BLAST/PSIBLAST alignment of GI: 254780790 and GI: 190889939 at iteration 1
>gi|190889939|ref|YP_001976481.1| hypothetical protein [Rhizobium etli CIAT 652] Length = 124
>gi|190695218|gb|ACE89303.1| hypothetical conserved membrane protein [Rhizobium etli CIAT 652] Length = 124
 Score = 72.4 bits (176), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 43/123 (34%), Positives = 67/123 (54%), Gaps = 1/123 (0%)

Query: 1   MKQCIIFIINIVVVFFIDVMGFFILMKCGA-DPFYSRIFSIAVAFLVTWIPSRLFIFLKL 59
           MK+ I F I   + F +D      L+      PF +R+ +IA+A   TW+ +R F F + 
Sbjct: 1   MKKLIRFAIAGGIGFLVDAGVLSALLSLTPLGPFVARLIAIALAMASTWVFNRNFTFDRS 60

Query: 60  RRKSFLETVRYGVMYFMLSILNYAFYVKLLLTFQGLQPLLATVLSAVSSMLFVFLLYIRF 119
            R    E  RYG +    +++NY  Y  LLL+  GLQPL A V++++++M+F F  Y R 
Sbjct: 61  GRSLAAEGFRYGSVGITAALVNYGLYSALLLSLPGLQPLAAMVVASIAAMVFSFFGYSRL 120

Query: 120 MTR 122
           + R
Sbjct: 121 VFR 123