BLASTP 2.2.22 [Sep-27-2009]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.


Reference for composition-based statistics:
Schaffer, Alejandro A., L. Aravind, Thomas L. Madden,
Sergei Shavirin, John L. Spouge, Yuri I. Wolf,  
Eugene V. Koonin, and Stephen F. Altschul (2001), 
"Improving the accuracy of PSI-BLAST protein database searches with 
composition-based statistics and other refinements",  Nucleic Acids Res. 29:2994-3005.

Query= gi|254780790|ref|YP_003065203.1| hypothetical protein
CLIBASIA_03405 [Candidatus Liberibacter asiaticus str. psy62]
         (129 letters)

Database: nr 
           14,124,377 sequences; 4,842,793,630 total letters

Searching..................................................done



>gi|238062716|ref|ZP_04607425.1| GtrA family protein [Micromonospora sp. ATCC 39149]
 gi|237884527|gb|EEP73355.1| GtrA family protein [Micromonospora sp. ATCC 39149]
          Length = 253

 Score = 96.5 bits (239), Expect = 1e-18,   Method: Composition-based stats.
 Identities = 14/128 (10%), Positives = 42/128 (32%), Gaps = 6/128 (4%)

Query: 1   MKQCIIFIINIVVVFFIDVMGFFIL--MKCGADPFYSRIFSIAVAFLVTWIPSRLFIFLK 58
           +++ + F +   +   ++   F  L           + + +  VA + +++ +R + +  
Sbjct: 15  VREALKFGVVGGINTALNYAVFNALALTVFRDGQLKATVIATVVATITSYLMNRHWTYRD 74

Query: 59  LRRKS-FLETVRYGVMYFMLSILNYAFYVKLLLTF---QGLQPLLATVLSAVSSMLFVFL 114
             + +   E   + +      ++                 L   +A     +   LF F 
Sbjct: 75  RPKSAMRREYALFFLFNATGLLIELGVLAAAKYGLGVTGLLALNVAKTGGVLLGTLFRFW 134

Query: 115 LYIRFMTR 122
            Y  F+ +
Sbjct: 135 SYRTFVFQ 142



 Score = 43.0 bits (100), Expect = 0.013,   Method: Composition-based stats.
 Identities = 18/65 (27%), Positives = 34/65 (52%)

Query: 58  KLRRKSFLETVRYGVMYFMLSILNYAFYVKLLLTFQGLQPLLATVLSAVSSMLFVFLLYI 117
           +  +K   E +++GV+  + + LNYA +  L LT      L ATV++ V + +  +L+  
Sbjct: 9   ERWQKFVREALKFGVVGGINTALNYAVFNALALTVFRDGQLKATVIATVVATITSYLMNR 68

Query: 118 RFMTR 122
            +  R
Sbjct: 69  HWTYR 73


>gi|119484333|ref|ZP_01618950.1| Glycosyl transferase, family 2 [Lyngbya sp. PCC 8106]
 gi|119457807|gb|EAW38930.1| Glycosyl transferase, family 2 [Lyngbya sp. PCC 8106]
          Length = 413

 Score = 95.3 bits (236), Expect = 2e-18,   Method: Composition-based stats.
 Identities = 25/134 (18%), Positives = 55/134 (41%), Gaps = 7/134 (5%)

Query: 1   MKQCIIFIINIVVVFFIDVMGFFILMKCGADPFYSRIFSIAVAFLVTWIPSRLFIF---- 56
           +K+ + F +  +   F+D+  F++    G     S I S  +A +  ++ +  + F    
Sbjct: 276 VKRFLRFGVVGLSGVFVDLTMFYLFRHLGLGLTLSVILSGEIAIVNNFLWNDRWTFADLT 335

Query: 57  --LKLRRKSFLETVRYGVMYFMLSILNYAFYVKLLLTFQGLQPLLATVLSAVSSMLFVFL 114
              +   K F   +++ ++     +LN A  V LL    G+   LA +++      + F 
Sbjct: 336 HQQRSWTKGFKRFLKFNIICLTGLVLN-AIIVNLLSRGLGMNEYLAKLIAIALVTFWNFW 394

Query: 115 LYIRFMTRRVYFIK 128
           + ++   R     K
Sbjct: 395 VNLKLSWRVTQVDK 408


>gi|152967850|ref|YP_001363634.1| GtrA family protein [Kineococcus radiotolerans SRS30216]
 gi|151362367|gb|ABS05370.1| GtrA family protein [Kineococcus radiotolerans SRS30216]
          Length = 206

 Score = 95.0 bits (235), Expect = 3e-18,   Method: Composition-based stats.
 Identities = 29/133 (21%), Positives = 48/133 (36%), Gaps = 13/133 (9%)

Query: 2   KQCIIFIINIVVVFFIDVMGFFILMK--------CGADPFYSRIFSIAVAFLVTWIPSRL 53
           ++   F I   V F  D   F +L              P  + + S  V+ LV W+ +R 
Sbjct: 21  REAAKFGIVGAVAFVTDFGVFNLLRYAGPDGVGVLHHKPLTANVISTVVSILVAWLGNRY 80

Query: 54  FIFLKLRRKSF-LETVRYGVMYFMLSILNYAF----YVKLLLTFQGLQPLLATVLSAVSS 108
           + F    R S   E V +  M  +  +++       Y  L L       + A ++     
Sbjct: 81  WTFRHRHRASAPRELVLFFAMNGVGLLISLVCLGFTYYVLDLRGPVASNVSAKIVGVALG 140

Query: 109 MLFVFLLYIRFMT 121
            LF +  Y RF+ 
Sbjct: 141 TLFRWWAYRRFVF 153



 Score = 37.6 bits (86), Expect = 0.67,   Method: Composition-based stats.
 Identities = 13/70 (18%), Positives = 28/70 (40%), Gaps = 6/70 (8%)

Query: 63  SFLETVRYGVMYFMLSILNYAFYVKLLLTFQ------GLQPLLATVLSAVSSMLFVFLLY 116
              E  ++G++  +  + ++  +  L             +PL A V+S V S+L  +L  
Sbjct: 19  LAREAAKFGIVGAVAFVTDFGVFNLLRYAGPDGVGVLHHKPLTANVISTVVSILVAWLGN 78

Query: 117 IRFMTRRVYF 126
             +  R  + 
Sbjct: 79  RYWTFRHRHR 88


>gi|240103717|ref|YP_002960026.1| Dolichol-phosphate mannosyltransferase (dpm1) [Thermococcus
           gammatolerans EJ3]
 gi|239911271|gb|ACS34162.1| Dolichol-phosphate mannosyltransferase (dpm1) [Thermococcus
           gammatolerans EJ3]
          Length = 403

 Score = 94.6 bits (234), Expect = 4e-18,   Method: Composition-based stats.
 Identities = 19/122 (15%), Positives = 50/122 (40%), Gaps = 3/122 (2%)

Query: 1   MKQCIIFIINIVVVFFIDVMGFFILMKCGADPFYSRIFSIAVAFLVTWIPSRLFIFLK-L 59
           + + + F I  +    ++    ++ +  G   + + + +  +A L  ++ + L+ F    
Sbjct: 283 LDRLVKFSIVGLSGILVNEGFLWLFVHLGLSKYVANVPATELAILNNFLWNDLWTFRDLR 342

Query: 60  RRKSFLETVRYGVMYFMLSILNYAFYVKLLLTFQGLQPLLATVLSAVSSMLFVFLLYIRF 119
               +   + + +   M +++ +A YV   L + GL  L+A ++    S +  FL     
Sbjct: 343 TAPLWRRLLSFHIAALMGALVQWAIYV--PLVYLGLHYLIANLIGIGVSFIIRFLFNRNV 400

Query: 120 MT 121
             
Sbjct: 401 TW 402



 Score = 44.1 bits (103), Expect = 0.007,   Method: Composition-based stats.
 Identities = 8/56 (14%), Positives = 25/56 (44%)

Query: 2   KQCIIFIINIVVVFFIDVMGFFILMKCGADPFYSRIFSIAVAFLVTWIPSRLFIFL 57
           ++ + F I  ++   +    +  L+  G     + +  I V+F++ ++ +R   + 
Sbjct: 348 RRLLSFHIAALMGALVQWAIYVPLVYLGLHYLIANLIGIGVSFIIRFLFNRNVTWG 403



 Score = 38.0 bits (87), Expect = 0.49,   Method: Composition-based stats.
 Identities = 12/64 (18%), Positives = 23/64 (35%), Gaps = 2/64 (3%)

Query: 59  LRRKSFLETVRYGVMYFMLSILNYAFYVKLLLTFQGLQPLLATVLSAVSSMLFVFLLYIR 118
                    V++ ++     ++N  F    L    GL   +A V +   ++L  FL    
Sbjct: 278 RWSGELDRLVKFSIVGLSGILVNEGFL--WLFVHLGLSKYVANVPATELAILNNFLWNDL 335

Query: 119 FMTR 122
           +  R
Sbjct: 336 WTFR 339


>gi|238062717|ref|ZP_04607426.1| GtrA family protein [Micromonospora sp. ATCC 39149]
 gi|237884528|gb|EEP73356.1| GtrA family protein [Micromonospora sp. ATCC 39149]
          Length = 257

 Score = 91.9 bits (227), Expect = 3e-17,   Method: Composition-based stats.
 Identities = 20/133 (15%), Positives = 43/133 (32%), Gaps = 12/133 (9%)

Query: 1   MKQCIIFIINIVVVFFIDVMGFFILMKC-GADPFYSRIFSIAVAFLVTWIPSRLFIFLKL 59
           +++   F     V F +D   F  L    G +   ++  S  +A  V ++ +R + +   
Sbjct: 106 VRELSKFATVGSVAFLVDFALFNYLANARGVEQVTAKTISTVIAATVAFLGNRFWTWRHR 165

Query: 60  RRK-SFLETVRYGVMYFMLSILNYAFYVKLLLTFQGLQP----------LLATVLSAVSS 108
           +R     E   +     +   +              + P          + + ++     
Sbjct: 166 QRSNPAREYALFFFFNSVGLGIAVGCLAISRYGLGAIWPEIFQTALADNIASFIVGTGLG 225

Query: 109 MLFVFLLYIRFMT 121
            LF F  Y RF+ 
Sbjct: 226 TLFRFWSYRRFVF 238



 Score = 36.4 bits (83), Expect = 1.3,   Method: Composition-based stats.
 Identities = 10/61 (16%), Positives = 26/61 (42%), Gaps = 1/61 (1%)

Query: 62  KSFLETVRYGVMYFMLSILNYAFYVKLLLTFQGLQPLLATVLSAVSSMLFVFLLYIRFMT 121
               E  ++  +  +  ++++A +   L   +G++ + A  +S V +    FL    +  
Sbjct: 104 HLVRELSKFATVGSVAFLVDFALFNY-LANARGVEQVTAKTISTVIAATVAFLGNRFWTW 162

Query: 122 R 122
           R
Sbjct: 163 R 163


>gi|166366940|ref|YP_001659213.1| dolichyl-phosphate-mannose synthase [Microcystis aeruginosa
           NIES-843]
 gi|166089313|dbj|BAG04021.1| dolichyl-phosphate-mannose synthase [Microcystis aeruginosa
           NIES-843]
          Length = 425

 Score = 91.5 bits (226), Expect = 3e-17,   Method: Composition-based stats.
 Identities = 16/131 (12%), Positives = 49/131 (37%), Gaps = 10/131 (7%)

Query: 1   MKQCIIFIINIVVVFFIDVMGFFIL---MKCGADPFYSRIFSIAVAFLVTWIPSRLFIFL 57
           + + + F +      F+D+  F++L            S+I +  VA +  ++ +  + F 
Sbjct: 284 LARFLRFSLVGFSGVFVDMAIFYLLSDPTTLAWGVTRSKIIAAEVAIINNFLWNDRWTFG 343

Query: 58  K------LRRKSFLETVRYGVMYFMLSILNYAFYVKLLLTFQGLQPLLATVLSAVSSMLF 111
                    ++     +++ ++     ILN    +        +   +A +++     ++
Sbjct: 344 DLSTGQNQWQQRCKRFLKFNLICLAGLILN-VLLLNFFFNVLHINRYIANLIAIAIVTVW 402

Query: 112 VFLLYIRFMTR 122
            F + ++   R
Sbjct: 403 NFWMNLKLSWR 413


>gi|184201396|ref|YP_001855603.1| hypothetical protein KRH_17500 [Kocuria rhizophila DC2201]
 gi|183581626|dbj|BAG30097.1| hypothetical membrane protein [Kocuria rhizophila DC2201]
          Length = 241

 Score = 91.1 bits (225), Expect = 4e-17,   Method: Composition-based stats.
 Identities = 22/129 (17%), Positives = 51/129 (39%), Gaps = 8/129 (6%)

Query: 1   MKQCIIFIINIVVVFFIDVMGFFILMK---CGADPFYSRIFSIAVAFLVTWIPSRLFIFL 57
           +K+   F +     F I+    ++LM           +++ +  VA + +W+ +R++ F 
Sbjct: 51  VKELTKFGLVGAAAFVINASLVWLLMHTPYFADSHIKAKVVATVVAIIFSWVANRMWTFR 110

Query: 58  KLRR-KSFLETVRYGVMYFMLSILNYAF----YVKLLLTFQGLQPLLATVLSAVSSMLFV 112
             R+     E V++ V   +   +        Y  L LT      +  T++  +   +F 
Sbjct: 111 DKRQDDKKKELVQFLVANGIGMAIELGCLGVSYYVLGLTSATASFVSGTIIGTILGTVFR 170

Query: 113 FLLYIRFMT 121
           +  Y  ++ 
Sbjct: 171 YFAYRFWVF 179



 Score = 40.3 bits (93), Expect = 0.100,   Method: Composition-based stats.
 Identities = 10/59 (16%), Positives = 27/59 (45%), Gaps = 1/59 (1%)

Query: 65  LETVRYGVMYFMLSILNYAFYVKLLLTFQGLQPLL-ATVLSAVSSMLFVFLLYIRFMTR 122
            E  ++G++     ++N +    L+ T       + A V++ V +++F ++    +  R
Sbjct: 52  KELTKFGLVGAAAFVINASLVWLLMHTPYFADSHIKAKVVATVVAIIFSWVANRMWTFR 110


>gi|290959874|ref|YP_003491056.1| cell surface polysaccharide biosynthesis protein [Streptomyces
           scabiei 87.22]
 gi|260649400|emb|CBG72515.1| putative cell surface polysaccharide biosynthesis protein
           [Streptomyces scabiei 87.22]
          Length = 213

 Score = 90.3 bits (223), Expect = 7e-17,   Method: Composition-based stats.
 Identities = 17/127 (13%), Positives = 42/127 (33%), Gaps = 5/127 (3%)

Query: 1   MKQCIIFIINIVVVFFIDVMGFFILMKCGADPFY-SRIFSIAVAFLVTWIPSRLFIFLKL 59
           +++ + F     V   +++  F ++          + + +  VA    ++  R F +   
Sbjct: 57  VREVVKFGAVGGVGLLVNLAVFNLVRHTTELQVVRASVIATVVAIACNYVGFRYFTYRDR 116

Query: 60  RRK-SFLETVRYGVMYFMLSILNYAFYVKLLLTFQGLQPLLA---TVLSAVSSMLFVFLL 115
            +     E   + +   +  ++           F    PL +     L    + LF F  
Sbjct: 117 DKSGRTKEMSLFLLFSAVGLVIENGVLYTATYGFDWDTPLQSNVFKFLGIGVATLFRFWS 176

Query: 116 YIRFMTR 122
           Y  ++ R
Sbjct: 177 YRTWVFR 183


>gi|145593418|ref|YP_001157715.1| GtrA family protein [Salinispora tropica CNB-440]
 gi|145302755|gb|ABP53337.1| GtrA family protein [Salinispora tropica CNB-440]
          Length = 267

 Score = 90.3 bits (223), Expect = 7e-17,   Method: Composition-based stats.
 Identities = 19/133 (14%), Positives = 41/133 (30%), Gaps = 12/133 (9%)

Query: 1   MKQCIIFIINIVVVFFIDVMGFFILMKCG-ADPFYSRIFSIAVAFLVTWIPSRLFIFLKL 59
           + +   F     V F +D   F +L      +   ++  S  VA    ++ +R + +   
Sbjct: 117 VHELSKFATVGGVAFIVDFALFNLLTSVQDMEQVTAKTISTVVAATFAFLGNRFWTWRHR 176

Query: 60  RRK-SFLETVRYGVMYFMLSILNYAFYVKLLLTF----------QGLQPLLATVLSAVSS 108
           R      E   + +   +   +  A                        + + ++    +
Sbjct: 177 RGGNPAREYALFFIFNAVGLGITVAVLAISRYGLGQIWPEVFQTPLADNIASYLVGTGLA 236

Query: 109 MLFVFLLYIRFMT 121
            LF F  Y RF+ 
Sbjct: 237 TLFRFWSYRRFVF 249



 Score = 36.0 bits (82), Expect = 1.7,   Method: Composition-based stats.
 Identities = 12/61 (19%), Positives = 27/61 (44%), Gaps = 1/61 (1%)

Query: 62  KSFLETVRYGVMYFMLSILNYAFYVKLLLTFQGLQPLLATVLSAVSSMLFVFLLYIRFMT 121
               E  ++  +  +  I+++A +   L + Q ++ + A  +S V +  F FL    +  
Sbjct: 115 HLVHELSKFATVGGVAFIVDFALFNL-LTSVQDMEQVTAKTISTVVAATFAFLGNRFWTW 173

Query: 122 R 122
           R
Sbjct: 174 R 174


>gi|86608476|ref|YP_477238.1| glycosyl transferase, group 2 [Synechococcus sp. JA-2-3B'a(2-13)]
 gi|86557018|gb|ABD01975.1| glycosyl transferase, group 2 [Synechococcus sp. JA-2-3B'a(2-13)]
          Length = 407

 Score = 90.0 bits (222), Expect = 1e-16,   Method: Composition-based stats.
 Identities = 23/128 (17%), Positives = 50/128 (39%), Gaps = 10/128 (7%)

Query: 4   CIIFIINIVVVFFIDVMGFFIL---MKCGADPFYSRIFSIAVAFLVTWIPSRLFIFLKLR 60
            + F    +    +D+   ++L      G D   S++ +  VA L  ++ + L+ F  + 
Sbjct: 268 FLRFSTVGLSGTLVDMALLYVLHDPTNLGWDLITSKLVASEVAILNNFLWNDLWTFRHVT 327

Query: 61  R------KSFLETVRYGVMYFMLSILNYAFYVKLLLTFQGLQPLLATVLSAVSSMLFVFL 114
           R             ++ V+  +  +LN +     L    G+  LLA +++    + + F 
Sbjct: 328 RLQPGPWNRLKRLAKFNVICLIGLVLNTSLVTL-LSERLGIHYLLANLIAIGIVVFWNFY 386

Query: 115 LYIRFMTR 122
           L  +   R
Sbjct: 387 LNSKLSWR 394



 Score = 42.6 bits (99), Expect = 0.019,   Method: Composition-based stats.
 Identities = 5/60 (8%), Positives = 21/60 (35%), Gaps = 1/60 (1%)

Query: 1   MKQCIIFIINIVVVFFIDVMGFFILM-KCGADPFYSRIFSIAVAFLVTWIPSRLFIFLKL 59
           +K+   F +  ++   ++     +L  + G     + + +I +     +  +    +   
Sbjct: 337 LKRLAKFNVICLIGLVLNTSLVTLLSERLGIHYLLANLIAIGIVVFWNFYLNSKLSWRSA 396



 Score = 37.2 bits (85), Expect = 0.67,   Method: Composition-based stats.
 Identities = 10/64 (15%), Positives = 28/64 (43%), Gaps = 1/64 (1%)

Query: 66  ETVRYGVMYFMLSILNYAFYVKLLL-TFQGLQPLLATVLSAVSSMLFVFLLYIRFMTRRV 124
             +R+  +    ++++ A    L   T  G   + + ++++  ++L  FL    +  R V
Sbjct: 267 SFLRFSTVGLSGTLVDMALLYVLHDPTNLGWDLITSKLVASEVAILNNFLWNDLWTFRHV 326

Query: 125 YFIK 128
             ++
Sbjct: 327 TRLQ 330


>gi|239941769|ref|ZP_04693706.1| hypothetical protein SrosN15_12284 [Streptomyces roseosporus NRRL
           15998]
 gi|239988229|ref|ZP_04708893.1| hypothetical protein SrosN1_13061 [Streptomyces roseosporus NRRL
           11379]
 gi|291445214|ref|ZP_06584604.1| integral membrane protein [Streptomyces roseosporus NRRL 15998]
 gi|291348161|gb|EFE75065.1| integral membrane protein [Streptomyces roseosporus NRRL 15998]
          Length = 192

 Score = 89.6 bits (221), Expect = 1e-16,   Method: Composition-based stats.
 Identities = 16/126 (12%), Positives = 42/126 (33%), Gaps = 5/126 (3%)

Query: 2   KQCIIFIINIVVVFFIDVMGFFILMKCGADPFY-SRIFSIAVAFLVTWIPSRLFIFLKLR 60
           ++   F     V   +++  F +L          + + +  VA L  ++  R + +    
Sbjct: 16  REVAKFGAVGAVGLLVNIAVFNLLRHTTDLQVVRASVLATFVAILCNYVGFRYWTYRDRD 75

Query: 61  R-KSFLETVRYGVMYFMLSILNYAFYVKLLLTFQGLQPLLA---TVLSAVSSMLFVFLLY 116
           +     E   + +     +++           F    P+ +    +L    + LF F  Y
Sbjct: 76  KTGRTRELTLFLLFSAAGAVIENGVLYLATYGFDWNSPVQSNVFKILGIGIATLFRFWSY 135

Query: 117 IRFMTR 122
             ++ +
Sbjct: 136 RTWVFK 141



 Score = 35.6 bits (81), Expect = 2.5,   Method: Composition-based stats.
 Identities = 13/60 (21%), Positives = 29/60 (48%), Gaps = 1/60 (1%)

Query: 63  SFLETVRYGVMYFMLSILNYAFYVKLLLTFQGLQPLLATVLSAVSSMLFVFLLYIRFMTR 122
              E  ++G +  +  ++N A +  L  T   LQ + A+VL+   ++L  ++ +  +  R
Sbjct: 14  LAREVAKFGAVGAVGLLVNIAVFNLLRHTT-DLQVVRASVLATFVAILCNYVGFRYWTYR 72


>gi|302865355|ref|YP_003833992.1| GtrA family protein [Micromonospora aurantiaca ATCC 27029]
 gi|302568214|gb|ADL44416.1| GtrA family protein [Micromonospora aurantiaca ATCC 27029]
          Length = 231

 Score = 89.2 bits (220), Expect = 2e-16,   Method: Composition-based stats.
 Identities = 17/131 (12%), Positives = 45/131 (34%), Gaps = 6/131 (4%)

Query: 1   MKQCIIFIINIVVVFFIDVMGFFIL--MKCGADPFYSRIFSIAVAFLVTWIPSRLFIFLK 58
           + + + F I   +   I+   F  L           + + +  +A + +++ +R + +  
Sbjct: 15  IHEALKFGIVGGINTVINYAVFNALALTVFRDGQLKATVIATIIATITSYLMNRHWTYRD 74

Query: 59  LRRKSFLE----TVRYGVMYFMLSILNYAFYVKLLLTFQGLQPLLATVLSAVSSMLFVFL 114
             + +          +     ++ +   A     L     L   +A  +  + + LF F 
Sbjct: 75  RPKSALRREYVLFFLFNGAGLLIELGVLALAKYGLGVHGLLALNVAKTIGVLLATLFRFW 134

Query: 115 LYIRFMTRRVY 125
            Y  F+ + V 
Sbjct: 135 SYRTFVFQPVP 145



 Score = 40.3 bits (93), Expect = 0.094,   Method: Composition-based stats.
 Identities = 15/65 (23%), Positives = 35/65 (53%)

Query: 58  KLRRKSFLETVRYGVMYFMLSILNYAFYVKLLLTFQGLQPLLATVLSAVSSMLFVFLLYI 117
           +  +K   E +++G++  + +++NYA +  L LT      L ATV++ + + +  +L+  
Sbjct: 9   ERWQKFIHEALKFGIVGGINTVINYAVFNALALTVFRDGQLKATVIATIIATITSYLMNR 68

Query: 118 RFMTR 122
            +  R
Sbjct: 69  HWTYR 73


>gi|271962877|ref|YP_003337073.1| membrane protein [Streptosporangium roseum DSM 43021]
 gi|270506052|gb|ACZ84330.1| membrane protein-like protein [Streptosporangium roseum DSM 43021]
          Length = 220

 Score = 89.2 bits (220), Expect = 2e-16,   Method: Composition-based stats.
 Identities = 19/126 (15%), Positives = 46/126 (36%), Gaps = 5/126 (3%)

Query: 1   MKQCIIFIINIVVVFFIDVMGFFILMK-CGADPFYSRIFSIAVAFLVTWIPSRLFIFLKL 59
           +++   F     + F ID  GF +L          S++ +  +A    +  +R + +   
Sbjct: 76  IRELSKFGTIGAIAFVIDTGGFNLLQYGLHWGTLTSKVIATVIATTFAYFGNRFWTYRHR 135

Query: 60  RRKS-FLETVRYGVMYFMLSILNYAFYVKLLLTFQGLQPL---LATVLSAVSSMLFVFLL 115
            +     E   + ++  +  ++          T +   PL   +A ++      LF F  
Sbjct: 136 EQSGLAREYFLFFLLNGVALLIGLLCIGFTRYTLELTDPLSINVANLIGIGLGTLFRFWS 195

Query: 116 YIRFMT 121
           Y +++ 
Sbjct: 196 YKKWVF 201



 Score = 33.7 bits (76), Expect = 9.5,   Method: Composition-based stats.
 Identities = 8/67 (11%), Positives = 23/67 (34%), Gaps = 1/67 (1%)

Query: 56  FLKLRRKSFLETVRYGVMYFMLSILNYAFYVKLLLTFQGLQPLLATVLSAVSSMLFVFLL 115
             +       E  ++G +  +  +++   +   L        L + V++ V +  F +  
Sbjct: 68  AYERLSGLIRELSKFGTIGAIAFVIDTGGFNL-LQYGLHWGTLTSKVIATVIATTFAYFG 126

Query: 116 YIRFMTR 122
              +  R
Sbjct: 127 NRFWTYR 133


>gi|315501899|ref|YP_004080786.1| gtra family protein [Micromonospora sp. L5]
 gi|315408518|gb|ADU06635.1| GtrA family protein [Micromonospora sp. L5]
          Length = 231

 Score = 89.2 bits (220), Expect = 2e-16,   Method: Composition-based stats.
 Identities = 18/131 (13%), Positives = 45/131 (34%), Gaps = 6/131 (4%)

Query: 1   MKQCIIFIINIVVVFFIDVMGFFIL--MKCGADPFYSRIFSIAVAFLVTWIPSRLFIFLK 58
           + + + F I   +   I+   F  L           + + +  VA + +++ +R + +  
Sbjct: 15  IHEALKFGIVGGINTVINYAVFNALALTVFRDGQLKATVIATIVATITSYLMNRHWTYRD 74

Query: 59  LRRKSFLE----TVRYGVMYFMLSILNYAFYVKLLLTFQGLQPLLATVLSAVSSMLFVFL 114
             + +          +     ++ +   A     L     L   +A  +  + + LF F 
Sbjct: 75  RPKSALRREYVLFFLFNGAGLLIELGVLALAKYGLGVHGLLALNVAKTIGVLLATLFRFW 134

Query: 115 LYIRFMTRRVY 125
            Y  F+ + V 
Sbjct: 135 SYRTFVFQPVP 145



 Score = 39.9 bits (92), Expect = 0.11,   Method: Composition-based stats.
 Identities = 15/65 (23%), Positives = 35/65 (53%)

Query: 58  KLRRKSFLETVRYGVMYFMLSILNYAFYVKLLLTFQGLQPLLATVLSAVSSMLFVFLLYI 117
           +  +K   E +++G++  + +++NYA +  L LT      L ATV++ + + +  +L+  
Sbjct: 9   ERWQKFIHEALKFGIVGGINTVINYAVFNALALTVFRDGQLKATVIATIVATITSYLMNR 68

Query: 118 RFMTR 122
            +  R
Sbjct: 69  HWTYR 73


>gi|330465766|ref|YP_004403509.1| gtra family protein [Verrucosispora maris AB-18-032]
 gi|328808737|gb|AEB42909.1| gtra family protein [Verrucosispora maris AB-18-032]
          Length = 239

 Score = 88.8 bits (219), Expect = 2e-16,   Method: Composition-based stats.
 Identities = 16/128 (12%), Positives = 42/128 (32%), Gaps = 6/128 (4%)

Query: 1   MKQCIIFIINIVVVFFIDVMGFFIL--MKCGADPFYSRIFSIAVAFLVTWIPSRLFIFLK 58
           + + + F +   +   I+   F  L           + + +  VA + +++ +R + +  
Sbjct: 15  IHEALKFGLVGGINTVINYAVFNALALTIFVDGQLKATVIATVVATITSYLMNRHWTYRD 74

Query: 59  LRRKSF-LETVRYGVMYFMLSILNYAFYVKLLLTFQGLQPL---LATVLSAVSSMLFVFL 114
             + +   E   + +      ++                 L   +A     V + LF F 
Sbjct: 75  RPKSAMQREYALFFLFNGAGLLIELGVLAAAKYGLGMTSLLALNVAKTGGVVLATLFRFW 134

Query: 115 LYIRFMTR 122
            Y  F+ +
Sbjct: 135 SYRTFVFQ 142



 Score = 41.0 bits (95), Expect = 0.059,   Method: Composition-based stats.
 Identities = 16/65 (24%), Positives = 35/65 (53%)

Query: 58  KLRRKSFLETVRYGVMYFMLSILNYAFYVKLLLTFQGLQPLLATVLSAVSSMLFVFLLYI 117
           +  +K   E +++G++  + +++NYA +  L LT      L ATV++ V + +  +L+  
Sbjct: 9   ERWQKFIHEALKFGLVGGINTVINYAVFNALALTIFVDGQLKATVIATVVATITSYLMNR 68

Query: 118 RFMTR 122
            +  R
Sbjct: 69  HWTYR 73


>gi|86605768|ref|YP_474531.1| glycosyl transferase, group 2 [Synechococcus sp. JA-3-3Ab]
 gi|86554310|gb|ABC99268.1| glycosyl transferase, group 2 [Synechococcus sp. JA-3-3Ab]
          Length = 407

 Score = 88.4 bits (218), Expect = 3e-16,   Method: Composition-based stats.
 Identities = 20/128 (15%), Positives = 51/128 (39%), Gaps = 10/128 (7%)

Query: 4   CIIFIINIVVVFFIDVMGFFILM---KCGADPFYSRIFSIAVAFLVTWIPSRLFIFLKLR 60
            + F    +    +D++  ++L      G D   S++ +  +A L  ++ + L+ F  + 
Sbjct: 268 FLRFSTVGLSGTVVDMVLLYLLHDPANLGWDLITSKLIASEMAILNNFLWNDLWTFRHVT 327

Query: 61  R------KSFLETVRYGVMYFMLSILNYAFYVKLLLTFQGLQPLLATVLSAVSSMLFVFL 114
           R             ++ ++  +   LN +  +  L    G+  LLA +++    + + F 
Sbjct: 328 RLQPGLSNRLKRLAKFNMICLIGLFLNSSLVIL-LSERLGIHYLLANLIAIGIVVFWNFY 386

Query: 115 LYIRFMTR 122
           L  +   +
Sbjct: 387 LNSKLSWK 394



 Score = 41.0 bits (95), Expect = 0.052,   Method: Composition-based stats.
 Identities = 6/60 (10%), Positives = 22/60 (36%), Gaps = 1/60 (1%)

Query: 1   MKQCIIFIINIVVVFFIDVMGFFILM-KCGADPFYSRIFSIAVAFLVTWIPSRLFIFLKL 59
           +K+   F +  ++  F++     +L  + G     + + +I +     +  +    +   
Sbjct: 337 LKRLAKFNMICLIGLFLNSSLVILLSERLGIHYLLANLIAIGIVVFWNFYLNSKLSWKSA 396



 Score = 36.0 bits (82), Expect = 1.8,   Method: Composition-based stats.
 Identities = 8/63 (12%), Positives = 26/63 (41%), Gaps = 1/63 (1%)

Query: 67  TVRYGVMYFMLSILNYAFYVKLLL-TFQGLQPLLATVLSAVSSMLFVFLLYIRFMTRRVY 125
            +R+  +    ++++      L      G   + + ++++  ++L  FL    +  R V 
Sbjct: 268 FLRFSTVGLSGTVVDMVLLYLLHDPANLGWDLITSKLIASEMAILNNFLWNDLWTFRHVT 327

Query: 126 FIK 128
            ++
Sbjct: 328 RLQ 330


>gi|291570869|dbj|BAI93141.1| putative dolichol-phosphate mannosyltransferase [Arthrospira
           platensis NIES-39]
          Length = 423

 Score = 88.0 bits (217), Expect = 4e-16,   Method: Composition-based stats.
 Identities = 20/129 (15%), Positives = 49/129 (37%), Gaps = 8/129 (6%)

Query: 1   MKQCIIFIINIVVVFFIDVMGFFILM-KCGADPFYSRIFSIAVAFLVTWIPSRLFIFLK- 58
           + +   F +      F+D+  F++L+   G     S + S  +A +  +I +  + F   
Sbjct: 290 VGRFFRFAVVGFSGLFVDMAIFYLLLDGWGLPLTLSAVLSAEMAIINNFIWNDQWTFRDL 349

Query: 59  -----LRRKSFLETVRYGVMYFMLSILNYAFYVKLLLTFQGLQPLLATVLSAVSSMLFVF 113
                   +     +++ ++  M   LN       L++  GL   +A + +      + F
Sbjct: 350 SRQQSGGHRRLKRLLKFNLICLMGLGLNVIILNL-LVSVLGLNAYMAKLGAIAIVTFWNF 408

Query: 114 LLYIRFMTR 122
            + ++   R
Sbjct: 409 WVNLKLSWR 417


>gi|300087708|ref|YP_003758230.1| Dolichyl-phosphate beta-D-mannosyltransferase [Dehalogenimonas
           lykanthroporepellens BL-DC-9]
 gi|299527441|gb|ADJ25909.1| Dolichyl-phosphate beta-D-mannosyltransferase [Dehalogenimonas
           lykanthroporepellens BL-DC-9]
          Length = 360

 Score = 88.0 bits (217), Expect = 4e-16,   Method: Composition-based stats.
 Identities = 14/126 (11%), Positives = 43/126 (34%), Gaps = 5/126 (3%)

Query: 1   MKQCIIFIINIVVVFFIDVMGFFILM-KCGADPFYSRIFSIAVAFLVTWIPSRLFIFLKL 59
           + + + F+        +++    +L  +       +   +   A +  +I +  F F   
Sbjct: 236 LTRIMKFVAVGASGTLVNLGILALLTEQASFPYLIAGTVAFLTAVIWNFIWNDRFTFGDR 295

Query: 60  R---RKSFLETVRYGVMYFMLSILNYAFYVKLLLTFQGLQPLLATVLSAVSSMLFVFLLY 116
                  +   +R+ ++     ++     +  L    G+  +++ V   V +  + FL  
Sbjct: 296 GNAKHGFWNRLLRFNLVSLGGLLIYLGV-MAFLTEVTGIHYMISAVAGIVLAFGWNFLSN 354

Query: 117 IRFMTR 122
             +  R
Sbjct: 355 NWWTWR 360


>gi|119898671|ref|YP_933884.1| glycosyltransferase [Azoarcus sp. BH72]
 gi|119671084|emb|CAL94997.1| glycosyltransferase [Azoarcus sp. BH72]
          Length = 368

 Score = 87.6 bits (216), Expect = 5e-16,   Method: Composition-based stats.
 Identities = 15/123 (12%), Positives = 51/123 (41%), Gaps = 2/123 (1%)

Query: 2   KQCIIFIINIVVVFFIDVMGFFILMKCGADPFYSRIFSIAVAFLVTWIPSRLFIFLKLRR 61
           +  I F +  +    +++  F   +  G + F +   +I V+ +  ++ +  + F   + 
Sbjct: 241 RVFIKFALVGLSGVAVNLGAFAAFLALGMNKFVASPLAIEVSIVSNFLLNNYWTFRWRKT 300

Query: 62  KSFLE--TVRYGVMYFMLSILNYAFYVKLLLTFQGLQPLLATVLSAVSSMLFVFLLYIRF 119
           +  +    +++ V+  +   ++++ +  +   +  L P +  +     +ML  + L   +
Sbjct: 301 RDRVRVKGLKFNVVSLVALGVSFSTFAAVSSLYPALPPWVPQLAGIPPAMLVNYFLNSYW 360

Query: 120 MTR 122
             R
Sbjct: 361 TFR 363



 Score = 41.0 bits (95), Expect = 0.057,   Method: Composition-based stats.
 Identities = 13/75 (17%), Positives = 32/75 (42%), Gaps = 6/75 (8%)

Query: 48  WIPSRLFIFLKLRRKSFLETVRYGVMYFMLSILNYAFYVKLLLTFQGLQPLLATVLSAVS 107
           ++ +  +I    R +S    +++ ++      +N   +   L    G+   +A+ L+   
Sbjct: 228 FVWNAWWI----RLQSSRVFIKFALVGLSGVAVNLGAFAAFL--ALGMNKFVASPLAIEV 281

Query: 108 SMLFVFLLYIRFMTR 122
           S++  FLL   +  R
Sbjct: 282 SIVSNFLLNNYWTFR 296


>gi|145225326|ref|YP_001136004.1| GtrA family protein [Mycobacterium gilvum PYR-GCK]
 gi|145217812|gb|ABP47216.1| GtrA family protein [Mycobacterium gilvum PYR-GCK]
          Length = 227

 Score = 87.3 bits (215), Expect = 7e-16,   Method: Composition-based stats.
 Identities = 28/134 (20%), Positives = 52/134 (38%), Gaps = 15/134 (11%)

Query: 3   QCIIFIINIVVVFFIDVMGFFIL--MKCGADPFYSRIFSIAVAFLVTWIPSRLFIFLKL- 59
           + I F I     F ID   FF L        P  ++I +  VA + ++I +R + F    
Sbjct: 24  ELIKFAIVGATTFVIDSAIFFTLKLTILEPKPVTAKIIAGIVAVIASYILNREWSFRDRG 83

Query: 60  RRKSFLETVRYGVMYFMLSILNYA------------FYVKLLLTFQGLQPLLATVLSAVS 107
            R+   E + +  +  +  +L+ A              +  L+T      + A ++  + 
Sbjct: 84  GRERHHEALLFFGVSGVGVLLSMAPLWVSSYVLMLRVPMVSLMTENIADFVSAYIIGNLL 143

Query: 108 SMLFVFLLYIRFMT 121
            M F F  + RF+ 
Sbjct: 144 QMAFRFWAFRRFVF 157



 Score = 39.9 bits (92), Expect = 0.11,   Method: Composition-based stats.
 Identities = 9/60 (15%), Positives = 30/60 (50%)

Query: 63  SFLETVRYGVMYFMLSILNYAFYVKLLLTFQGLQPLLATVLSAVSSMLFVFLLYIRFMTR 122
              E +++ ++     +++ A +  L LT    +P+ A +++ + +++  ++L   +  R
Sbjct: 21  RHHELIKFAIVGATTFVIDSAIFFTLKLTILEPKPVTAKIIAGIVAVIASYILNREWSFR 80


>gi|284050713|ref|ZP_06380923.1| GtrA family protein [Arthrospira platensis str. Paraca]
          Length = 423

 Score = 87.3 bits (215), Expect = 7e-16,   Method: Composition-based stats.
 Identities = 20/129 (15%), Positives = 49/129 (37%), Gaps = 8/129 (6%)

Query: 1   MKQCIIFIINIVVVFFIDVMGFFILM-KCGADPFYSRIFSIAVAFLVTWIPSRLFIFLK- 58
           + +   F +      F+D+  F++L+   G     S + S  +A +  +I +  + F   
Sbjct: 290 VGRFFRFAVVGFSGLFVDMAIFYLLLDGWGLPLTLSAVLSAEMAIINNFIWNDQWTFRDL 349

Query: 59  -----LRRKSFLETVRYGVMYFMLSILNYAFYVKLLLTFQGLQPLLATVLSAVSSMLFVF 113
                   +     +++ ++  M   LN       L++  GL   +A + +      + F
Sbjct: 350 SRQQSGGHQRLKRLLKFNLICLMGLGLNVIILNL-LVSVLGLNAYMAKLGAIAIVTFWNF 408

Query: 114 LLYIRFMTR 122
            + ++   R
Sbjct: 409 WVNLKLSWR 417


>gi|209525942|ref|ZP_03274476.1| Dolichyl-phosphate beta-D-mannosyltransferase [Arthrospira maxima
           CS-328]
 gi|209493619|gb|EDZ93940.1| Dolichyl-phosphate beta-D-mannosyltransferase [Arthrospira maxima
           CS-328]
          Length = 425

 Score = 86.9 bits (214), Expect = 8e-16,   Method: Composition-based stats.
 Identities = 20/129 (15%), Positives = 49/129 (37%), Gaps = 8/129 (6%)

Query: 1   MKQCIIFIINIVVVFFIDVMGFFILM-KCGADPFYSRIFSIAVAFLVTWIPSRLFIFLK- 58
           + +   F +      F+D+  F++L+   G     S + S  +A +  +I +  + F   
Sbjct: 292 VGRFARFAVVGFSGLFVDMAIFYLLLDGWGLPLTLSAVLSAEMAIINNFIWNDQWTFRDL 351

Query: 59  -----LRRKSFLETVRYGVMYFMLSILNYAFYVKLLLTFQGLQPLLATVLSAVSSMLFVF 113
                   +     +++ ++  M   LN       L++  GL   +A + +      + F
Sbjct: 352 SRQQSGGHRKLKRLLKFNLICLMGLGLNVIILNL-LVSVLGLNAYMAKLGAIAIVTFWNF 410

Query: 114 LLYIRFMTR 122
            + ++   R
Sbjct: 411 WVNLKLSWR 419


>gi|256380365|ref|YP_003104025.1| GtrA family protein [Actinosynnema mirum DSM 43827]
 gi|255924668|gb|ACU40179.1| GtrA family protein [Actinosynnema mirum DSM 43827]
          Length = 184

 Score = 86.9 bits (214), Expect = 9e-16,   Method: Composition-based stats.
 Identities = 23/135 (17%), Positives = 49/135 (36%), Gaps = 15/135 (11%)

Query: 2   KQCIIFIINIVVVFFIDVMGFFIL--MKCGADPFYSRIFSIAVAFLVTWIPSRLFIFLKL 59
           ++ + F +     F ID   FF L        P  ++I +  VA +V+++ +R + F   
Sbjct: 24  RELLKFALVGGTCFVIDTAIFFALKSTVLLEKPVTAKIVATLVATIVSYVLNREWSFKTR 83

Query: 60  -RRKSFLETVRYGVMYFMLSILNYAFYVKLLLTFQG------------LQPLLATVLSAV 106
             R+   E   + ++  +  +LN          F                   A ++  +
Sbjct: 84  GGRERHHEAALFFLVNGIGIVLNSMPLWVSRYLFHLQEPEVSRLVQEVSDFASAQIIGTL 143

Query: 107 SSMLFVFLLYIRFMT 121
             M F +  Y +++ 
Sbjct: 144 IGMAFRWYGYKKWVF 158



 Score = 39.9 bits (92), Expect = 0.12,   Method: Composition-based stats.
 Identities = 7/59 (11%), Positives = 28/59 (47%)

Query: 64  FLETVRYGVMYFMLSILNYAFYVKLLLTFQGLQPLLATVLSAVSSMLFVFLLYIRFMTR 122
             E +++ ++     +++ A +  L  T    +P+ A +++ + + +  ++L   +  +
Sbjct: 23  HRELLKFALVGGTCFVIDTAIFFALKSTVLLEKPVTAKIVATLVATIVSYVLNREWSFK 81


>gi|18976430|ref|NP_577787.1| dolichol monophosphate mannose synthase [Pyrococcus furiosus DSM
           3638]
 gi|18891964|gb|AAL80182.1| dolichol monophosphate mannose synthase [Pyrococcus furiosus DSM
           3638]
          Length = 352

 Score = 86.9 bits (214), Expect = 9e-16,   Method: Composition-based stats.
 Identities = 17/122 (13%), Positives = 51/122 (41%), Gaps = 3/122 (2%)

Query: 1   MKQCIIFIINIVVVFFIDVMGFFILMKCGADPFYSRIFSIAVAFLVTWIPSRLFIFLK-L 59
           + + + F I  +    ++    ++ +  G     + I ++ ++ L  +  + ++ F    
Sbjct: 231 IDRIVKFSIVGLSGILVNEGFLWLFVNLGIPKEIAVIPAVELSILNNFFWNDIWTFKDIR 290

Query: 60  RRKSFLETVRYGVMYFMLSILNYAFYVKLLLTFQGLQPLLATVLSAVSSMLFVFLLYIRF 119
           R   F   +++ +     +++N+  Y   +L F G+  L+A ++  V S    +++    
Sbjct: 291 RGSIFSRLLKFHIAALSGAVVNFIVY--WILLFLGIHYLIANLVGIVLSFGVRYVINRHV 348

Query: 120 MT 121
             
Sbjct: 349 TW 350


>gi|126661601|ref|ZP_01732632.1| dolichyl-phosphate-mannose synthase [Cyanothece sp. CCY0110]
 gi|126617114|gb|EAZ87952.1| dolichyl-phosphate-mannose synthase [Cyanothece sp. CCY0110]
          Length = 422

 Score = 86.9 bits (214), Expect = 1e-15,   Method: Composition-based stats.
 Identities = 19/129 (14%), Positives = 49/129 (37%), Gaps = 10/129 (7%)

Query: 3   QCIIFIINIVVVFFIDVMGFFILM---KCGADPFYSRIFSIAVAFLVTWIPSRLFIFLK- 58
           + I F +  +    +D+   ++L      G     S+I +  +A +  ++ + L+ F   
Sbjct: 289 RFIQFCLVGLSGVVVDMGFLYLLSDPNTLGLPLTRSKIIAAELAIINNFLWNDLWTFGDI 348

Query: 59  -----LRRKSFLETVRYGVMYFMLSILNYAFYVKLLLTFQGLQPLLATVLSAVSSMLFVF 113
                 +R+     +++ ++     ILN   ++ +      +   +A  L+     L+ F
Sbjct: 349 SRRQPGKRQRLKRLIKFNIICLAGLILN-VLFLNIFYNLFNINQYIANFLAIGLVTLWNF 407

Query: 114 LLYIRFMTR 122
               +   R
Sbjct: 408 WFNSKLSWR 416



 Score = 39.5 bits (91), Expect = 0.14,   Method: Composition-based stats.
 Identities = 8/58 (13%), Positives = 22/58 (37%), Gaps = 1/58 (1%)

Query: 1   MKQCIIFIINIVVVFFIDVMGFFILMKCGA-DPFYSRIFSIAVAFLVTWIPSRLFIFL 57
           +K+ I F I  +    ++V+   I       + + +   +I +  L  +  +    + 
Sbjct: 359 LKRLIKFNIICLAGLILNVLFLNIFYNLFNINQYIANFLAIGLVTLWNFWFNSKLSWR 416


>gi|332158216|ref|YP_004423495.1| dolichol-phosphate mannosyltransferase [Pyrococcus sp. NA2]
 gi|331033679|gb|AEC51491.1| dolichol-phosphate mannosyltransferase [Pyrococcus sp. NA2]
          Length = 351

 Score = 86.5 bits (213), Expect = 1e-15,   Method: Composition-based stats.
 Identities = 22/122 (18%), Positives = 52/122 (42%), Gaps = 3/122 (2%)

Query: 1   MKQCIIFIINIVVVFFIDVMGFFILMKCGADPFYSRIFSIAVAFLVTWIPSRLFIFLKLR 60
           + + I F +  +    ++    ++ ++ G     + I S  ++ +  +I + L+ F  +R
Sbjct: 231 VDRLIRFSLVGLSGILVNEGFLWLFVRLGLSKEIAVIPSTELSIINNFIWNDLWTFRDIR 290

Query: 61  R-KSFLETVRYGVMYFMLSILNYAFYVKLLLTFQGLQPLLATVLSAVSSMLFVFLLYIRF 119
           +   F   V++ +   + ++    F V  LL F G+  LLA +    +S L  ++     
Sbjct: 291 KGSIFARFVKFHLAALVGAVAQ--FLVYWLLLFLGVHYLLANLFGIGASFLIRYIFNRHI 348

Query: 120 MT 121
             
Sbjct: 349 TW 350



 Score = 34.5 bits (78), Expect = 5.1,   Method: Composition-based stats.
 Identities = 14/81 (17%), Positives = 31/81 (38%), Gaps = 4/81 (4%)

Query: 44  FLVTWIPSRLFIFLKLRRKSFLETVRYGVMYFMLSILNYAFYVKLLLTFQGLQPLLATVL 103
            ++ ++  R    L    K     +R+ ++     ++N  F    L    GL   +A + 
Sbjct: 213 TMINYL--RHVYRLMKWEKEVDRLIRFSLVGLSGILVNEGFL--WLFVRLGLSKEIAVIP 268

Query: 104 SAVSSMLFVFLLYIRFMTRRV 124
           S   S++  F+    +  R +
Sbjct: 269 STELSIINNFIWNDLWTFRDI 289


>gi|315445622|ref|YP_004078501.1| hypothetical protein Mspyr1_40800 [Mycobacterium sp. Spyr1]
 gi|315263925|gb|ADU00667.1| predicted membrane protein [Mycobacterium sp. Spyr1]
          Length = 227

 Score = 86.5 bits (213), Expect = 1e-15,   Method: Composition-based stats.
 Identities = 28/134 (20%), Positives = 52/134 (38%), Gaps = 15/134 (11%)

Query: 3   QCIIFIINIVVVFFIDVMGFFIL--MKCGADPFYSRIFSIAVAFLVTWIPSRLFIFLKL- 59
           + I F I     F ID   FF L        P  ++I +  VA + ++I +R + F    
Sbjct: 24  ELIKFAIVGATTFVIDSAIFFTLKLTILEPKPVTAKIIAGIVAVIASYILNREWSFRDRG 83

Query: 60  RRKSFLETVRYGVMYFMLSILNYA------------FYVKLLLTFQGLQPLLATVLSAVS 107
            R+   E + +  +  +  +L+ A              +  L+T      + A ++  + 
Sbjct: 84  GRERHHEALLFFGVSGVGVLLSMAPLWVSSYVLMLRVPMVSLMTENIADFVSAYIIGNLL 143

Query: 108 SMLFVFLLYIRFMT 121
            M F F  + RF+ 
Sbjct: 144 QMAFRFWAFRRFVF 157



 Score = 39.5 bits (91), Expect = 0.14,   Method: Composition-based stats.
 Identities = 9/60 (15%), Positives = 30/60 (50%)

Query: 63  SFLETVRYGVMYFMLSILNYAFYVKLLLTFQGLQPLLATVLSAVSSMLFVFLLYIRFMTR 122
              E +++ ++     +++ A +  L LT    +P+ A +++ + +++  ++L   +  R
Sbjct: 21  RHHELIKFAIVGATTFVIDSAIFFTLKLTILEPKPVTAKIIAGIVAVIASYILNREWSFR 80


>gi|254172380|ref|ZP_04879055.1| dolichol-phosphate mannosyltransferase [Thermococcus sp. AM4]
 gi|214033309|gb|EEB74136.1| dolichol-phosphate mannosyltransferase [Thermococcus sp. AM4]
          Length = 360

 Score = 86.5 bits (213), Expect = 1e-15,   Method: Composition-based stats.
 Identities = 21/123 (17%), Positives = 51/123 (41%), Gaps = 4/123 (3%)

Query: 1   MKQCIIFIINIVVVFFIDVMGFFILMK-CGADPFYSRIFSIAVAFLVTWIPSRLFIFLKL 59
           + + + F +  +    ++    +  +   G D   + + +  +A L  ++ + L+ F  L
Sbjct: 239 LDRLVKFSVVGLSGILVNEGFLWFFVSELGMDKIIANVPATELAILNNFLWNDLWTFRDL 298

Query: 60  RR-KSFLETVRYGVMYFMLSILNYAFYVKLLLTFQGLQPLLATVLSAVSSMLFVFLLYIR 118
           R+   +     + V   M +++ +A Y    L + G+  L+A +L   +S +  FL    
Sbjct: 299 RKAPLWKRLASFHVAALMGALVQWAIYA--PLVYLGINYLIANLLGIGASFVVRFLFNRN 356

Query: 119 FMT 121
              
Sbjct: 357 VTW 359



 Score = 41.4 bits (96), Expect = 0.039,   Method: Composition-based stats.
 Identities = 8/56 (14%), Positives = 24/56 (42%)

Query: 2   KQCIIFIINIVVVFFIDVMGFFILMKCGADPFYSRIFSIAVAFLVTWIPSRLFIFL 57
           K+   F +  ++   +    +  L+  G +   + +  I  +F+V ++ +R   + 
Sbjct: 305 KRLASFHVAALMGALVQWAIYAPLVYLGINYLIANLLGIGASFVVRFLFNRNVTWG 360



 Score = 39.5 bits (91), Expect = 0.14,   Method: Composition-based stats.
 Identities = 13/79 (16%), Positives = 32/79 (40%), Gaps = 3/79 (3%)

Query: 44  FLVTWIPSRLFIFLKLRRKSFLETVRYGVMYFMLSILNYAFYVKLLLTFQGLQPLLATVL 103
            +V+++  +    L          V++ V+     ++N  F     ++  G+  ++A V 
Sbjct: 221 TIVSYL--KHVYRLMRWSGELDRLVKFSVVGLSGILVNEGFL-WFFVSELGMDKIIANVP 277

Query: 104 SAVSSMLFVFLLYIRFMTR 122
           +   ++L  FL    +  R
Sbjct: 278 ATELAILNNFLWNDLWTFR 296


>gi|218438882|ref|YP_002377211.1| GtrA family protein [Cyanothece sp. PCC 7424]
 gi|218171610|gb|ACK70343.1| GtrA family protein [Cyanothece sp. PCC 7424]
          Length = 419

 Score = 86.5 bits (213), Expect = 1e-15,   Method: Composition-based stats.
 Identities = 18/131 (13%), Positives = 52/131 (39%), Gaps = 10/131 (7%)

Query: 1   MKQCIIFIINIVVVFFIDVMGFFIL---MKCGADPFYSRIFSIAVAFLVTWIPSRLFIFL 57
           + + I F +  +   F+D+   ++L      G +   S+I +  VA +  ++ +  + F 
Sbjct: 285 VGRFIRFGLVGLSGVFVDMTLLYLLSDSTTLGWELTRSKIIAAEVAIINNFLWNDRWTFG 344

Query: 58  K------LRRKSFLETVRYGVMYFMLSILNYAFYVKLLLTFQGLQPLLATVLSAVSSMLF 111
                     +     +++ ++     +LN    + L     G+   +A +++     ++
Sbjct: 345 DLSSQQRGWNQRLKRFLKFNMICLAGLVLNVLL-LNLFFNIFGINRYVANLIAIALVTVW 403

Query: 112 VFLLYIRFMTR 122
            F + ++   R
Sbjct: 404 NFWINLKLSWR 414


>gi|170289827|ref|YP_001736643.1| glycosyl transferase family protein [Candidatus Korarchaeum
           cryptofilum OPF8]
 gi|170173907|gb|ACB06960.1| glycosyl transferase family 2 [Candidatus Korarchaeum cryptofilum
           OPF8]
          Length = 344

 Score = 86.1 bits (212), Expect = 1e-15,   Method: Composition-based stats.
 Identities = 19/120 (15%), Positives = 52/120 (43%), Gaps = 3/120 (2%)

Query: 4   CIIFIINIVVVFFIDVMGFFILMK-CGADPFYSRIFSIAVAFLVTWIPSRLFIFLKLRR- 61
            I F I   +   ++++  +++    G +   + I +I ++ L  +I + ++ F K RR 
Sbjct: 225 FIRFSIIGALGTLVNLLSLYVMRYFLGLEHELASIIAIEISLLNNFILNDIWTFRKRRRG 284

Query: 62  KSFLETVRYGVMYFMLSILNYAFYVKLLLTFQGLQPLLATVLSAVSSMLFVFLLYIRFMT 121
                 + Y +   +  +  ++  +  L  F G++ +L+  +  +   +  + L  R + 
Sbjct: 285 SIISSLLNYHLANLLGIMTQFSISM-SLYRFFGMESILSQFIGIIVGFIVNYSLSKRIVW 343



 Score = 37.2 bits (85), Expect = 0.79,   Method: Composition-based stats.
 Identities = 9/57 (15%), Positives = 26/57 (45%), Gaps = 1/57 (1%)

Query: 67  TVRYGVMYFMLSILNYAFYVKLLLTFQGLQPLLATVLSAVSSMLFVFLLYIRFMTRR 123
            +R+ ++  + +++N      +          LA++++   S+L  F+L   +  R+
Sbjct: 225 FIRFSIIGALGTLVNLLSLYVMRYFLGLEHE-LASIIAIEISLLNNFILNDIWTFRK 280


>gi|333024981|ref|ZP_08453045.1| putative integral membrane protein [Streptomyces sp. Tu6071]
 gi|332744833|gb|EGJ75274.1| putative integral membrane protein [Streptomyces sp. Tu6071]
          Length = 208

 Score = 86.1 bits (212), Expect = 1e-15,   Method: Composition-based stats.
 Identities = 12/127 (9%), Positives = 39/127 (30%), Gaps = 5/127 (3%)

Query: 1   MKQCIIFIINIVVVFFIDVMGFFILMKCGADPFY-SRIFSIAVAFLVTWIPSRLFIFLKL 59
           + +   F         +++  + ++    +  +  + + +  ++ +  +I  R F +   
Sbjct: 15  VAELAKFGAVGGAGVLVNMAAYNLVRHFTSLAYVRASVIATVISIVFNYIGFRYFTYRDR 74

Query: 60  RRK-SFLETVRYGVMYFMLSILNYAFYVKLLLTFQGLQPL---LATVLSAVSSMLFVFLL 115
            +     E   +     +  ++                PL   +        + LF F  
Sbjct: 75  DKSGRKRELGLFAFFSAIGLVIENGVLYAGTYGLGFDTPLQTNVVKFCGIGVATLFRFWS 134

Query: 116 YIRFMTR 122
           Y  ++ R
Sbjct: 135 YRSWVFR 141



 Score = 37.6 bits (86), Expect = 0.65,   Method: Composition-based stats.
 Identities = 15/64 (23%), Positives = 31/64 (48%), Gaps = 1/64 (1%)

Query: 59  LRRKSFLETVRYGVMYFMLSILNYAFYVKLLLTFQGLQPLLATVLSAVSSMLFVFLLYIR 118
             R+   E  ++G +     ++N A Y  +   F  L  + A+V++ V S++F ++ +  
Sbjct: 10  RLRRIVAELAKFGAVGGAGVLVNMAAYNLVRH-FTSLAYVRASVIATVISIVFNYIGFRY 68

Query: 119 FMTR 122
           F  R
Sbjct: 69  FTYR 72


>gi|118469379|ref|YP_886189.1| transmembrane protein [Mycobacterium smegmatis str. MC2 155]
 gi|118170666|gb|ABK71562.1| probable conserved transmembrane protein [Mycobacterium smegmatis
           str. MC2 155]
          Length = 223

 Score = 86.1 bits (212), Expect = 1e-15,   Method: Composition-based stats.
 Identities = 25/134 (18%), Positives = 47/134 (35%), Gaps = 15/134 (11%)

Query: 3   QCIIFIINIVVVFFIDVMGFFIL--MKCGADPFYSRIFSIAVAFLVTWIPSRLFIFLKL- 59
           + I F I     F ID   F+ L        P  ++I +  VA + ++I +R + F    
Sbjct: 24  ELIKFAIVGATTFVIDSAIFYTLKLTVLEPKPVTAKIIAGIVAVIASYILNREWSFRDRG 83

Query: 60  RRKSFLETVRYGVMYFMLSILNYAFYVKLLLTFQ------------GLQPLLATVLSAVS 107
            R+   E   +  +  +  +L+ A                          + A ++  + 
Sbjct: 84  GRERHHEAFLFFAVSGVGVLLSMAPLWISSYVLMLRVPEVSLTTENIADFISAYIIGNLL 143

Query: 108 SMLFVFLLYIRFMT 121
            M F F  + RF+ 
Sbjct: 144 QMAFRFWAFRRFVF 157



 Score = 39.9 bits (92), Expect = 0.11,   Method: Composition-based stats.
 Identities = 9/60 (15%), Positives = 30/60 (50%)

Query: 63  SFLETVRYGVMYFMLSILNYAFYVKLLLTFQGLQPLLATVLSAVSSMLFVFLLYIRFMTR 122
              E +++ ++     +++ A +  L LT    +P+ A +++ + +++  ++L   +  R
Sbjct: 21  RHHELIKFAIVGATTFVIDSAIFYTLKLTVLEPKPVTAKIIAGIVAVIASYILNREWSFR 80


>gi|269794183|ref|YP_003313638.1| hypothetical protein Sked_08530 [Sanguibacter keddieii DSM 10542]
 gi|269096368|gb|ACZ20804.1| predicted membrane protein [Sanguibacter keddieii DSM 10542]
          Length = 180

 Score = 86.1 bits (212), Expect = 1e-15,   Method: Composition-based stats.
 Identities = 25/129 (19%), Positives = 48/129 (37%), Gaps = 10/129 (7%)

Query: 3   QCIIFIINIVVVFFIDVMGFFILMK-----CGADPFYSRIFSIAVAFLVTWIPSRLFIFL 57
           + + F     V F +D   F +L           P  +++ S+AVA +V W+ +R + F 
Sbjct: 45  ELLRFGTVGGVAFVVDTGLFNLLRFGPGGLLDDKPLTAKVVSVAVATIVAWLGNRYWTFA 104

Query: 58  KLRRKSF-LETVRYGVMYFMLSILNYAFYVKLLLTF----QGLQPLLATVLSAVSSMLFV 112
             R ++   E + + V+      +                     + A  +  V  M+F 
Sbjct: 105 DRRTETHLREFLGFVVVNIGGMAIALGCLWFSHYILDLRTPLADNISANGVGLVLGMVFR 164

Query: 113 FLLYIRFMT 121
           +L Y  F+ 
Sbjct: 165 YLAYRTFVF 173


>gi|126433935|ref|YP_001069626.1| GtrA family protein [Mycobacterium sp. JLS]
 gi|126233735|gb|ABN97135.1| GtrA family protein [Mycobacterium sp. JLS]
          Length = 229

 Score = 86.1 bits (212), Expect = 2e-15,   Method: Composition-based stats.
 Identities = 25/134 (18%), Positives = 46/134 (34%), Gaps = 15/134 (11%)

Query: 3   QCIIFIINIVVVFFIDVMGFFIL--MKCGADPFYSRIFSIAVAFLVTWIPSRLFIFLKL- 59
           + I F I     F ID   FF L        P  ++I +  VA + ++I +R + F    
Sbjct: 24  ELIKFAIVGATTFVIDSAIFFTLKLTILEPKPVTAKIIAGIVAVIASYILNREWSFRDRG 83

Query: 60  RRKSFLETVRYGVMYFMLSILNYAFYVKLLLTFQ------------GLQPLLATVLSAVS 107
            R+   E + +     +  +L+                            + A +L  + 
Sbjct: 84  GRERHHEALLFFGFSGVGVLLSMLPLYFSSYVLGLRVPEVSLTIENIADFVSAYILGNLL 143

Query: 108 SMLFVFLLYIRFMT 121
            M F F  + R++ 
Sbjct: 144 QMAFRFWAFRRWVF 157



 Score = 39.1 bits (90), Expect = 0.18,   Method: Composition-based stats.
 Identities = 9/59 (15%), Positives = 30/59 (50%)

Query: 64  FLETVRYGVMYFMLSILNYAFYVKLLLTFQGLQPLLATVLSAVSSMLFVFLLYIRFMTR 122
             E +++ ++     +++ A +  L LT    +P+ A +++ + +++  ++L   +  R
Sbjct: 22  HHELIKFAIVGATTFVIDSAIFFTLKLTILEPKPVTAKIIAGIVAVIASYILNREWSFR 80


>gi|300863667|ref|ZP_07108603.1| GtrA-like protein [Oscillatoria sp. PCC 6506]
 gi|300338337|emb|CBN53747.1| GtrA-like protein [Oscillatoria sp. PCC 6506]
          Length = 409

 Score = 86.1 bits (212), Expect = 2e-15,   Method: Composition-based stats.
 Identities = 26/129 (20%), Positives = 55/129 (42%), Gaps = 8/129 (6%)

Query: 1   MKQCIIFIINIVVVFFIDVMGFFIL-MKCGADPFYSRIFSIAVAFLVTWIPSRLFIFLK- 58
           + +   F +      F+D+  F++L    G     S + S  VA +  ++ + L+ F   
Sbjct: 276 LGRFFRFGVVGFSGVFVDMGVFYLLRTVLGLALTRSAMLSSEVAIINNFLWNDLWTFGDI 335

Query: 59  -----LRRKSFLETVRYGVMYFMLSILNYAFYVKLLLTFQGLQPLLATVLSAVSSMLFVF 113
                 +R+ F   +++ ++  M  ILN      L   F  +   LA +++ V+  L+ F
Sbjct: 336 SKRQPGKRQQFKRFLKFNLICLMGLILNVLLVNLLFNVFA-VNEYLAKLIAIVAVTLWNF 394

Query: 114 LLYIRFMTR 122
            + ++   R
Sbjct: 395 WINMKLSWR 403


>gi|295836983|ref|ZP_06823916.1| integral membrane protein [Streptomyces sp. SPB74]
 gi|197697442|gb|EDY44375.1| integral membrane protein [Streptomyces sp. SPB74]
          Length = 209

 Score = 86.1 bits (212), Expect = 2e-15,   Method: Composition-based stats.
 Identities = 11/127 (8%), Positives = 39/127 (30%), Gaps = 5/127 (3%)

Query: 1   MKQCIIFIINIVVVFFIDVMGFFILMKCGADPFY-SRIFSIAVAFLVTWIPSRLFIFLKL 59
           + +   F         +++  + ++    +  +  + + +  ++ +  ++  R F +   
Sbjct: 15  VAELAKFGAVGGAGVLVNMAAYNLVRHFTSLAYVRASVIATIISIVFNYVGFRYFTYRDR 74

Query: 60  RRK-SFLETVRYGVMYFMLSILNYAFYVKLLLTFQGLQPL---LATVLSAVSSMLFVFLL 115
            +     E   +     +  ++                PL   +        + LF F  
Sbjct: 75  DKSGRKRELGLFAFFSAIGLVIENGVLYAGTYGLGFDTPLQTNVVKFCGIGVATLFRFWS 134

Query: 116 YIRFMTR 122
           Y  ++ R
Sbjct: 135 YRSWVFR 141



 Score = 37.2 bits (85), Expect = 0.70,   Method: Composition-based stats.
 Identities = 14/64 (21%), Positives = 31/64 (48%), Gaps = 1/64 (1%)

Query: 59  LRRKSFLETVRYGVMYFMLSILNYAFYVKLLLTFQGLQPLLATVLSAVSSMLFVFLLYIR 118
             R+   E  ++G +     ++N A Y  +   F  L  + A+V++ + S++F ++ +  
Sbjct: 10  RLRRLVAELAKFGAVGGAGVLVNMAAYNLVRH-FTSLAYVRASVIATIISIVFNYVGFRY 68

Query: 119 FMTR 122
           F  R
Sbjct: 69  FTYR 72


>gi|302521370|ref|ZP_07273712.1| integral membrane protein [Streptomyces sp. SPB78]
 gi|318056733|ref|ZP_07975456.1| integral membrane protein [Streptomyces sp. SA3_actG]
 gi|318075367|ref|ZP_07982699.1| integral membrane protein [Streptomyces sp. SA3_actF]
 gi|302430265|gb|EFL02081.1| integral membrane protein [Streptomyces sp. SPB78]
          Length = 208

 Score = 85.7 bits (211), Expect = 2e-15,   Method: Composition-based stats.
 Identities = 12/127 (9%), Positives = 39/127 (30%), Gaps = 5/127 (3%)

Query: 1   MKQCIIFIINIVVVFFIDVMGFFILMKCGADPFY-SRIFSIAVAFLVTWIPSRLFIFLKL 59
           + +   F         +++  + ++    +  +  + + +  ++ +  +I  R F +   
Sbjct: 15  VAELAKFGAVGGAGVLVNMAAYNLVRHFTSLAYVRASVIATVISIVFNYIGFRYFTYRDR 74

Query: 60  RRK-SFLETVRYGVMYFMLSILNYAFYVKLLLTFQGLQPL---LATVLSAVSSMLFVFLL 115
            +     E   +     +  ++                PL   +        + LF F  
Sbjct: 75  DKSGRKRELGLFAFFSAIGLVIENGVLYAGTYGLGFDTPLQTNVVKFCGIGVATLFRFWS 134

Query: 116 YIRFMTR 122
           Y  ++ R
Sbjct: 135 YRSWVFR 141



 Score = 37.2 bits (85), Expect = 0.70,   Method: Composition-based stats.
 Identities = 15/64 (23%), Positives = 31/64 (48%), Gaps = 1/64 (1%)

Query: 59  LRRKSFLETVRYGVMYFMLSILNYAFYVKLLLTFQGLQPLLATVLSAVSSMLFVFLLYIR 118
             R+   E  ++G +     ++N A Y  +   F  L  + A+V++ V S++F ++ +  
Sbjct: 10  RLRRIVAELAKFGAVGGAGVLVNMAAYNLVRH-FTSLAYVRASVIATVISIVFNYIGFRY 68

Query: 119 FMTR 122
           F  R
Sbjct: 69  FTYR 72


>gi|14520276|ref|NP_125751.1| dolichol-phosphate mannosyltransferase [Pyrococcus abyssi GE5]
 gi|5457491|emb|CAB48982.1| dpm1 dolichol-phosphate mannosyltransferase [Pyrococcus abyssi GE5]
          Length = 362

 Score = 85.7 bits (211), Expect = 2e-15,   Method: Composition-based stats.
 Identities = 16/120 (13%), Positives = 46/120 (38%), Gaps = 3/120 (2%)

Query: 3   QCIIFIINIVVVFFIDVMGFFILMKCGADPFYSRIFSIAVAFLVTWIPSRLFIFLKLRR- 61
           + + F I  +    ++    ++ +K G     + + S  ++ +  +I + L+ F  LR+ 
Sbjct: 244 RLVKFSIVGLSGVAVNEGFLWLFVKMGIRKEVAVLPSTELSVINNFIWNDLWTFKDLRKG 303

Query: 62  KSFLETVRYGVMYFMLSILNYAFYVKLLLTFQGLQPLLATVLSAVSSMLFVFLLYIRFMT 121
                  ++ +   +        Y    L F G+  L++ ++   +S +  ++       
Sbjct: 304 SVLRRFFQFHIAALIGVFAQLLIYWA--LLFLGVHYLISNLVGIGASFIVRYIFNRHVTW 361



 Score = 44.1 bits (103), Expect = 0.006,   Method: Composition-based stats.
 Identities = 11/56 (19%), Positives = 27/56 (48%)

Query: 1   MKQCIIFIINIVVVFFIDVMGFFILMKCGADPFYSRIFSIAVAFLVTWIPSRLFIF 56
           +++   F I  ++  F  ++ ++ L+  G     S +  I  +F+V +I +R   +
Sbjct: 306 LRRFFQFHIAALIGVFAQLLIYWALLFLGVHYLISNLVGIGASFIVRYIFNRHVTW 361


>gi|159027121|emb|CAO86752.1| unnamed protein product [Microcystis aeruginosa PCC 7806]
          Length = 420

 Score = 85.7 bits (211), Expect = 2e-15,   Method: Composition-based stats.
 Identities = 19/131 (14%), Positives = 50/131 (38%), Gaps = 10/131 (7%)

Query: 1   MKQCIIFIINIVVVFFIDVMGFFILM---KCGADPFYSRIFSIAVAFLVTWIPSRLFIFL 57
           + + I F +  +   F+D+   ++L      G     S+I +  +A +  +I +  + F 
Sbjct: 288 LDRFIRFGLVGLTGVFVDMAFLYLLSDTAALGWGLTRSKIIAAELAIINNFIWNDRWTFG 347

Query: 58  K------LRRKSFLETVRYGVMYFMLSILNYAFYVKLLLTFQGLQPLLATVLSAVSSMLF 111
                     K +    ++ ++     ++     + LL    G+   LA  ++     ++
Sbjct: 348 DLSARQRGWNKRWKRFFKFNLICL-AGLILNVLLLNLLFNGLGINRYLANFIAIAIVTVW 406

Query: 112 VFLLYIRFMTR 122
            F + ++   R
Sbjct: 407 NFWVNLKLSWR 417


>gi|108798268|ref|YP_638465.1| GtrA-like protein [Mycobacterium sp. MCS]
 gi|119867364|ref|YP_937316.1| GtrA family protein [Mycobacterium sp. KMS]
 gi|108768687|gb|ABG07409.1| GtrA-like protein [Mycobacterium sp. MCS]
 gi|119693453|gb|ABL90526.1| GtrA family protein [Mycobacterium sp. KMS]
          Length = 229

 Score = 85.7 bits (211), Expect = 2e-15,   Method: Composition-based stats.
 Identities = 25/134 (18%), Positives = 46/134 (34%), Gaps = 15/134 (11%)

Query: 3   QCIIFIINIVVVFFIDVMGFFIL--MKCGADPFYSRIFSIAVAFLVTWIPSRLFIFLKL- 59
           + I F I     F ID   FF L        P  ++I +  VA + ++I +R + F    
Sbjct: 24  ELIKFAIVGATTFVIDSAIFFTLKLTILEPKPVTAKIIAGIVAVIASYILNREWSFRDRG 83

Query: 60  RRKSFLETVRYGVMYFMLSILNYAFYVKLLLTFQ------------GLQPLLATVLSAVS 107
            R+   E + +     +  +L+                            + A +L  + 
Sbjct: 84  GRERHHEALLFFGFSGVGVLLSMLPLYFSSYVLGLRVPEVSLTIENIADFVSAYILGNLL 143

Query: 108 SMLFVFLLYIRFMT 121
            M F F  + R++ 
Sbjct: 144 QMAFRFWAFRRWVF 157



 Score = 39.1 bits (90), Expect = 0.21,   Method: Composition-based stats.
 Identities = 9/59 (15%), Positives = 30/59 (50%)

Query: 64  FLETVRYGVMYFMLSILNYAFYVKLLLTFQGLQPLLATVLSAVSSMLFVFLLYIRFMTR 122
             E +++ ++     +++ A +  L LT    +P+ A +++ + +++  ++L   +  R
Sbjct: 22  HHELIKFAIVGATTFVIDSAIFFTLKLTILEPKPVTAKIIAGIVAVIASYILNREWSFR 80


>gi|295696087|ref|YP_003589325.1| Dolichyl-phosphate beta-D-mannosyltransferase [Bacillus tusciae DSM
           2912]
 gi|295411689|gb|ADG06181.1| Dolichyl-phosphate beta-D-mannosyltransferase [Bacillus tusciae DSM
           2912]
          Length = 366

 Score = 85.7 bits (211), Expect = 2e-15,   Method: Composition-based stats.
 Identities = 16/125 (12%), Positives = 43/125 (34%), Gaps = 3/125 (2%)

Query: 2   KQCIIFIINIVVVFFIDVMGFFILMKCGADPFYSRIFSIAVAFLVTWIPSRLFIFLKLRR 61
           ++  +F +  +    ++ + F  L K    P  +   S ++A +  +  +    +    +
Sbjct: 233 RRFWLFALVGISGVAVNTLLFAHLTKWNIFPETAAFVSGSLAMIWNFAWNCGLTWRDAPQ 292

Query: 62  K--SFLETVRYGVMYFMLSILNYAFYVKLLLTFQGLQPLLATVLSAVSSMLFVFLLYIRF 119
                +   ++  +  +   +N       L     +    A +   +   L  + L  R+
Sbjct: 293 SDPLAVTFAKFAAVALIGIAVNLVVLSV-LFRLLDVPKQWANLTGIIGGALVNYRLNDRW 351

Query: 120 MTRRV 124
             RRV
Sbjct: 352 TWRRV 356



 Score = 45.7 bits (107), Expect = 0.002,   Method: Composition-based stats.
 Identities = 6/63 (9%), Positives = 23/63 (36%), Gaps = 1/63 (1%)

Query: 4   CIIFIINIVVVFFIDVMGFFILMKCGA-DPFYSRIFSIAVAFLVTWIPSRLFIFLKLRRK 62
              F    ++   ++++   +L +       ++ +  I    LV +  +  + + ++  K
Sbjct: 300 FAKFAAVALIGIAVNLVVLSVLFRLLDVPKQWANLTGIIGGALVNYRLNDRWTWRRVGDK 359

Query: 63  SFL 65
              
Sbjct: 360 RPR 362


>gi|84498097|ref|ZP_00996894.1| probable conserved transmembrane protein [Janibacter sp. HTCC2649]
 gi|84381597|gb|EAP97480.1| probable conserved transmembrane protein [Janibacter sp. HTCC2649]
          Length = 185

 Score = 85.3 bits (210), Expect = 2e-15,   Method: Composition-based stats.
 Identities = 28/126 (22%), Positives = 50/126 (39%), Gaps = 6/126 (4%)

Query: 2   KQCIIFIINIVVVFFIDVMGFFILMK--CGADPFYSRIFSIAVAFLVTWIPSRLFIFLKL 59
           ++ I F +  V+ F ID+  F +L        P  + I S ++A    W+ +R + F   
Sbjct: 33  REVIKFGVIGVIAFVIDMGSFNLLRHTILEDKPTAAVIISASIATAFAWVGNRAWTFRHR 92

Query: 60  R-RKSFLETVRYGVMYFMLSILN---YAFYVKLLLTFQGLQPLLATVLSAVSSMLFVFLL 115
           R R +  E   +     +  ++     AF   +L         +A ++      LF F  
Sbjct: 93  RNRPAHHEAALFAGTNGVALLIQAAAVAFSNYVLGYESLTADNVAKIVGIGLGTLFRFWA 152

Query: 116 YIRFMT 121
           Y RF+ 
Sbjct: 153 YRRFVF 158



 Score = 35.3 bits (80), Expect = 2.8,   Method: Composition-based stats.
 Identities = 11/58 (18%), Positives = 27/58 (46%)

Query: 65  LETVRYGVMYFMLSILNYAFYVKLLLTFQGLQPLLATVLSAVSSMLFVFLLYIRFMTR 122
            E +++GV+  +  +++   +  L  T    +P  A ++SA  +  F ++    +  R
Sbjct: 33  REVIKFGVIGVIAFVIDMGSFNLLRHTILEDKPTAAVIISASIATAFAWVGNRAWTFR 90


>gi|120402713|ref|YP_952542.1| GtrA family protein [Mycobacterium vanbaalenii PYR-1]
 gi|119955531|gb|ABM12536.1| GtrA family protein [Mycobacterium vanbaalenii PYR-1]
          Length = 240

 Score = 85.3 bits (210), Expect = 2e-15,   Method: Composition-based stats.
 Identities = 26/134 (19%), Positives = 48/134 (35%), Gaps = 15/134 (11%)

Query: 3   QCIIFIINIVVVFFIDVMGFFIL--MKCGADPFYSRIFSIAVAFLVTWIPSRLFIFLKL- 59
           + I F I     F ID   FF L        P  ++I +  VA + ++I +R + F    
Sbjct: 41  ELIKFAIVGATTFVIDSAIFFTLKLTILEPKPVTAKIIAGIVAVIASYILNREWSFRDRG 100

Query: 60  RRKSFLETVRYGVMYFMLSILNYAFYVKLLLTFQG------------LQPLLATVLSAVS 107
            R+   E + +  +  +  +L+ A                          + A ++  + 
Sbjct: 101 GRERHHEALLFFGVSGVGVLLSMAPLWVSSYVLMLRVPMVSLAAENVADFISAYIIGNLL 160

Query: 108 SMLFVFLLYIRFMT 121
            M F F  + RF+ 
Sbjct: 161 QMAFRFWAFRRFVF 174



 Score = 39.5 bits (91), Expect = 0.15,   Method: Composition-based stats.
 Identities = 12/85 (14%), Positives = 34/85 (40%), Gaps = 8/85 (9%)

Query: 46  VTWIPSRLFIFLKLRRK--------SFLETVRYGVMYFMLSILNYAFYVKLLLTFQGLQP 97
           V W+          R             E +++ ++     +++ A +  L LT    +P
Sbjct: 13  VNWLLVSFADATIRRLPGPIRPYAERHHELIKFAIVGATTFVIDSAIFFTLKLTILEPKP 72

Query: 98  LLATVLSAVSSMLFVFLLYIRFMTR 122
           + A +++ + +++  ++L   +  R
Sbjct: 73  VTAKIIAGIVAVIASYILNREWSFR 97


>gi|254415596|ref|ZP_05029355.1| GtrA-like protein [Microcoleus chthonoplastes PCC 7420]
 gi|196177546|gb|EDX72551.1| GtrA-like protein [Microcoleus chthonoplastes PCC 7420]
          Length = 402

 Score = 85.3 bits (210), Expect = 3e-15,   Method: Composition-based stats.
 Identities = 24/129 (18%), Positives = 54/129 (41%), Gaps = 8/129 (6%)

Query: 1   MKQCIIFIINIVVVFFIDVMGFFILM-KCGADPFYSRIFSIAVAFLVTWIPSRLFIFLK- 58
           + + I F +      F+D+  F++L  + G     S I S  VA L  ++ + L+ F   
Sbjct: 269 IGRFIRFGVVGFSGVFVDMGIFYLLREQAGLGLTRSAILSAEVAILNNFLWNDLWTFGDI 328

Query: 59  -----LRRKSFLETVRYGVMYFMLSILNYAFYVKLLLTFQGLQPLLATVLSAVSSMLFVF 113
                  R+     +++ ++     IL     V LL    G+   ++ +++  +  ++ F
Sbjct: 329 SRHQRGWRQRLERFLKFNLVCLAGLIL-NVLLVNLLFNVFGINEYVSKLIAIAAVTVWNF 387

Query: 114 LLYIRFMTR 122
            + ++   R
Sbjct: 388 WINLKLSWR 396


>gi|282896675|ref|ZP_06304683.1| Glycosyl transferase, family 2 [Raphidiopsis brookii D9]
 gi|281198393|gb|EFA73281.1| Glycosyl transferase, family 2 [Raphidiopsis brookii D9]
          Length = 414

 Score = 85.3 bits (210), Expect = 3e-15,   Method: Composition-based stats.
 Identities = 14/129 (10%), Positives = 49/129 (37%), Gaps = 8/129 (6%)

Query: 1   MKQCIIFIINIVVVFFIDVMGFFILM-KCGADPFYSRIFSIAVAFLVTWIPSRLFIFLK- 58
           + + + F +  +   F+D+   ++L          S+I +  +A    ++ +  + F   
Sbjct: 282 LSRFMRFGLVGLSGVFVDMAVLYLLSDALAFPLVGSKILAGELAIFNNFLWNDAWTFGDI 341

Query: 59  -----LRRKSFLETVRYGVMYFMLSILNYAFYVKLLLTFQGLQPLLATVLSAVSSMLFVF 113
                  ++      ++ ++  +  I+N      ++  F      +A +++   + ++ F
Sbjct: 342 SMRQRSWKQRIKRFYKFNLICLVGLIINVLILKFVVH-FLISNHYIANLIAIGVTTIWNF 400

Query: 114 LLYIRFMTR 122
              ++   R
Sbjct: 401 WFNLKLSWR 409


>gi|255327334|ref|ZP_05368408.1| monosaccharide translocase [Rothia mucilaginosa ATCC 25296]
 gi|255295614|gb|EET74957.1| monosaccharide translocase [Rothia mucilaginosa ATCC 25296]
          Length = 205

 Score = 84.9 bits (209), Expect = 3e-15,   Method: Composition-based stats.
 Identities = 18/126 (14%), Positives = 51/126 (40%), Gaps = 7/126 (5%)

Query: 3   QCIIFIINIVVVFFIDVMGFFIL--MKCGADPFYSRIFSIAVAFLVTWIPSRLFIFLKLR 60
           + + F       F ++ +  ++L           +++ +  VA + +W+ +RL+ F   R
Sbjct: 23  EVLKFGTVGGAAFIVNSVTVWVLMTTIMSESHTKAKVVASIVATIFSWLMNRLWTFRDSR 82

Query: 61  RKSF-LETVRYGVMYFMLSILNYAFY----VKLLLTFQGLQPLLATVLSAVSSMLFVFLL 115
            +++  E V +G++  +  ++           L L       +  T++  +   +  + L
Sbjct: 83  SENWKREAVEFGLVNLLGILVEAGCVAFSTYVLNLRTPEASFISGTIIGTILGTILRYFL 142

Query: 116 YIRFMT 121
           Y  ++ 
Sbjct: 143 YRFWVY 148



 Score = 40.3 bits (93), Expect = 0.099,   Method: Composition-based stats.
 Identities = 11/61 (18%), Positives = 27/61 (44%)

Query: 62  KSFLETVRYGVMYFMLSILNYAFYVKLLLTFQGLQPLLATVLSAVSSMLFVFLLYIRFMT 121
              +E +++G +     I+N      L+ T        A V++++ + +F +L+   +  
Sbjct: 19  SYGIEVLKFGTVGGAAFIVNSVTVWVLMTTIMSESHTKAKVVASIVATIFSWLMNRLWTF 78

Query: 122 R 122
           R
Sbjct: 79  R 79


>gi|308173816|ref|YP_003920521.1| hypothetical protein BAMF_1925 [Bacillus amyloliquefaciens DSM 7]
 gi|307606680|emb|CBI43051.1| putative conserved membrane protein [Bacillus amyloliquefaciens DSM
           7]
 gi|328553257|gb|AEB23749.1| hypothetical protein BAMTA208_07880 [Bacillus amyloliquefaciens
           TA208]
 gi|328911958|gb|AEB63554.1| putative membrane protein [Bacillus amyloliquefaciens LL3]
          Length = 135

 Score = 84.6 bits (208), Expect = 4e-15,   Method: Composition-based stats.
 Identities = 22/121 (18%), Positives = 49/121 (40%), Gaps = 2/121 (1%)

Query: 1   MKQCIIFIINIVVVFFIDVMGFFILMKCGADPFYSRIFSIAVAFLVTWIPSRLFIFLKLR 60
           +K    F    V    ID   FF+L  C      ++I S +   + +++ +R + F   R
Sbjct: 6   IKTLGRFCTVGVGNTLIDFGVFFLLTACHVPYLPAQICSYSAGIINSYVWNRNWTFRVKR 65

Query: 61  RKSFLETVRYGVMYFMLSILNYAFYVKLLLTFQGLQPLLATVLSAVSSMLFVFLLYIRFM 120
           +    E VR+ ++    S++ +           G   L++ + + +  M+  F+    ++
Sbjct: 66  KADGKEIVRFLMINAAASVITFLLLYA--FQKSGCTLLVSKLAATIGGMMMNFIGNRIWV 123

Query: 121 T 121
            
Sbjct: 124 F 124



 Score = 43.0 bits (100), Expect = 0.013,   Method: Composition-based stats.
 Identities = 9/58 (15%), Positives = 25/58 (43%)

Query: 2   KQCIIFIINIVVVFFIDVMGFFILMKCGADPFYSRIFSIAVAFLVTWIPSRLFIFLKL 59
           K+ + F++       I  +  +   K G     S++ +     ++ +I +R+++F   
Sbjct: 70  KEIVRFLMINAAASVITFLLLYAFQKSGCTLLVSKLAATIGGMMMNFIGNRIWVFGDS 127


>gi|307153564|ref|YP_003888948.1| Dolichyl-phosphate beta-D-mannosyltransferase [Cyanothece sp. PCC
           7822]
 gi|306983792|gb|ADN15673.1| Dolichyl-phosphate beta-D-mannosyltransferase [Cyanothece sp. PCC
           7822]
          Length = 409

 Score = 84.6 bits (208), Expect = 4e-15,   Method: Composition-based stats.
 Identities = 24/131 (18%), Positives = 52/131 (39%), Gaps = 10/131 (7%)

Query: 1   MKQCIIFIINIVVVFFIDVMGFFIL---MKCGADPFYSRIFSIAVAFLVTWIPSRLFIFL 57
           + + + F +  +   F+D+  F++L      G     S+I +  VA +  ++ +  + F 
Sbjct: 275 VGRFVRFGLVGLSGVFVDMSLFYLLSDPSALGWGLTRSKIIAAEVAIINNFLWNDRWTFG 334

Query: 58  K------LRRKSFLETVRYGVMYFMLSILNYAFYVKLLLTFQGLQPLLATVLSAVSSMLF 111
                     K     +++ V+     +LN    + LL    G+   LA  L+     L+
Sbjct: 335 DLSSQQRGWGKRLKRLLKFNVICLAGLVLNVLL-LNLLFNVFGINRYLANFLAIGLVTLW 393

Query: 112 VFLLYIRFMTR 122
            F + ++   R
Sbjct: 394 NFWVNLKLSWR 404


>gi|159036463|ref|YP_001535716.1| GtrA family protein [Salinispora arenicola CNS-205]
 gi|157915298|gb|ABV96725.1| GtrA family protein [Salinispora arenicola CNS-205]
          Length = 267

 Score = 84.6 bits (208), Expect = 4e-15,   Method: Composition-based stats.
 Identities = 18/133 (13%), Positives = 40/133 (30%), Gaps = 12/133 (9%)

Query: 1   MKQCIIFIINIVVVFFIDVMGFFILMKCGA-DPFYSRIFSIAVAFLVTWIPSRLFIFLKL 59
           + +   F     V F +D   F ++      +   ++  S  VA    ++ +R + +   
Sbjct: 117 VHELSKFATVGGVAFLVDFALFNVMTAVQDVEQVTAKTISTVVAATFAFLGNRFWTWRHR 176

Query: 60  RRK-SFLETVRYGVMYFMLSILNYAFYVKLLLTF----------QGLQPLLATVLSAVSS 108
           R      E   +     +   +  A                        + + ++    +
Sbjct: 177 RGGNPAREYALFFFFNAVGLGITVAVLAISRYGLGQIWPEVFQTPLADNIASYLVGTGLA 236

Query: 109 MLFVFLLYIRFMT 121
            LF F  Y RF+ 
Sbjct: 237 TLFRFWSYRRFVF 249



 Score = 33.7 bits (76), Expect = 7.7,   Method: Composition-based stats.
 Identities = 10/61 (16%), Positives = 26/61 (42%), Gaps = 1/61 (1%)

Query: 62  KSFLETVRYGVMYFMLSILNYAFYVKLLLTFQGLQPLLATVLSAVSSMLFVFLLYIRFMT 121
               E  ++  +  +  ++++A +   +   Q ++ + A  +S V +  F FL    +  
Sbjct: 115 HLVHELSKFATVGGVAFLVDFALFNV-MTAVQDVEQVTAKTISTVVAATFAFLGNRFWTW 173

Query: 122 R 122
           R
Sbjct: 174 R 174


>gi|291484431|dbj|BAI85506.1| hypothetical protein BSNT_03008 [Bacillus subtilis subsp. natto
           BEST195]
          Length = 148

 Score = 84.6 bits (208), Expect = 5e-15,   Method: Composition-based stats.
 Identities = 23/121 (19%), Positives = 48/121 (39%), Gaps = 2/121 (1%)

Query: 1   MKQCIIFIINIVVVFFIDVMGFFILMKCGADPFYSRIFSIAVAFLVTWIPSRLFIFLKLR 60
           +K    F    V    ID   FF+L  C      ++I S     + +++ +R + F   R
Sbjct: 19  IKTLGRFCTVGVGNTLIDFGVFFLLTACHVSYLPAQICSYTAGIVNSYVWNRNWTFCVKR 78

Query: 61  RKSFLETVRYGVMYFMLSILNYAFYVKLLLTFQGLQPLLATVLSAVSSMLFVFLLYIRFM 120
           +    E VR+ ++    S + +      L    G   L++ + + +  M+  F+    ++
Sbjct: 79  KADGKEIVRFLMINIAASGITFLLLY--LFQNCGCSLLVSKLAATIGGMMMNFIGNRIWV 136

Query: 121 T 121
            
Sbjct: 137 F 137



 Score = 43.3 bits (101), Expect = 0.011,   Method: Composition-based stats.
 Identities = 9/58 (15%), Positives = 27/58 (46%)

Query: 2   KQCIIFIINIVVVFFIDVMGFFILMKCGADPFYSRIFSIAVAFLVTWIPSRLFIFLKL 59
           K+ + F++  +    I  +  ++   CG     S++ +     ++ +I +R+++F   
Sbjct: 83  KEIVRFLMINIAASGITFLLLYLFQNCGCSLLVSKLAATIGGMMMNFIGNRIWVFGDS 140


>gi|302534833|ref|ZP_07287175.1| integral membrane protein [Streptomyces sp. C]
 gi|302443728|gb|EFL15544.1| integral membrane protein [Streptomyces sp. C]
          Length = 178

 Score = 84.2 bits (207), Expect = 5e-15,   Method: Composition-based stats.
 Identities = 14/126 (11%), Positives = 40/126 (31%), Gaps = 5/126 (3%)

Query: 2   KQCIIFIINIVVVFFIDVMGFFILMKCGADPFY-SRIFSIAVAFLVTWIPSRLFIFLKLR 60
           ++ + F         ++   F +L          + + +I VA +  ++  R F +    
Sbjct: 19  REAVKFGAVGGAGVLVNFGVFNLLRNTTDLQTVRANVIAIVVAIITNYVGFRYFTYRDRD 78

Query: 61  R-KSFLETVRYGVMYFMLSILNYAFYVKLLLTF---QGLQPLLATVLSAVSSMLFVFLLY 116
                 E + + +   +  ++           F     L   +   +    + +F F  Y
Sbjct: 79  LGSRRREMLLFVLFSGIGMVIESGVLYVATYGFGFDGSLANNVFKFVGMGVATVFRFWSY 138

Query: 117 IRFMTR 122
             ++ +
Sbjct: 139 RTWVFK 144



 Score = 35.6 bits (81), Expect = 2.5,   Method: Composition-based stats.
 Identities = 13/65 (20%), Positives = 30/65 (46%), Gaps = 1/65 (1%)

Query: 58  KLRRKSFLETVRYGVMYFMLSILNYAFYVKLLLTFQGLQPLLATVLSAVSSMLFVFLLYI 117
           +  R    E V++G +     ++N+  +   L     LQ + A V++ V +++  ++ + 
Sbjct: 12  ERLRGLAREAVKFGAVGGAGVLVNFGVFNL-LRNTTDLQTVRANVIAIVVAIITNYVGFR 70

Query: 118 RFMTR 122
            F  R
Sbjct: 71  YFTYR 75


>gi|304317953|ref|YP_003853098.1| GtrA family protein [Thermoanaerobacterium thermosaccharolyticum
           DSM 571]
 gi|302779455|gb|ADL70014.1| GtrA family protein [Thermoanaerobacterium thermosaccharolyticum
           DSM 571]
          Length = 137

 Score = 84.2 bits (207), Expect = 5e-15,   Method: Composition-based stats.
 Identities = 18/121 (14%), Positives = 48/121 (39%), Gaps = 3/121 (2%)

Query: 3   QCIIFIINIVVVFFIDVMGFFILMKCGADPFYSRIFSIAVAFLVTWIPSRLFIFLKLRRK 62
           + + F +  +V   +D   F +L   G     S++ S +   + ++I ++ + F      
Sbjct: 19  EFVKFNLVGIVNTLVDFAVFTVLTFFGMHYMLSQVISYSCGVVNSFIMNKYWTFGAKSTP 78

Query: 63  SFLETVRYGVMYFMLSILNYAFYVKLLLTFQGLQPLLATVLSAVSSMLFVFLLYIRFMTR 122
              E +++  +  +   ++             L    A +++ + SM+  FL    ++ +
Sbjct: 79  HGDEILKFIAVNVVSLGVSLTVLY---PLKPQLGVFSAKIIATLFSMMVNFLGSKLWVFK 135

Query: 123 R 123
           R
Sbjct: 136 R 136



 Score = 36.8 bits (84), Expect = 0.90,   Method: Composition-based stats.
 Identities = 13/65 (20%), Positives = 34/65 (52%), Gaps = 2/65 (3%)

Query: 57  LKLRRKSFLETVRYGVMYFMLSILNYAFYVKLLLTFQGLQPLLATVLSAVSSMLFVFLLY 116
              R+   LE V++ ++  + +++++A +    LTF G+  +L+ V+S    ++  F++ 
Sbjct: 10  RDNRKNGLLEFVKFNLVGIVNTLVDFAVFTV--LTFFGMHYMLSQVISYSCGVVNSFIMN 67

Query: 117 IRFMT 121
             +  
Sbjct: 68  KYWTF 72


>gi|212225070|ref|YP_002308306.1| dolichol-phosphate mannosyltransferase [Thermococcus onnurineus
           NA1]
 gi|212010027|gb|ACJ17409.1| dolichol-phosphate mannosyltransferase [Thermococcus onnurineus
           NA1]
          Length = 352

 Score = 84.2 bits (207), Expect = 6e-15,   Method: Composition-based stats.
 Identities = 23/123 (18%), Positives = 50/123 (40%), Gaps = 4/123 (3%)

Query: 1   MKQCIIFIINIVVVFFIDVMGFFILM-KCGADPFYSRIFSIAVAFLVTWIPSRLFIFLK- 58
           + + I F+I  ++   ++    +  + K G D   + I +  +A L  +  + L+ F   
Sbjct: 231 LDRLIKFMIVGLLGVLVNQGFLWFFVSKLGWDKILANIPATELAILNNFTWNDLWTFRDL 290

Query: 59  LRRKSFLETVRYGVMYFMLSILNYAFYVKLLLTFQGLQPLLATVLSAVSSMLFVFLLYIR 118
             R   L  + + +     +++ +  Y    L   G+  LLA ++  V S +  FL+   
Sbjct: 291 KMRPLHLRLLSFHLAALTGAVVQWIIYAG--LVLLGMHYLLANMVGIVVSFIVRFLVNRH 348

Query: 119 FMT 121
              
Sbjct: 349 VTW 351



 Score = 42.2 bits (98), Expect = 0.022,   Method: Composition-based stats.
 Identities = 8/55 (14%), Positives = 24/55 (43%)

Query: 3   QCIIFIINIVVVFFIDVMGFFILMKCGADPFYSRIFSIAVAFLVTWIPSRLFIFL 57
           + + F +  +    +  + +  L+  G     + +  I V+F+V ++ +R   + 
Sbjct: 298 RLLSFHLAALTGAVVQWIIYAGLVLLGMHYLLANMVGIVVSFIVRFLVNRHVTWG 352



 Score = 39.5 bits (91), Expect = 0.15,   Method: Composition-based stats.
 Identities = 9/79 (11%), Positives = 30/79 (37%), Gaps = 3/79 (3%)

Query: 44  FLVTWIPSRLFIFLKLRRKSFLETVRYGVMYFMLSILNYAFYVKLLLTFQGLQPLLATVL 103
            ++ ++  +    L          +++ ++  +  ++N  F     ++  G   +LA + 
Sbjct: 213 TILNYL--KHVYRLMKWEGELDRLIKFMIVGLLGVLVNQGFL-WFFVSKLGWDKILANIP 269

Query: 104 SAVSSMLFVFLLYIRFMTR 122
           +   ++L  F     +  R
Sbjct: 270 ATELAILNNFTWNDLWTFR 288


>gi|282900165|ref|ZP_06308121.1| Glycosyl transferase, family 2 [Cylindrospermopsis raciborskii
           CS-505]
 gi|281194914|gb|EFA69855.1| Glycosyl transferase, family 2 [Cylindrospermopsis raciborskii
           CS-505]
          Length = 418

 Score = 83.8 bits (206), Expect = 8e-15,   Method: Composition-based stats.
 Identities = 15/129 (11%), Positives = 49/129 (37%), Gaps = 8/129 (6%)

Query: 1   MKQCIIFIINIVVVFFIDVMGFFILM-KCGADPFYSRIFSIAVAFLVTWIPSRLFIFLK- 58
           + + + F +  +   F+D +  ++L          S+I +  +A    ++ +  + F   
Sbjct: 286 LSRFMRFGLVGLSGVFVDTVVLYLLSDTLALPLIGSKILAGELAIFNNFLWNDAWTFGDI 345

Query: 59  -----LRRKSFLETVRYGVMYFMLSILNYAFYVKLLLTFQGLQPLLATVLSAVSSMLFVF 113
                  ++      ++ ++     ++N       L+ F      +A +++   + ++ F
Sbjct: 346 SIQQRSWKQRIKRFYKFNLICLAGLMINVLILEF-LVQFLISNRYIANLIAIGVTTIWNF 404

Query: 114 LLYIRFMTR 122
            L ++   R
Sbjct: 405 WLNLKLSWR 413


>gi|284029416|ref|YP_003379347.1| GtrA family protein [Kribbella flavida DSM 17836]
 gi|283808709|gb|ADB30548.1| GtrA family protein [Kribbella flavida DSM 17836]
          Length = 188

 Score = 83.8 bits (206), Expect = 8e-15,   Method: Composition-based stats.
 Identities = 22/141 (15%), Positives = 52/141 (36%), Gaps = 19/141 (13%)

Query: 1   MKQCIIFIINIVVVFFIDVMGFFILMK--------------CGADPFYSRIFSIAVAFLV 46
           + +   F +  ++   +D+  +  L+                   P  ++  S+++A + 
Sbjct: 15  VHEVAKFGLVGLLGMVVDLPIYNWLVFDNPLVVFGTHGDGMLHDKPVTAKFISVSIATVA 74

Query: 47  TWIPSRLFIFLKLRRKS-FLETVRYGVMYFMLSILNYAFY----VKLLLTFQGLQPLLAT 101
           T++ +R + +    R     E V + V+  +  ++  A        L L       + A 
Sbjct: 75  TYLGNRHWTWRHRERSGLHREYVLFFVLNGIGLLIAAACLGFSRYVLDLHTALADNISAN 134

Query: 102 VLSAVSSMLFVFLLYIRFMTR 122
           V+      LF F  Y +++ R
Sbjct: 135 VIGLGLGTLFRFWSYRKWVFR 155


>gi|172039528|ref|YP_001806029.1| dolichyl-phosphate-mannose synthase [Cyanothece sp. ATCC 51142]
 gi|171700982|gb|ACB53963.1| dolichyl-phosphate-mannose synthase [Cyanothece sp. ATCC 51142]
          Length = 423

 Score = 83.8 bits (206), Expect = 8e-15,   Method: Composition-based stats.
 Identities = 20/136 (14%), Positives = 49/136 (36%), Gaps = 10/136 (7%)

Query: 3   QCIIFIINIVVVFFIDVMGFFILM---KCGADPFYSRIFSIAVAFLVTWIPSRLFIFLK- 58
           + I F +  +    +D+   ++L      G     S+I +  +A +  ++ +  + F   
Sbjct: 289 RFIQFCLVGLSGVVVDMGFLYLLSDPNTLGLPLTRSKIIAAELAIINNFLWNDFWTFGDI 348

Query: 59  -----LRRKSFLETVRYGVMYFMLSILNYAFYVKLLLTFQGLQPLLATVLSAVSSMLFVF 113
                 +R+     +++ V+     IL     + +      L   +A  L+     L+ F
Sbjct: 349 ARRQPGKRQRLKRLIKFNVICLAGLIL-NVLLLNVFFNVFNLNRYIANFLAIGLVTLWNF 407

Query: 114 LLYIRFMTRRVYFIKK 129
              ++   R     +K
Sbjct: 408 WFNLKLSWRVTEVNEK 423


>gi|154686263|ref|YP_001421424.1| YngA [Bacillus amyloliquefaciens FZB42]
 gi|42491125|emb|CAE11262.1| YngA protein [Bacillus amyloliquefaciens FZB42]
 gi|154352114|gb|ABS74193.1| YngA [Bacillus amyloliquefaciens FZB42]
          Length = 135

 Score = 83.8 bits (206), Expect = 8e-15,   Method: Composition-based stats.
 Identities = 21/121 (17%), Positives = 47/121 (38%), Gaps = 2/121 (1%)

Query: 1   MKQCIIFIINIVVVFFIDVMGFFILMKCGADPFYSRIFSIAVAFLVTWIPSRLFIFLKLR 60
           +K    F    V    ID   FF+L  C      ++I S +   + +++ +R + F   R
Sbjct: 6   VKTAGRFCTVGVGNTLIDFGVFFLLAACHVPYLPAQICSYSAGIINSYVWNRKWTFRVKR 65

Query: 61  RKSFLETVRYGVMYFMLSILNYAFYVKLLLTFQGLQPLLATVLSAVSSMLFVFLLYIRFM 120
           +    E +R+ ++    S + +           G   L++   + +  M+  F+    ++
Sbjct: 66  KADGKEIMRFVMINLAASGITFLLLYA--FQKGGCSLLVSKFAATIGGMMMNFIGNRIWV 123

Query: 121 T 121
            
Sbjct: 124 F 124



 Score = 41.4 bits (96), Expect = 0.041,   Method: Composition-based stats.
 Identities = 9/58 (15%), Positives = 25/58 (43%)

Query: 2   KQCIIFIINIVVVFFIDVMGFFILMKCGADPFYSRIFSIAVAFLVTWIPSRLFIFLKL 59
           K+ + F++  +    I  +  +   K G     S+  +     ++ +I +R+++F   
Sbjct: 70  KEIMRFVMINLAASGITFLLLYAFQKGGCSLLVSKFAATIGGMMMNFIGNRIWVFGDS 127


>gi|300743823|ref|ZP_07072843.1| putative membrane protein [Rothia dentocariosa M567]
 gi|300380184|gb|EFJ76747.1| putative membrane protein [Rothia dentocariosa M567]
          Length = 211

 Score = 83.4 bits (205), Expect = 8e-15,   Method: Composition-based stats.
 Identities = 18/128 (14%), Positives = 49/128 (38%), Gaps = 7/128 (5%)

Query: 3   QCIIFIINIVVVFFIDVMGFFILMK--CGADPFYSRIFSIAVAFLVTWIPSRLFIFLKLR 60
           + + F       F ++    + LM          +++ +  VA +  WI +RL+ F + R
Sbjct: 23  EVLKFGTVGGAAFLVNAAVVWALMLGPFENAHTKAKVIASVVATIFAWIMNRLWTFREDR 82

Query: 61  RKSF-LETVRYGVMYFMLSILNYAFY----VKLLLTFQGLQPLLATVLSAVSSMLFVFLL 115
            +++  E + + ++  +  ++           L L       +  T++      +  + L
Sbjct: 83  SENWKREGIEFALVNILGILVEAGCVFFTNYVLGLRSPEASFISGTIIGTALGTILRYFL 142

Query: 116 YIRFMTRR 123
           Y  ++  +
Sbjct: 143 YRFWVYGK 150


>gi|186684340|ref|YP_001867536.1| GtrA family protein [Nostoc punctiforme PCC 73102]
 gi|186466792|gb|ACC82593.1| GtrA family protein [Nostoc punctiforme PCC 73102]
          Length = 415

 Score = 83.4 bits (205), Expect = 9e-15,   Method: Composition-based stats.
 Identities = 15/131 (11%), Positives = 46/131 (35%), Gaps = 10/131 (7%)

Query: 1   MKQCIIFIINIVVVFFIDVMGFFIL---MKCGADPFYSRIFSIAVAFLVTWIPSRLFIFL 57
           + + I F +  +   F+D+   ++L            S+I +  +A L  ++ +  + F 
Sbjct: 281 IGRFIRFGLVGLSGVFVDMTILYLLSDPTTLAWPLTRSKIMAGEIAILNNFLWNDAWTFA 340

Query: 58  K------LRRKSFLETVRYGVMYFMLSILNYAFYVKLLLTFQGLQPLLATVLSAVSSMLF 111
                     +     +++  +     +LN      +          +A  ++   + ++
Sbjct: 341 DVSARQQEWHQRLKRFLKFNAICLAGLVLNVLVLNLVFNFLIP-NRYIANFIAIAVATIW 399

Query: 112 VFLLYIRFMTR 122
            F + ++   R
Sbjct: 400 NFWINLKLSWR 410


>gi|269128316|ref|YP_003301686.1| GtrA family protein [Thermomonospora curvata DSM 43183]
 gi|268313274|gb|ACY99648.1| GtrA family protein [Thermomonospora curvata DSM 43183]
          Length = 221

 Score = 83.4 bits (205), Expect = 1e-14,   Method: Composition-based stats.
 Identities = 19/126 (15%), Positives = 41/126 (32%), Gaps = 5/126 (3%)

Query: 1   MKQCIIFIINIVVVFFIDVMGFFIL-MKCGADPFYSRIFSIAVAFLVTWIPSRLFIFLKL 59
           +++   F     + F I +     L       P  S   +  VA    ++ +R + F   
Sbjct: 29  VRELAKFGSVGAMAFVITIGTANALQFGLHLGPLKSNAVATVVATTFAYLANRYWTFRHR 88

Query: 60  RRKSF-LETVRYGVMYFMLSILNYAFYVKLLLTFQGLQPL---LATVLSAVSSMLFVFLL 115
            R     E V +  +  +  ++                P+    + +L    + LF F  
Sbjct: 89  DRSGMGREYVLFFALNGVGLVITNLVIGFTHYGLGLDDPVAYNASLILGTGIATLFRFWS 148

Query: 116 YIRFMT 121
           Y +++ 
Sbjct: 149 YKKWVF 154



 Score = 34.5 bits (78), Expect = 4.4,   Method: Composition-based stats.
 Identities = 12/75 (16%), Positives = 26/75 (34%), Gaps = 1/75 (1%)

Query: 48  WIPSRLFIFLKLRRKSFLETVRYGVMYFMLSILNYAFYVKLLLTFQGLQPLLATVLSAVS 107
           +  S +    +       E  ++G +  M  ++       L      L PL +  ++ V 
Sbjct: 13  FFVSLIANLYRRFEHLVRELAKFGSVGAMAFVITIGTANALQFGL-HLGPLKSNAVATVV 71

Query: 108 SMLFVFLLYIRFMTR 122
           +  F +L    +  R
Sbjct: 72  ATTFAYLANRYWTFR 86


>gi|311113066|ref|YP_003984288.1| hypothetical protein HMPREF0733_11397 [Rothia dentocariosa ATCC
           17931]
 gi|310944560|gb|ADP40854.1| conserved hypothetical protein [Rothia dentocariosa ATCC 17931]
          Length = 214

 Score = 83.4 bits (205), Expect = 1e-14,   Method: Composition-based stats.
 Identities = 18/128 (14%), Positives = 48/128 (37%), Gaps = 7/128 (5%)

Query: 3   QCIIFIINIVVVFFIDVMGFFILMK--CGADPFYSRIFSIAVAFLVTWIPSRLFIFLKLR 60
           + + F       F ++    + LM          +++ +  VA +  WI +RL+ F + R
Sbjct: 26  EVLKFGTVGGAAFLVNAAVVWALMLGPFENAHTKAKVIASVVATIFAWIMNRLWTFREDR 85

Query: 61  RKSF-LETVRYGVMYFMLSILNYAFY----VKLLLTFQGLQPLLATVLSAVSSMLFVFLL 115
            +++  E + +  +  +  ++           L L       +  T++      +  + L
Sbjct: 86  SENWKREGIEFAFVNILGILVEAGCVFFTNYVLGLRSPEASFISGTIIGTALGTILRYFL 145

Query: 116 YIRFMTRR 123
           Y  ++  +
Sbjct: 146 YRFWVYGK 153


>gi|296168924|ref|ZP_06850593.1| GtrA family protein [Mycobacterium parascrofulaceum ATCC BAA-614]
 gi|295896393|gb|EFG76046.1| GtrA family protein [Mycobacterium parascrofulaceum ATCC BAA-614]
          Length = 219

 Score = 83.0 bits (204), Expect = 1e-14,   Method: Composition-based stats.
 Identities = 23/134 (17%), Positives = 49/134 (36%), Gaps = 15/134 (11%)

Query: 3   QCIIFIINIVVVFFIDVMGFFIL--MKCGADPFYSRIFSIAVAFLVTWIPSRLFIFLKL- 59
           + I F I     F ID   F+ L      + P  +++ +  VA + +++ +R + F    
Sbjct: 24  ELIKFAIVGGTTFVIDSAIFYTLKLTILDSKPVTAKVIAGIVAVIASYVLNREWSFRDRG 83

Query: 60  RRKSFLETVRYGVMYFMLSILNYAFYVKLLLTFQ------------GLQPLLATVLSAVS 107
            R+   E + +     +  +L+ A         Q                + A ++  + 
Sbjct: 84  GRERHHEALLFFAFSGVGVLLSMAPLWFSSYVLQLREPMVSLTVENIADFISAYIIGNLL 143

Query: 108 SMLFVFLLYIRFMT 121
            M F F  + R++ 
Sbjct: 144 QMAFRFWAFRRWVF 157



 Score = 39.5 bits (91), Expect = 0.14,   Method: Composition-based stats.
 Identities = 11/67 (16%), Positives = 34/67 (50%)

Query: 56  FLKLRRKSFLETVRYGVMYFMLSILNYAFYVKLLLTFQGLQPLLATVLSAVSSMLFVFLL 115
           F++   +   E +++ ++     +++ A +  L LT    +P+ A V++ + +++  ++L
Sbjct: 14  FIQPYLQRHHELIKFAIVGGTTFVIDSAIFYTLKLTILDSKPVTAKVIAGIVAVIASYVL 73

Query: 116 YIRFMTR 122
              +  R
Sbjct: 74  NREWSFR 80


>gi|154151989|ref|YP_001405607.1| dolichyl-phosphate beta-D-mannosyltransferase [Candidatus
           Methanoregula boonei 6A8]
 gi|154000541|gb|ABS56964.1| Dolichyl-phosphate beta-D-mannosyltransferase [Methanoregula boonei
           6A8]
          Length = 376

 Score = 83.0 bits (204), Expect = 1e-14,   Method: Composition-based stats.
 Identities = 20/125 (16%), Positives = 46/125 (36%), Gaps = 5/125 (4%)

Query: 3   QCIIFIINIVVVFFIDVMGFFILMKCGADPF-YSRIFSIAVAFLVTWIPSRLFIFLKLRR 61
           +   F I  +    ++      L          + I SI ++ L  +I +  + F   + 
Sbjct: 243 KLFRFGIVGLTGIIVNEGLLIYLRSYAQFALPVASIISIELSILSNFILNDSWTFKTGQH 302

Query: 62  ---KSFLETVRYGVMYFMLSILNYAFYVKLLLTFQGLQPLLATVLSAVSSMLFVFLLYIR 118
                +   + + V+    + +N+     L L   G+   +A +L  V +  + FL+  R
Sbjct: 303 ALPHWWQRLLSFQVVSLGGAAINFVILNALALYV-GVDYRVANILGIVVAFAWNFLVNRR 361

Query: 119 FMTRR 123
              ++
Sbjct: 362 VTWKK 366



 Score = 46.0 bits (108), Expect = 0.002,   Method: Composition-based stats.
 Identities = 12/61 (19%), Positives = 26/61 (42%), Gaps = 1/61 (1%)

Query: 2   KQCIIFIINIVVVFFIDVMGFFIL-MKCGADPFYSRIFSIAVAFLVTWIPSRLFIFLKLR 60
           ++ + F +  +    I+ +    L +  G D   + I  I VAF   ++ +R   + K  
Sbjct: 309 QRLLSFQVVSLGGAAINFVILNALALYVGVDYRVANILGIVVAFAWNFLVNRRVTWKKSG 368

Query: 61  R 61
           +
Sbjct: 369 Q 369


>gi|21221502|ref|NP_627281.1| integral membrane protein [Streptomyces coelicolor A3(2)]
 gi|7672244|emb|CAB89433.1| putative integral membrane protein [Streptomyces coelicolor A3(2)]
          Length = 190

 Score = 83.0 bits (204), Expect = 1e-14,   Method: Composition-based stats.
 Identities = 17/127 (13%), Positives = 42/127 (33%), Gaps = 5/127 (3%)

Query: 1   MKQCIIFIINIVVVFFIDVMGFFILMKCGADPFY-SRIFSIAVAFLVTWIPSRLFIFLKL 59
           +++ + F         ++++ F  +          + I +  VA +  ++  R F +   
Sbjct: 30  VREVVKFGAVGGAGVLVNLLVFNFVRHTTDLQVVRASIVATVVAIVFNYLGFRYFAYRDR 89

Query: 60  RRKS-FLETVRYGVMYFMLSILNYAFYVKLLLTFQGLQPLLATV---LSAVSSMLFVFLL 115
            +     E   + +   +  ++           F    PL + +   L      LF F  
Sbjct: 90  DKSGQTREMSLFLLFSAVGLVIENGVLYTATYGFGWDSPLQSNIFKFLGIGIGTLFRFWS 149

Query: 116 YIRFMTR 122
           Y  ++ R
Sbjct: 150 YRSWVFR 156



 Score = 34.1 bits (77), Expect = 6.9,   Method: Composition-based stats.
 Identities = 13/66 (19%), Positives = 32/66 (48%), Gaps = 1/66 (1%)

Query: 57  LKLRRKSFLETVRYGVMYFMLSILNYAFYVKLLLTFQGLQPLLATVLSAVSSMLFVFLLY 116
            +   +   E V++G +     ++N   +  +  T   LQ + A++++ V +++F +L +
Sbjct: 23  RERVDRLVREVVKFGAVGGAGVLVNLLVFNFVRHTT-DLQVVRASIVATVVAIVFNYLGF 81

Query: 117 IRFMTR 122
             F  R
Sbjct: 82  RYFAYR 87


>gi|308406110|ref|ZP_07669510.1| conserved membrane protein [Mycobacterium tuberculosis SUMu012]
 gi|308364506|gb|EFP53357.1| conserved membrane protein [Mycobacterium tuberculosis SUMu012]
          Length = 289

 Score = 83.0 bits (204), Expect = 1e-14,   Method: Composition-based stats.
 Identities = 23/134 (17%), Positives = 48/134 (35%), Gaps = 15/134 (11%)

Query: 3   QCIIFIINIVVVFFIDVMGFFIL--MKCGADPFYSRIFSIAVAFLVTWIPSRLFIFLKL- 59
           + I F I     F ID   F+ L        P  +++ +  VA + +++ +R + F    
Sbjct: 90  ELIKFAIVGGTTFIIDTAIFYTLKLTVLEPKPVTAKVIAGIVAVIASYVLNREWSFRDRG 149

Query: 60  RRKSFLETVRYGVMYFMLSILNYAFYVKLLLTFQ------------GLQPLLATVLSAVS 107
            R+   E + +     +  +L+ A         Q                + A ++  + 
Sbjct: 150 GRERHHEALLFFAFSGVGVLLSMAPLWFSSYILQLRVPTVSLTMENIADFISAYIIGNLL 209

Query: 108 SMLFVFLLYIRFMT 121
            M F F  + R++ 
Sbjct: 210 QMAFRFWAFRRWVF 223



 Score = 40.3 bits (93), Expect = 0.091,   Method: Composition-based stats.
 Identities = 17/102 (16%), Positives = 43/102 (42%), Gaps = 5/102 (4%)

Query: 21  GFFILMKCGADPFYSRIFSIAVAFLVTWIPSRLFIFLKLRRKSFLETVRYGVMYFMLSIL 80
             +          +S + S A A +      RL   ++   +   E +++ ++     I+
Sbjct: 50  VTYHFASILCSSVHSLVVSFADATIA-----RLPGVVQPYAQRHHELIKFAIVGGTTFII 104

Query: 81  NYAFYVKLLLTFQGLQPLLATVLSAVSSMLFVFLLYIRFMTR 122
           + A +  L LT    +P+ A V++ + +++  ++L   +  R
Sbjct: 105 DTAIFYTLKLTVLEPKPVTAKVIAGIVAVIASYVLNREWSFR 146


>gi|271965217|ref|YP_003339413.1| membrane protein [Streptosporangium roseum DSM 43021]
 gi|270508392|gb|ACZ86670.1| membrane protein-like protein [Streptosporangium roseum DSM 43021]
          Length = 186

 Score = 83.0 bits (204), Expect = 1e-14,   Method: Composition-based stats.
 Identities = 20/135 (14%), Positives = 53/135 (39%), Gaps = 15/135 (11%)

Query: 2   KQCIIFIINIVVVFFIDVMGFFIL--MKCGADPFYSRIFSIAVAFLVTWIPSRLFIFLKL 59
           ++ + F +     F +D   F+ L        P  +++ ++ VA +V+++ +R + F   
Sbjct: 29  RELLKFAVVGGAAFLVDNTVFYGLKLTILEPKPVTAKVIAVLVATIVSYVLNREWSFRTR 88

Query: 60  -RRKSFLETVRYGVMYFMLSILNYAFYVKLLLTFQ------------GLQPLLATVLSAV 106
             R+   E   + ++  +  +L+          F                 + A V+  +
Sbjct: 89  GGRERHHEAALFFLVSGVGLVLSSVPLWISRYVFLLETPEVSLVTQEIADFMSAQVIGTL 148

Query: 107 SSMLFVFLLYIRFMT 121
            +M+F F  + +++ 
Sbjct: 149 IAMVFRFWAFRKWVF 163



 Score = 39.1 bits (90), Expect = 0.19,   Method: Composition-based stats.
 Identities = 10/59 (16%), Positives = 28/59 (47%)

Query: 64  FLETVRYGVMYFMLSILNYAFYVKLLLTFQGLQPLLATVLSAVSSMLFVFLLYIRFMTR 122
             E +++ V+     +++   +  L LT    +P+ A V++ + + +  ++L   +  R
Sbjct: 28  HRELLKFAVVGGAAFLVDNTVFYGLKLTILEPKPVTAKVIAVLVATIVSYVLNREWSFR 86


>gi|82701411|ref|YP_410977.1| dolichyl-phosphate beta-D-mannosyltransferase [Nitrosospira
           multiformis ATCC 25196]
 gi|82409476|gb|ABB73585.1| Dolichyl-phosphate beta-D-mannosyltransferase [Nitrosospira
           multiformis ATCC 25196]
          Length = 373

 Score = 83.0 bits (204), Expect = 1e-14,   Method: Composition-based stats.
 Identities = 17/129 (13%), Positives = 55/129 (42%), Gaps = 2/129 (1%)

Query: 2   KQCIIFIINIVVVFFIDVMGFFILMKCGADPFYSRIFSIAVAFLVTWIPSRLFIFLKLRR 61
           K  I F I  +    +++  F +L++   + + +   SI ++ +  ++ +  + F     
Sbjct: 244 KTFIKFAIVGLSGVIVNLGVFTLLLQANVNKYLASPISIEISIITNFLLNNYWTFRWRTS 303

Query: 62  --KSFLETVRYGVMYFMLSILNYAFYVKLLLTFQGLQPLLATVLSAVSSMLFVFLLYIRF 119
                ++ +++ ++  +   ++Y+ +V L + F  + P +  ++    +M   + L   +
Sbjct: 304 QDHIRVKGLKFNMVSLVSLGVSYSTFVVLSVLFPDVSPEIHQLVGIAPAMFINYFLNSYW 363

Query: 120 MTRRVYFIK 128
             +     K
Sbjct: 364 TFKNTPAPK 372



 Score = 40.7 bits (94), Expect = 0.063,   Method: Composition-based stats.
 Identities = 16/81 (19%), Positives = 36/81 (44%), Gaps = 6/81 (7%)

Query: 42  VAFLVTWIPSRLFIFLKLRRKSFLETVRYGVMYFMLSILNYAFYVKLLLTFQGLQPLLAT 101
           ++ ++ +I +  +I    R  S    +++ ++     I+N   +   LL    +   LA+
Sbjct: 225 ISDIIEFILNAWWI----RLHSSKTFIKFAIVGLSGVIVNLGVF--TLLLQANVNKYLAS 278

Query: 102 VLSAVSSMLFVFLLYIRFMTR 122
            +S   S++  FLL   +  R
Sbjct: 279 PISIEISIITNFLLNNYWTFR 299


>gi|16078878|ref|NP_389699.1| hypothetical protein BSU18170 [Bacillus subtilis subsp. subtilis
           str. 168]
 gi|221309707|ref|ZP_03591554.1| hypothetical protein Bsubs1_10011 [Bacillus subtilis subsp.
           subtilis str. 168]
 gi|221314029|ref|ZP_03595834.1| hypothetical protein BsubsN3_09952 [Bacillus subtilis subsp.
           subtilis str. NCIB 3610]
 gi|221318951|ref|ZP_03600245.1| hypothetical protein BsubsJ_09866 [Bacillus subtilis subsp.
           subtilis str. JH642]
 gi|221323225|ref|ZP_03604519.1| hypothetical protein BsubsS_09987 [Bacillus subtilis subsp.
           subtilis str. SMY]
 gi|81341967|sp|O31821|YNGA_BACSU RecName: Full=Uncharacterized membrane protein yngA
 gi|2634200|emb|CAB13700.1| putative conserved membrane protein [Bacillus subtilis subsp.
           subtilis str. 168]
          Length = 148

 Score = 83.0 bits (204), Expect = 1e-14,   Method: Composition-based stats.
 Identities = 23/121 (19%), Positives = 48/121 (39%), Gaps = 2/121 (1%)

Query: 1   MKQCIIFIINIVVVFFIDVMGFFILMKCGADPFYSRIFSIAVAFLVTWIPSRLFIFLKLR 60
           +K    F    V    ID   FF+L  C      ++I S     + +++ +R + F   R
Sbjct: 19  IKTLGRFCTVGVGNTLIDFGVFFLLTACHVSYLPAQICSYTAGIVNSYVWNRNWTFCVKR 78

Query: 61  RKSFLETVRYGVMYFMLSILNYAFYVKLLLTFQGLQPLLATVLSAVSSMLFVFLLYIRFM 120
           +    E VR+ ++    S + +      L    G   L++ + + +  M+  F+    ++
Sbjct: 79  KADGKEIVRFLMINIAASGITFLLLY--LFQNCGCSLLVSKLAATIGGMMMNFIGNRIWV 136

Query: 121 T 121
            
Sbjct: 137 F 137



 Score = 42.6 bits (99), Expect = 0.016,   Method: Composition-based stats.
 Identities = 9/58 (15%), Positives = 27/58 (46%)

Query: 2   KQCIIFIINIVVVFFIDVMGFFILMKCGADPFYSRIFSIAVAFLVTWIPSRLFIFLKL 59
           K+ + F++  +    I  +  ++   CG     S++ +     ++ +I +R+++F   
Sbjct: 83  KEIVRFLMINIAASGITFLLLYLFQNCGCSLLVSKLAATIGGMMMNFIGNRIWVFGDS 140


>gi|258654343|ref|YP_003203499.1| GtrA family protein [Nakamurella multipartita DSM 44233]
 gi|258557568|gb|ACV80510.1| GtrA family protein [Nakamurella multipartita DSM 44233]
          Length = 200

 Score = 82.6 bits (203), Expect = 1e-14,   Method: Composition-based stats.
 Identities = 23/135 (17%), Positives = 49/135 (36%), Gaps = 15/135 (11%)

Query: 2   KQCIIFIINIVVVFFIDVMGFFILMK--CGADPFYSRIFSIAVAFLVTWIPSRLFIFLKL 59
           ++   F++     + +DV  F +L           ++  S+ VA ++++I +R + F   
Sbjct: 16  RELAKFLVVGGTSYVVDVGLFSLLSHTVLSDKVVTAKGISVIVATILSYILNREWSFNSR 75

Query: 60  -RRKSFLETVRYGVMYFMLSILNYAFYVKLLLTFQ------------GLQPLLATVLSAV 106
             R+   E + + V+  +   LN          F                 + A V+   
Sbjct: 76  GGRERHHEAMLFFVVNGIALGLNLVPLAVSQYIFGINTANYSSLTVTIANFVSANVIGTA 135

Query: 107 SSMLFVFLLYIRFMT 121
             M F F  Y +++ 
Sbjct: 136 LGMAFRFWAYRKWVF 150


>gi|332671028|ref|YP_004454036.1| GtrA family protein [Cellulomonas fimi ATCC 484]
 gi|332340066|gb|AEE46649.1| GtrA family protein [Cellulomonas fimi ATCC 484]
          Length = 167

 Score = 82.6 bits (203), Expect = 2e-14,   Method: Composition-based stats.
 Identities = 28/128 (21%), Positives = 54/128 (42%), Gaps = 9/128 (7%)

Query: 3   QCIIFIINIVVVFFIDVMGFFILMK-----CGADPFYSRIFSIAVAFLVTWIPSRLFIFL 57
           + + F+    V F +D+  F +L           P  ++I S+AVA LV+W+ +R + F 
Sbjct: 36  EMLRFLSVGGVAFVVDLGLFNLLRFGPGELLEHKPLTAKILSMAVATLVSWLGNRHWTFA 95

Query: 58  -KLRRKSFLETVRYGVMYFMLSILNYAFYVKLLLTFQGLQPL---LATVLSAVSSMLFVF 113
                +   E + YG +  + + +            Q   PL   +ATV+      +  +
Sbjct: 96  AHRTERHGRELLVYGAVNLVGAAVPVLTLAFSHYVLQQDSPLADNVATVVGIAVGTVLRY 155

Query: 114 LLYIRFMT 121
           + Y R++ 
Sbjct: 156 VGYKRWVF 163



 Score = 34.5 bits (78), Expect = 5.4,   Method: Composition-based stats.
 Identities = 10/62 (16%), Positives = 23/62 (37%), Gaps = 3/62 (4%)

Query: 63  SFLETVRYGVMYFMLSILNYAFYVKLLLT---FQGLQPLLATVLSAVSSMLFVFLLYIRF 119
              E +R+  +  +  +++   +  L          +PL A +LS   + L  +L    +
Sbjct: 33  RAAEMLRFLSVGGVAFVVDLGLFNLLRFGPGELLEHKPLTAKILSMAVATLVSWLGNRHW 92

Query: 120 MT 121
             
Sbjct: 93  TF 94


>gi|283458625|ref|YP_003363260.1| hypothetical protein RMDY18_16080 [Rothia mucilaginosa DY-18]
 gi|283134675|dbj|BAI65440.1| predicted membrane protein [Rothia mucilaginosa DY-18]
          Length = 205

 Score = 82.6 bits (203), Expect = 2e-14,   Method: Composition-based stats.
 Identities = 17/126 (13%), Positives = 51/126 (40%), Gaps = 7/126 (5%)

Query: 3   QCIIFIINIVVVFFIDVMGFFIL--MKCGADPFYSRIFSIAVAFLVTWIPSRLFIFLKLR 60
           + + F       F ++ +  ++L           +++ +  VA + +W+ +RL+ F   R
Sbjct: 23  EVLKFGTVGGAAFIVNSVTVWVLMMTIMSESHTKAKVVASVVATIFSWLMNRLWTFRDSR 82

Query: 61  RKSF-LETVRYGVMYFMLSILNYAFY----VKLLLTFQGLQPLLATVLSAVSSMLFVFLL 115
            +++  E + +G++  +  ++           L L       +  T++  +   +  + L
Sbjct: 83  SENWKREAIEFGLVNLLGILVEAGCVAFSTYVLNLRTPEASFISGTIIGTILGTILRYFL 142

Query: 116 YIRFMT 121
           Y  ++ 
Sbjct: 143 YRFWVY 148



 Score = 39.5 bits (91), Expect = 0.15,   Method: Composition-based stats.
 Identities = 12/61 (19%), Positives = 28/61 (45%)

Query: 62  KSFLETVRYGVMYFMLSILNYAFYVKLLLTFQGLQPLLATVLSAVSSMLFVFLLYIRFMT 121
              +E +++G +     I+N      L++T        A V+++V + +F +L+   +  
Sbjct: 19  SYGIEVLKFGTVGGAAFIVNSVTVWVLMMTIMSESHTKAKVVASVVATIFSWLMNRLWTF 78

Query: 122 R 122
           R
Sbjct: 79  R 79


>gi|315227160|ref|ZP_07868947.1| GtrA family protein [Parascardovia denticolens DSM 10105]
 gi|315119610|gb|EFT82743.1| GtrA family protein [Parascardovia denticolens DSM 10105]
          Length = 250

 Score = 82.6 bits (203), Expect = 2e-14,   Method: Composition-based stats.
 Identities = 20/132 (15%), Positives = 50/132 (37%), Gaps = 13/132 (9%)

Query: 1   MKQCIIFIINIVVVFFIDVMGFFILMKCGADPFYSRIFSIAVAFLVTWIPSRLFIFLKL- 59
           ++Q I F I  V+ F ID     +L+  G +   +   S  ++ +  ++ S  ++F+   
Sbjct: 8   IEQIIKFGIVGVIAFLIDFGLLNLLVHFGMNAVVAGTISFTISLIFNYLASMRYVFVHRP 67

Query: 60  RRKSFLETVRYGVMYFMLSILNYAFYVKLLLTFQG------------LQPLLATVLSAVS 107
               ++E + + V   +   +N                         +  + + +++ V 
Sbjct: 68  DMAQWMEILIFVVSSVIGLGINDWIIWIGTGRMLPAGTQTSDPTKYQIYTIGSKLVATVV 127

Query: 108 SMLFVFLLYIRF 119
            M++ FL+    
Sbjct: 128 VMVWNFLIRKWL 139



 Score = 38.3 bits (88), Expect = 0.35,   Method: Composition-based stats.
 Identities = 10/61 (16%), Positives = 33/61 (54%), Gaps = 2/61 (3%)

Query: 61  RKSFLETVRYGVMYFMLSILNYAFYVKLLLTFQGLQPLLATVLSAVSSMLFVFLLYIRFM 120
           ++   + +++G++  +  ++++      LL   G+  ++A  +S   S++F +L  +R++
Sbjct: 5   KRLIEQIIKFGIVGVIAFLIDFGLL--NLLVHFGMNAVVAGTISFTISLIFNYLASMRYV 62

Query: 121 T 121
            
Sbjct: 63  F 63


>gi|257061687|ref|YP_003139575.1| Dolichyl-phosphate beta-D-mannosyltransferase [Cyanothece sp. PCC
           8802]
 gi|256591853|gb|ACV02740.1| Dolichyl-phosphate beta-D-mannosyltransferase [Cyanothece sp. PCC
           8802]
          Length = 397

 Score = 82.6 bits (203), Expect = 2e-14,   Method: Composition-based stats.
 Identities = 19/129 (14%), Positives = 49/129 (37%), Gaps = 10/129 (7%)

Query: 3   QCIIFIINIVVVFFIDVMGFFILM---KCGADPFYSRIFSIAVAFLVTWIPSRLFIFLK- 58
           + I F +  +    +D+   ++L            S+I +  +A +  +I +  + F   
Sbjct: 265 RFIQFCLVGLSGVVVDMGFLYLLSDPSTLALPLTRSKIIAAELAIINNFIWNDFWTFGDI 324

Query: 59  -----LRRKSFLETVRYGVMYFMLSILNYAFYVKLLLTFQGLQPLLATVLSAVSSMLFVF 113
                 +R+     +++ ++  +  ILN   ++ L      L   ++ +L+      F F
Sbjct: 325 AQRQPGKRQRLKRLIKFNIICLVGLILN-VLFLNLFFNVFNLNRYISNLLAIGLVTFFNF 383

Query: 114 LLYIRFMTR 122
              ++   R
Sbjct: 384 WFNLKLSWR 392



 Score = 37.2 bits (85), Expect = 0.79,   Method: Composition-based stats.
 Identities = 8/58 (13%), Positives = 23/58 (39%), Gaps = 1/58 (1%)

Query: 1   MKQCIIFIINIVVVFFIDVMGFFILMK-CGADPFYSRIFSIAVAFLVTWIPSRLFIFL 57
           +K+ I F I  +V   ++V+   +       + + S + +I +     +  +    + 
Sbjct: 335 LKRLIKFNIICLVGLILNVLFLNLFFNVFNLNRYISNLLAIGLVTFFNFWFNLKLSWR 392


>gi|114567665|ref|YP_754819.1| dolichyl-phosphate beta-D-mannosyltransferase [Syntrophomonas
           wolfei subsp. wolfei str. Goettingen]
 gi|114338600|gb|ABI69448.1| Dolichyl-phosphate beta-D-mannosyltransferase [Syntrophomonas
           wolfei subsp. wolfei str. Goettingen]
          Length = 386

 Score = 82.3 bits (202), Expect = 2e-14,   Method: Composition-based stats.
 Identities = 14/121 (11%), Positives = 43/121 (35%), Gaps = 2/121 (1%)

Query: 2   KQCIIFIINIVVVFFIDVMGFFILMKCGADPFYSRIFSIAVAFLVTWIPSRLFIF-LKLR 60
           ++   F +  +   F++++ +F L     +   +   S  VA LV ++ +    +     
Sbjct: 234 RRFFYFSLVGLSGVFVNMLIYFFLTMLNLEVRIAGFCSAFVAMLVNFVLNDKITWAYVKT 293

Query: 61  RKSFLETVRYGVMYFMLSILNYAFYVKLLLTFQGLQPLLATVLSAVSSMLFVFLLYIRFM 120
              +    +Y +   +   +N           Q    LL+ ++    ++ + + +   + 
Sbjct: 294 NSVWSRGSKYIITSLIGIGINVGVLDFFYYQLQ-FNHLLSNLIGISCAVFWNYTINNLWT 352

Query: 121 T 121
            
Sbjct: 353 W 353



 Score = 43.0 bits (100), Expect = 0.014,   Method: Composition-based stats.
 Identities = 9/58 (15%), Positives = 22/58 (37%), Gaps = 1/58 (1%)

Query: 6   IFIINIVVVFFIDVMGF-FILMKCGADPFYSRIFSIAVAFLVTWIPSRLFIFLKLRRK 62
            +II  ++   I+V    F   +   +   S +  I+ A    +  + L+ +   +  
Sbjct: 302 KYIITSLIGIGINVGVLDFFYYQLQFNHLLSNLIGISCAVFWNYTINNLWTWSTAKHN 359


>gi|169334358|ref|ZP_02861551.1| hypothetical protein ANASTE_00757 [Anaerofustis stercorihominis DSM
           17244]
 gi|169259075|gb|EDS73041.1| hypothetical protein ANASTE_00757 [Anaerofustis stercorihominis DSM
           17244]
          Length = 340

 Score = 82.3 bits (202), Expect = 2e-14,   Method: Composition-based stats.
 Identities = 15/121 (12%), Positives = 45/121 (37%), Gaps = 2/121 (1%)

Query: 2   KQCIIFIINIVVVFFIDVMGFFILMKCGADPFYSRIFSIAVAFLVTWIPSRLFIFLKLRR 61
           K+ I +II+      +D + F +    G     +   +  ++ L  +  +R ++F     
Sbjct: 222 KRIIKYIISSTSSALVDYLSFCLFTFFGLPLLVATYTARLISSLFNYTLNRKYVFKNDGH 281

Query: 62  KSFLETVRYGVMYFMLSILNYAFYVKLLLTFQGLQPLLATVLSAVSSMLFVFLLYIRFMT 121
                   Y ++  +  +    F+  ++  + G+   +A  +  +   +  +     F+ 
Sbjct: 282 IGKTMFKYYILVVIVAFLSY--FFTNVVHNYIGINVYIAKAVVDMCLYVVTYNGQKYFVF 339

Query: 122 R 122
           +
Sbjct: 340 K 340


>gi|321311463|ref|YP_004203750.1| putative conserved membrane protein [Bacillus subtilis BSn5]
 gi|320017737|gb|ADV92723.1| putative conserved membrane protein [Bacillus subtilis BSn5]
          Length = 148

 Score = 82.3 bits (202), Expect = 2e-14,   Method: Composition-based stats.
 Identities = 22/121 (18%), Positives = 47/121 (38%), Gaps = 2/121 (1%)

Query: 1   MKQCIIFIINIVVVFFIDVMGFFILMKCGADPFYSRIFSIAVAFLVTWIPSRLFIFLKLR 60
           +K    F    V    ID   FF+L  C      ++I S     + +++ +R + F    
Sbjct: 19  IKTLGRFCTVGVGNTLIDFGVFFLLTACHVSYLPAQICSYTAGIINSYVWNRNWTFCVKG 78

Query: 61  RKSFLETVRYGVMYFMLSILNYAFYVKLLLTFQGLQPLLATVLSAVSSMLFVFLLYIRFM 120
           +    E VR+ ++    S + +      L    G   L++ + + +  M+  F+    ++
Sbjct: 79  KADGKEVVRFLMINIAASGITFLLLY--LFQNCGCSLLVSKLAATIGGMMMNFIGNRIWV 136

Query: 121 T 121
            
Sbjct: 137 F 137



 Score = 42.2 bits (98), Expect = 0.021,   Method: Composition-based stats.
 Identities = 9/58 (15%), Positives = 27/58 (46%)

Query: 2   KQCIIFIINIVVVFFIDVMGFFILMKCGADPFYSRIFSIAVAFLVTWIPSRLFIFLKL 59
           K+ + F++  +    I  +  ++   CG     S++ +     ++ +I +R+++F   
Sbjct: 83  KEVVRFLMINIAASGITFLLLYLFQNCGCSLLVSKLAATIGGMMMNFIGNRIWVFGDS 140


>gi|296331033|ref|ZP_06873508.1| YngA [Bacillus subtilis subsp. spizizenii ATCC 6633]
 gi|305674550|ref|YP_003866222.1| hypothetical protein BSUW23_09335 [Bacillus subtilis subsp.
           spizizenii str. W23]
 gi|296152038|gb|EFG92912.1| YngA [Bacillus subtilis subsp. spizizenii ATCC 6633]
 gi|305412794|gb|ADM37913.1| putative conserved membrane protein [Bacillus subtilis subsp.
           spizizenii str. W23]
          Length = 134

 Score = 82.3 bits (202), Expect = 2e-14,   Method: Composition-based stats.
 Identities = 23/119 (19%), Positives = 48/119 (40%), Gaps = 2/119 (1%)

Query: 4   CIIFIINIVVVFFIDVMGFFILMKCGADPFYSRIFSIAVAFLVTWIPSRLFIFLKLRRKS 63
            I F    V    ID   FF+L         +++ S       ++I +R++ F   ++  
Sbjct: 9   LIRFCTVGVGNTLIDFCVFFLLTAVYVPYLIAQVCSYTAGIANSYIWNRIWTFEVKKKAD 68

Query: 64  FLETVRYGVMYFMLSILNYAFYVKLLLTFQGLQPLLATVLSAVSSMLFVFLLYIRFMTR 122
             E +R+  +    S + +       L   GL  L++ +++ V  M+  F+    ++ R
Sbjct: 69  KQEMIRFIAVNLAASGMTFLLLFG--LQTAGLSLLISKLIATVGGMIINFIGNRLWVFR 125



 Score = 39.1 bits (90), Expect = 0.18,   Method: Composition-based stats.
 Identities = 13/62 (20%), Positives = 28/62 (45%)

Query: 2   KQCIIFIINIVVVFFIDVMGFFILMKCGADPFYSRIFSIAVAFLVTWIPSRLFIFLKLRR 61
           ++ I FI   +    +  +  F L   G     S++ +     ++ +I +RL++F    +
Sbjct: 70  QEMIRFIAVNLAASGMTFLLLFGLQTAGLSLLISKLIATVGGMIINFIGNRLWVFRDPLK 129

Query: 62  KS 63
           KS
Sbjct: 130 KS 131


>gi|170781055|ref|YP_001709387.1| putative integral membrane protein [Clavibacter michiganensis
           subsp. sepedonicus]
 gi|169155623|emb|CAQ00741.1| putative integral membrane protein [Clavibacter michiganensis
           subsp. sepedonicus]
          Length = 163

 Score = 82.3 bits (202), Expect = 2e-14,   Method: Composition-based stats.
 Identities = 24/131 (18%), Positives = 47/131 (35%), Gaps = 12/131 (9%)

Query: 3   QCIIFIINIVVVFFIDVMGFFILMK-------CGADPFYSRIFSIAVAFLVTWIPSRLFI 55
           Q   F +     F +D+  F +L           A P  +++ S  VA  V W+ +R + 
Sbjct: 2   QIAQFGLVGGAGFLVDLAVFNLLRATVLHPDAVEAGPLLAKVASTVVAIAVNWVGNRYWT 61

Query: 56  FLK-LRRKSFLETVRYGVMYFMLSILNYAFYVKLLL----TFQGLQPLLATVLSAVSSML 110
           F K    +   E + +  +  +  ++  A           T      + A V+       
Sbjct: 62  FGKQRTTRRGREALEFLAVSVLGMVIGLACLYVSHYVLGLTSPLADNVSANVIGLGLGSA 121

Query: 111 FVFLLYIRFMT 121
             F+LY +++ 
Sbjct: 122 VRFVLYRQWVY 132



 Score = 34.5 bits (78), Expect = 4.9,   Method: Composition-based stats.
 Identities = 10/72 (13%), Positives = 29/72 (40%), Gaps = 6/72 (8%)

Query: 2   KQCIIFIINIVVVFFIDVMGFFI------LMKCGADPFYSRIFSIAVAFLVTWIPSRLFI 55
           ++ + F+   V+   I +   ++      L    AD   + +  + +   V ++  R ++
Sbjct: 72  REALEFLAVSVLGMVIGLACLYVSHYVLGLTSPLADNVSANVIGLGLGSAVRFVLYRQWV 131

Query: 56  FLKLRRKSFLET 67
           +   RR +  + 
Sbjct: 132 YSPARRHAAPQA 143



 Score = 34.1 bits (77), Expect = 7.2,   Method: Composition-based stats.
 Identities = 11/63 (17%), Positives = 26/63 (41%), Gaps = 5/63 (7%)

Query: 66  ETVRYGVMYFMLSILNYAFYVKLLLTFQG-----LQPLLATVLSAVSSMLFVFLLYIRFM 120
           +  ++G++     +++ A +  L  T          PLLA V S V ++   ++    + 
Sbjct: 2   QIAQFGLVGGAGFLVDLAVFNLLRATVLHPDAVEAGPLLAKVASTVVAIAVNWVGNRYWT 61

Query: 121 TRR 123
             +
Sbjct: 62  FGK 64


>gi|323704775|ref|ZP_08116352.1| GtrA family protein [Thermoanaerobacterium xylanolyticum LX-11]
 gi|323535701|gb|EGB25475.1| GtrA family protein [Thermoanaerobacterium xylanolyticum LX-11]
          Length = 135

 Score = 81.9 bits (201), Expect = 3e-14,   Method: Composition-based stats.
 Identities = 17/121 (14%), Positives = 50/121 (41%), Gaps = 3/121 (2%)

Query: 3   QCIIFIINIVVVFFIDVMGFFILMKCGADPFYSRIFSIAVAFLVTWIPSRLFIFLKLRRK 62
           Q I F +  +V   +D   F +L   G     +++ S +   + +++ ++ + F      
Sbjct: 17  QFIKFNLVGIVNTLVDFSVFTVLTFFGMYYMAAQVISYSCGVVNSFMMNKYWTFGDKSTP 76

Query: 63  SFLETVRYGVMYFMLSILNYAFYVKLLLTFQGLQPLLATVLSAVSSMLFVFLLYIRFMTR 122
              E  ++  +  +   ++ +    +      L  L A +++ + SM+  F+    ++ +
Sbjct: 77  HGYEIFKFIAVNGVSLAVSLSILYPI---KPVLGVLSAKIIATLFSMMINFVGSKLWVFK 133

Query: 123 R 123
           +
Sbjct: 134 K 134


>gi|302560285|ref|ZP_07312627.1| integral membrane protein [Streptomyces griseoflavus Tu4000]
 gi|302477903|gb|EFL40996.1| integral membrane protein [Streptomyces griseoflavus Tu4000]
          Length = 179

 Score = 81.5 bits (200), Expect = 4e-14,   Method: Composition-based stats.
 Identities = 16/129 (12%), Positives = 43/129 (33%), Gaps = 5/129 (3%)

Query: 2   KQCIIFIINIVVVFFIDVMGFFILMKCGADPFY-SRIFSIAVAFLVTWIPSRLFIFLKLR 60
           ++   F         +++  F ++ +        + + +  VA +  ++  R F +    
Sbjct: 30  REAAKFGAVGGAGVLVNLGVFNLVRQVTDLQVVRASVIATIVAIVFNYVGFRYFTYRDRD 89

Query: 61  RK-SFLETVRYGVMYFMLSILNYAFYVKLLLTFQGLQPLLATV---LSAVSSMLFVFLLY 116
           +     E   + +   +  ++           F    PL + +   L    + LF F  Y
Sbjct: 90  KSGRTREMSLFLLYSAIGLVIENGVLYTATYGFGWDSPLQSNIFKFLGIGVATLFRFWSY 149

Query: 117 IRFMTRRVY 125
             ++ R + 
Sbjct: 150 RTWVFRAIP 158



 Score = 34.5 bits (78), Expect = 5.4,   Method: Composition-based stats.
 Identities = 12/62 (19%), Positives = 31/62 (50%), Gaps = 1/62 (1%)

Query: 61  RKSFLETVRYGVMYFMLSILNYAFYVKLLLTFQGLQPLLATVLSAVSSMLFVFLLYIRFM 120
           R+ F E  ++G +     ++N   +  +      LQ + A+V++ + +++F ++ +  F 
Sbjct: 26  RRLFREAAKFGAVGGAGVLVNLGVFNLVR-QVTDLQVVRASVIATIVAIVFNYVGFRYFT 84

Query: 121 TR 122
            R
Sbjct: 85  YR 86


>gi|254415637|ref|ZP_05029396.1| GtrA-like protein [Microcoleus chthonoplastes PCC 7420]
 gi|196177587|gb|EDX72592.1| GtrA-like protein [Microcoleus chthonoplastes PCC 7420]
          Length = 401

 Score = 81.1 bits (199), Expect = 5e-14,   Method: Composition-based stats.
 Identities = 24/129 (18%), Positives = 53/129 (41%), Gaps = 8/129 (6%)

Query: 1   MKQCIIFIINIVVVFFIDVMGFFILMK-CGADPFYSRIFSIAVAFLVTWIPSRLFIFLKL 59
           + + I F I      F+D+  F++L    G     S   S  VA    ++ + ++ F  +
Sbjct: 268 IGRFIRFSIVGFSGVFVDIAIFYLLRNKLGLGLTLSAALSAEVAMFNNFLWNDVWTFGDI 327

Query: 60  R------RKSFLETVRYGVMYFMLSILNYAFYVKLLLTFQGLQPLLATVLSAVSSMLFVF 113
                  R+ F   +++  +     ILN    V LL    G+   ++ +++  +  ++ F
Sbjct: 328 SQHQPGLRQWFERFLKFNGICLAGLILNVLL-VNLLFNVFGINEYVSKLIAIAAVTVWNF 386

Query: 114 LLYIRFMTR 122
            + ++   R
Sbjct: 387 WINLKLSWR 395


>gi|297617675|ref|YP_003702834.1| glycosyl transferase family 2 [Syntrophothermus lipocalidus DSM
           12680]
 gi|297145512|gb|ADI02269.1| glycosyl transferase family 2 [Syntrophothermus lipocalidus DSM
           12680]
          Length = 948

 Score = 81.1 bits (199), Expect = 5e-14,   Method: Composition-based stats.
 Identities = 27/131 (20%), Positives = 48/131 (36%), Gaps = 11/131 (8%)

Query: 2   KQCIIFIINIVVVFFIDVMGFFILMKC-----GADPFYSRIFSIAVAFLVTWIPSRLFIF 56
           +Q + F I  VV  FID   F IL+       G       I ++  A   ++  +R + F
Sbjct: 6   RQLVRFSITGVVNTFIDFGLFNILVFFTGARSGWQVGLINIVAVGAAAANSYFMNRRWTF 65

Query: 57  LKLRRKSFLETVRYGVMYFMLSILNYAF------YVKLLLTFQGLQPLLATVLSAVSSML 110
               + +  E VR+     +  ++N A        V  +     +      +L  V S  
Sbjct: 66  QTRGKHAPKEIVRFIPATIVGMLINSAVVSGISALVYWIPLPVYIVLNAGKLLGTVFSAT 125

Query: 111 FVFLLYIRFMT 121
           + F  Y  ++ 
Sbjct: 126 WNFAAYRLWVF 136


>gi|229819653|ref|YP_002881179.1| GtrA family protein [Beutenbergia cavernae DSM 12333]
 gi|229565566|gb|ACQ79417.1| GtrA family protein [Beutenbergia cavernae DSM 12333]
          Length = 166

 Score = 81.1 bits (199), Expect = 5e-14,   Method: Composition-based stats.
 Identities = 26/131 (19%), Positives = 48/131 (36%), Gaps = 10/131 (7%)

Query: 1   MKQCIIFIINIVVVFFIDVMGFFILMK-----CGADPFYSRIFSIAVAFLVTWIPSRLFI 55
           + + + F     V F +DV  F +L         A P  +++ S+AVA LV W+ +R + 
Sbjct: 15  LPELLRFGSVGAVAFVVDVGLFNLLRFGPGHLLEAKPLTAKVVSVAVATLVAWLGNRHWT 74

Query: 56  FLKLRR-KSFLETVRYGVMYFMLSILNYAFYVKLLLTF----QGLQPLLATVLSAVSSML 110
           F   R      E + Y ++     ++                     + A V+       
Sbjct: 75  FSDRRTASRTREFIGYSLVNVGGMVIAVGCLWFSHYVLGLQTALADNIAANVVGLGLGTA 134

Query: 111 FVFLLYIRFMT 121
           F +L Y  ++ 
Sbjct: 135 FRYLGYRSWVF 145


>gi|86739420|ref|YP_479820.1| GtrA-like protein [Frankia sp. CcI3]
 gi|86566282|gb|ABD10091.1| GtrA-like protein [Frankia sp. CcI3]
          Length = 190

 Score = 81.1 bits (199), Expect = 5e-14,   Method: Composition-based stats.
 Identities = 19/127 (14%), Positives = 43/127 (33%), Gaps = 6/127 (4%)

Query: 1   MKQCIIFIINIVVVFFIDVMGFFIL-MKCGADPFYSRIFSIAVAFLVTWIPSRLFIFLKL 59
           + +   F +     + ID +   +     G  P  ++  S  VA   ++I +R + F   
Sbjct: 35  VHEMGKFGLVGGACYAIDFLVSNLCHTLLGMGPLSAKTVSTVVAATFSYIGNRQWSFNHR 94

Query: 60  -RRKSFLETVRYGVMYFMLSILNYAFY----VKLLLTFQGLQPLLATVLSAVSSMLFVFL 114
            R     E   + ++  +  ++           L L       L   ++      +F F 
Sbjct: 95  ARTGLRREYTLFVILNTVGLLIALGCLGFARYVLDLKGVLAFNLFGNIIGTGLGTVFRFW 154

Query: 115 LYIRFMT 121
            Y +++ 
Sbjct: 155 AYKKWVF 161


>gi|300782915|ref|YP_003763206.1| GtrA-like protein [Amycolatopsis mediterranei U32]
 gi|299792429|gb|ADJ42804.1| GtrA-like protein [Amycolatopsis mediterranei U32]
          Length = 172

 Score = 80.7 bits (198), Expect = 6e-14,   Method: Composition-based stats.
 Identities = 21/135 (15%), Positives = 50/135 (37%), Gaps = 15/135 (11%)

Query: 2   KQCIIFIINIVVVFFIDVMGFFIL--MKCGADPFYSRIFSIAVAFLVTWIPSRLFIFLKL 59
           ++ + F I     F +D   ++ L        P  ++  +I VA +V++I +R + F   
Sbjct: 20  RELLKFAIVGGTTFLVDNGVWYTLKLTVLEPKPTTAKAIAIIVATIVSYILNREWSFRTR 79

Query: 60  -RRKSFLETVRYGVMYFMLSILNYA------------FYVKLLLTFQGLQPLLATVLSAV 106
             R+   E   + V+  +   +N                    L  +       +++  +
Sbjct: 80  GGRERHHEAALFFVISGIAVGVNLVPLIVSRYVLDLEVPHVTFLVQEIADFASGSIIGML 139

Query: 107 SSMLFVFLLYIRFMT 121
            +M F F  + +++ 
Sbjct: 140 LAMFFRFWGFKKWVF 154



 Score = 39.5 bits (91), Expect = 0.17,   Method: Composition-based stats.
 Identities = 8/59 (13%), Positives = 26/59 (44%)

Query: 64  FLETVRYGVMYFMLSILNYAFYVKLLLTFQGLQPLLATVLSAVSSMLFVFLLYIRFMTR 122
             E +++ ++     +++   +  L LT    +P  A  ++ + + +  ++L   +  R
Sbjct: 19  HRELLKFAIVGGTTFLVDNGVWYTLKLTVLEPKPTTAKAIAIIVATIVSYILNREWSFR 77


>gi|56551399|ref|YP_162238.1| glycosyl transferase family 2 protein [Zymomonas mobilis subsp.
           mobilis ZM4]
 gi|260752989|ref|YP_003225882.1| glycosyl transferase family 2 [Zymomonas mobilis subsp. mobilis
           NCIMB 11163]
 gi|56542973|gb|AAV89127.1| glycosyl transferase family 2 [Zymomonas mobilis subsp. mobilis
           ZM4]
 gi|258552352|gb|ACV75298.1| glycosyl transferase family 2 [Zymomonas mobilis subsp. mobilis
           NCIMB 11163]
          Length = 389

 Score = 80.7 bits (198), Expect = 6e-14,   Method: Composition-based stats.
 Identities = 16/130 (12%), Positives = 44/130 (33%), Gaps = 5/130 (3%)

Query: 3   QCIIFIINIVVVFFIDVMGFFILMKCGADPFYSRIFSIAVAFLVTWIPSRLFIFLKLRRK 62
           + ++F     +   + +   F+L         ++  +I  A L  +  +    +   + K
Sbjct: 261 RFVLFSAVGALGLCVHLGILFLLKSYHVAFLPAQTAAIGCAMLFNFFVNNELTYRDRKLK 320

Query: 63  SFL---ETVRYGVMYFMLSILNYAFYVKLLLTFQGLQPLLATVLSAVSSMLFVFLLYIRF 119
            +      + + ++  + ++ N       +         LA +  A+    F F    + 
Sbjct: 321 GWAFIPGLILFCLICSIGALANIGVAELAIHQTSSWS--LAGLAGALIGAAFNFGAASKL 378

Query: 120 MTRRVYFIKK 129
           +  RV   K+
Sbjct: 379 IWERVKKPKR 388


>gi|241761045|ref|ZP_04759134.1| glycosyl transferase family 2 [Zymomonas mobilis subsp. mobilis
           ATCC 10988]
 gi|241374664|gb|EER64125.1| glycosyl transferase family 2 [Zymomonas mobilis subsp. mobilis
           ATCC 10988]
          Length = 389

 Score = 80.7 bits (198), Expect = 6e-14,   Method: Composition-based stats.
 Identities = 16/130 (12%), Positives = 44/130 (33%), Gaps = 5/130 (3%)

Query: 3   QCIIFIINIVVVFFIDVMGFFILMKCGADPFYSRIFSIAVAFLVTWIPSRLFIFLKLRRK 62
           + ++F     +   + +   F+L         ++  +I  A L  +  +    +   + K
Sbjct: 261 RFVLFSAVGALGLCVHLGILFLLKSYHVAFLPAQTAAIGCAMLFNFFVNNELTYRDRKLK 320

Query: 63  SFL---ETVRYGVMYFMLSILNYAFYVKLLLTFQGLQPLLATVLSAVSSMLFVFLLYIRF 119
            +      + + ++  + ++ N       +         LA +  A+    F F    + 
Sbjct: 321 GWAFIPGLILFCLICSIGALANIGVAELAIHQTSSWS--LAGLAGALIGAAFNFGAASKL 378

Query: 120 MTRRVYFIKK 129
           +  RV   K+
Sbjct: 379 IWERVKKPKR 388


>gi|229489357|ref|ZP_04383220.1| GtrA family protein [Rhodococcus erythropolis SK121]
 gi|229323454|gb|EEN89212.1| GtrA family protein [Rhodococcus erythropolis SK121]
          Length = 199

 Score = 80.7 bits (198), Expect = 6e-14,   Method: Composition-based stats.
 Identities = 24/134 (17%), Positives = 50/134 (37%), Gaps = 15/134 (11%)

Query: 3   QCIIFIINIVVVFFIDVMGFFIL--MKCGADPFYSRIFSIAVAFLVTWIPSRLFIFLKL- 59
           + I F I     F ID   F+ L      + P  ++I +  VA + ++I +R + F    
Sbjct: 24  ELIKFAIVGGTTFLIDSGIFYTLKLSILESKPITAKIIAGVVAVIASYILNREWSFKNRG 83

Query: 60  RRKSFLETVRYGVMYFMLSILNYAFYVKLLLTF------------QGLQPLLATVLSAVS 107
            R+   E   + ++  +  ++++         F                 + A V+  + 
Sbjct: 84  GREPAHEAALFFIISAIGVVISFIPLYISSYVFNLRVPEVSLAAENIADFISAYVIGNLL 143

Query: 108 SMLFVFLLYIRFMT 121
            M F F  + +F+ 
Sbjct: 144 QMAFRFWAFRKFVF 157



 Score = 39.5 bits (91), Expect = 0.15,   Method: Composition-based stats.
 Identities = 7/60 (11%), Positives = 29/60 (48%)

Query: 63  SFLETVRYGVMYFMLSILNYAFYVKLLLTFQGLQPLLATVLSAVSSMLFVFLLYIRFMTR 122
              E +++ ++     +++   +  L L+    +P+ A +++ V +++  ++L   +  +
Sbjct: 21  RHSELIKFAIVGGTTFLIDSGIFYTLKLSILESKPITAKIIAGVVAVIASYILNREWSFK 80


>gi|67470874|ref|XP_651399.1| dolichol monophosphate mannose synthase [Entamoeba histolytica
           HM-1:IMSS]
 gi|56468129|gb|EAL46013.1| dolichol monophosphate mannose synthase, putative [Entamoeba
           histolytica HM-1:IMSS]
          Length = 353

 Score = 80.3 bits (197), Expect = 7e-14,   Method: Composition-based stats.
 Identities = 18/122 (14%), Positives = 47/122 (38%), Gaps = 4/122 (3%)

Query: 4   CIIFIINIVVVFFIDVMGFFILMKCGADPFYSRIFSIAVAFLVTWIPSRLFIFLK--LRR 61
            + FI+   +   ID++ F +L+  G    +++  S   A    +  + L+ F +     
Sbjct: 231 LLKFIVVGGLGTIIDILIFTLLVSIGLPGGFAQTLSFIAALCNNFFLNSLWTFPQNVDVN 290

Query: 62  KSFLETVRYGVMYFMLSILNYAFYVKLLLTFQGLQPLLATVLSAVSSML--FVFLLYIRF 119
           +   + +++GV+  +  I+    +    +      P +  +L  V   +    F+     
Sbjct: 291 EKKKQFIKFGVVSCVAFIIRSLLFKLGRMYVPDEFPYIQMLLFVVIGTVTIINFIGSKLI 350

Query: 120 MT 121
           + 
Sbjct: 351 VF 352


>gi|126179414|ref|YP_001047379.1| dolichyl-phosphate beta-D-mannosyltransferase [Methanoculleus
           marisnigri JR1]
 gi|125862208|gb|ABN57397.1| Dolichyl-phosphate beta-D-mannosyltransferase [Methanoculleus
           marisnigri JR1]
          Length = 371

 Score = 80.3 bits (197), Expect = 7e-14,   Method: Composition-based stats.
 Identities = 15/126 (11%), Positives = 47/126 (37%), Gaps = 6/126 (4%)

Query: 3   QCIIFIINIVVVFFIDVMGFFILMKC-GADPFYSRIFSIAVAFLVTWIPSRLFIFLKLRR 61
           + + F +  +   F+++   + L +  G     S   +I ++ +  ++ + ++ F  +  
Sbjct: 246 KVVRFGLVGLSGIFVNMGLLYALTEIAGLYYLVSAAIAIELSIVNNFVLNDVWTFRSIEN 305

Query: 62  ----KSFLETVRYGVMYFMLSILNYAFYVKLLLTFQGLQPLLATVLSAVSSMLFVFLLYI 117
               + F     +  +      +N A     L+   G   L+A +   + +  + + +  
Sbjct: 306 LKFERKFSRFGSFQAVSMGGLAINMAVLYL-LVDIAGAYYLVANLAGILIAFAWNYAINR 364

Query: 118 RFMTRR 123
            +   R
Sbjct: 365 HYTWVR 370



 Score = 38.3 bits (88), Expect = 0.36,   Method: Composition-based stats.
 Identities = 15/79 (18%), Positives = 31/79 (39%), Gaps = 4/79 (5%)

Query: 53  LFIFLKLRRKSFLET---VRYGVMYFMLSILNYAFYVKLLLTFQGLQPLLATVLSAVSSM 109
            F   +     + E    VR+G++      +N       L    GL  L++  ++   S+
Sbjct: 230 RFSVTRRTGSVWTEWNKVVRFGLVGLSGIFVNMGLLYA-LTEIAGLYYLVSAAIAIELSI 288

Query: 110 LFVFLLYIRFMTRRVYFIK 128
           +  F+L   +  R +  +K
Sbjct: 289 VNNFVLNDVWTFRSIENLK 307


>gi|240171615|ref|ZP_04750274.1| hypothetical protein MkanA1_20033 [Mycobacterium kansasii ATCC
           12478]
          Length = 222

 Score = 80.3 bits (197), Expect = 7e-14,   Method: Composition-based stats.
 Identities = 23/134 (17%), Positives = 48/134 (35%), Gaps = 15/134 (11%)

Query: 3   QCIIFIINIVVVFFIDVMGFFIL--MKCGADPFYSRIFSIAVAFLVTWIPSRLFIFLKL- 59
           + I F I     F ID   F+ L        P  +++ +  VA + +++ +R + F    
Sbjct: 24  ELIKFAIVGGTTFIIDSAIFYTLKLTILEPKPVTAKVIAGIVAVIASYVLNREWSFRDRG 83

Query: 60  RRKSFLETVRYGVMYFMLSILNYAFYVKLLLTFQ------------GLQPLLATVLSAVS 107
            R+   E + +     +  +L+ A         Q                + A ++  + 
Sbjct: 84  GRERHHEALLFFAFSGVGVLLSMAPLWVSSYVLQLRVPTVSLTVENIADFVSAYIIGNLL 143

Query: 108 SMLFVFLLYIRFMT 121
            M F F  + R++ 
Sbjct: 144 QMAFRFWAFRRWVF 157



 Score = 37.6 bits (86), Expect = 0.61,   Method: Composition-based stats.
 Identities = 11/61 (18%), Positives = 31/61 (50%)

Query: 62  KSFLETVRYGVMYFMLSILNYAFYVKLLLTFQGLQPLLATVLSAVSSMLFVFLLYIRFMT 121
           +   E +++ ++     I++ A +  L LT    +P+ A V++ + +++  ++L   +  
Sbjct: 20  QRHHELIKFAIVGGTTFIIDSAIFYTLKLTILEPKPVTAKVIAGIVAVIASYVLNREWSF 79

Query: 122 R 122
           R
Sbjct: 80  R 80


>gi|256787310|ref|ZP_05525741.1| integral membrane protein [Streptomyces lividans TK24]
 gi|289771205|ref|ZP_06530583.1| integral membrane protein [Streptomyces lividans TK24]
 gi|289701404|gb|EFD68833.1| integral membrane protein [Streptomyces lividans TK24]
          Length = 169

 Score = 80.3 bits (197), Expect = 8e-14,   Method: Composition-based stats.
 Identities = 17/127 (13%), Positives = 42/127 (33%), Gaps = 5/127 (3%)

Query: 1   MKQCIIFIINIVVVFFIDVMGFFILMKCGADPFY-SRIFSIAVAFLVTWIPSRLFIFLKL 59
           +++ + F         ++++ F  +          + I +  VA +  ++  R F +   
Sbjct: 9   VREVVKFGAVGGAGVLVNLLVFNFVRHTTDLQVVRASIVATVVAIVFNYLGFRYFAYRDR 68

Query: 60  RRKS-FLETVRYGVMYFMLSILNYAFYVKLLLTFQGLQPLLATV---LSAVSSMLFVFLL 115
            +     E   + +   +  ++           F    PL + +   L      LF F  
Sbjct: 69  DKSGQTREMSLFLLFSAVGLVIENGVLYTATYGFGWDSPLQSNIFKFLGIGIGTLFRFWS 128

Query: 116 YIRFMTR 122
           Y  ++ R
Sbjct: 129 YRSWVFR 135


>gi|149186740|ref|ZP_01865051.1| putative dolichol monophosphate mannose synthase [Erythrobacter sp.
           SD-21]
 gi|148829648|gb|EDL48088.1| putative dolichol monophosphate mannose synthase [Erythrobacter sp.
           SD-21]
          Length = 363

 Score = 80.3 bits (197), Expect = 9e-14,   Method: Composition-based stats.
 Identities = 22/126 (17%), Positives = 51/126 (40%), Gaps = 7/126 (5%)

Query: 3   QCIIFIINIVVVFFIDVMGFFILMKC-GADPFYSRIFSIAVAFLVTWIPSRLFIFLKLRR 61
           +  +F     +   + +   ++ +   GA   +S+  +   A    +  +    +   R 
Sbjct: 239 RFALFGTVGALGVGVHLAILYLCLWAAGAQFAWSQAIATLGAMTFNFWLNNFLTYRDRRL 298

Query: 62  KSFLETVR----YGVMYFMLSILNYAFYVKLLLTFQGLQPLLATVLSAVSSMLFVFLLYI 117
           K+  + +R    + V   + ++ N A  +  LL  +GL  LLA ++      ++ + L  
Sbjct: 299 KTTSKLLRGWASFVVACSVGALANVA--MASLLYARGLHSLLAALIGIAIGSVWNYALSS 356

Query: 118 RFMTRR 123
           RF+  R
Sbjct: 357 RFVWGR 362



 Score = 34.5 bits (78), Expect = 4.4,   Method: Composition-based stats.
 Identities = 9/58 (15%), Positives = 23/58 (39%)

Query: 1   MKQCIIFIINIVVVFFIDVMGFFILMKCGADPFYSRIFSIAVAFLVTWIPSRLFIFLK 58
           ++    F++   V    +V    +L   G     + +  IA+  +  +  S  F++ +
Sbjct: 305 LRGWASFVVACSVGALANVAMASLLYARGLHSLLAALIGIAIGSVWNYALSSRFVWGR 362


>gi|57641844|ref|YP_184322.1| fused dolichol-phosphate mannosyltransferase/GtrA-like
           domain-containing protein [Thermococcus kodakarensis
           KOD1]
 gi|57160168|dbj|BAD86098.1| dolichol-phosphate mannosyltransferase, fused to membrane-bound
           GtrA-like domain [Thermococcus kodakarensis KOD1]
          Length = 352

 Score = 80.3 bits (197), Expect = 9e-14,   Method: Composition-based stats.
 Identities = 21/123 (17%), Positives = 48/123 (39%), Gaps = 4/123 (3%)

Query: 1   MKQCIIFIINIVVVFFIDVMGFFILM-KCGADPFYSRIFSIAVAFLVTWIPSRLFIFLK- 58
           + + + F +  +    ++    +  +   G D  +S I +  +A L  +  + ++ F   
Sbjct: 231 IDRLVKFSLVGLSGVLVNEGFLWAFVEFFGWDKVFSNILATELAILNNFTWNDIWTFRDL 290

Query: 59  LRRKSFLETVRYGVMYFMLSILNYAFYVKLLLTFQGLQPLLATVLSAVSSMLFVFLLYIR 118
             +      V + V     +++ +A YV   L   G+  LLA ++  V S +  F +   
Sbjct: 291 KNKPLLKRLVSFHVAALSGALVQWAIYVI--LMAVGVHYLLANLIGIVVSFIVRFAVNRH 348

Query: 119 FMT 121
              
Sbjct: 349 VTW 351



 Score = 45.7 bits (107), Expect = 0.002,   Method: Composition-based stats.
 Identities = 11/57 (19%), Positives = 25/57 (43%)

Query: 1   MKQCIIFIINIVVVFFIDVMGFFILMKCGADPFYSRIFSIAVAFLVTWIPSRLFIFL 57
           +K+ + F +  +    +    + ILM  G     + +  I V+F+V +  +R   + 
Sbjct: 296 LKRLVSFHVAALSGALVQWAIYVILMAVGVHYLLANLIGIVVSFIVRFAVNRHVTWG 352



 Score = 38.7 bits (89), Expect = 0.30,   Method: Composition-based stats.
 Identities = 12/79 (15%), Positives = 29/79 (36%), Gaps = 3/79 (3%)

Query: 44  FLVTWIPSRLFIFLKLRRKSFLETVRYGVMYFMLSILNYAFYVKLLLTFQGLQPLLATVL 103
            +V ++  R    L          V++ ++     ++N  F     + F G   + + +L
Sbjct: 213 TIVNYL--RHIYRLMRWEGEIDRLVKFSLVGLSGVLVNEGFLWA-FVEFFGWDKVFSNIL 269

Query: 104 SAVSSMLFVFLLYIRFMTR 122
           +   ++L  F     +  R
Sbjct: 270 ATELAILNNFTWNDIWTFR 288


>gi|302524274|ref|ZP_07276616.1| transmembrane protein [Streptomyces sp. AA4]
 gi|302433169|gb|EFL04985.1| transmembrane protein [Streptomyces sp. AA4]
          Length = 199

 Score = 80.3 bits (197), Expect = 9e-14,   Method: Composition-based stats.
 Identities = 18/135 (13%), Positives = 53/135 (39%), Gaps = 15/135 (11%)

Query: 2   KQCIIFIINIVVVFFIDVMGFFIL--MKCGADPFYSRIFSIAVAFLVTWIPSRLFIFLKL 59
           ++ + F I     F +D   +++L      + P  ++  +I VA +V+++ +R + F   
Sbjct: 48  RELLKFAIVGGTTFLVDNGVWYLLKLSVLESKPTTAKAIAIIVATIVSYVLNREWSFRTR 107

Query: 60  -RRKSFLETVRYGVMYFMLSILNYAFYVKLLLTFQ------------GLQPLLATVLSAV 106
             R+   E   + ++  +  ++N    +                          +++  +
Sbjct: 108 GGRERAHEATLFFLISGVAVVVNLIPLLISRYGLHLEVPHVSRLVQEIADFASGSIIGML 167

Query: 107 SSMLFVFLLYIRFMT 121
            +M+F F  + +++ 
Sbjct: 168 LAMVFRFWGFKKWVF 182



 Score = 39.9 bits (92), Expect = 0.13,   Method: Composition-based stats.
 Identities = 7/59 (11%), Positives = 26/59 (44%)

Query: 64  FLETVRYGVMYFMLSILNYAFYVKLLLTFQGLQPLLATVLSAVSSMLFVFLLYIRFMTR 122
             E +++ ++     +++   +  L L+    +P  A  ++ + + +  ++L   +  R
Sbjct: 47  HRELLKFAIVGGTTFLVDNGVWYLLKLSVLESKPTTAKAIAIIVATIVSYVLNREWSFR 105


>gi|183981281|ref|YP_001849572.1| hypothetical protein MMAR_1259 [Mycobacterium marinum M]
 gi|183174607|gb|ACC39717.1| conserved hypothetical membrane protein [Mycobacterium marinum M]
          Length = 214

 Score = 79.9 bits (196), Expect = 1e-13,   Method: Composition-based stats.
 Identities = 23/134 (17%), Positives = 48/134 (35%), Gaps = 15/134 (11%)

Query: 3   QCIIFIINIVVVFFIDVMGFFIL--MKCGADPFYSRIFSIAVAFLVTWIPSRLFIFLKL- 59
           + I F I     F ID   F+ L        P  +++ +  VA + +++ +R + F    
Sbjct: 11  ELIKFAIVGGTTFIIDSAIFYTLKLTILEPKPVTAKVIAGIVAVIASYVLNREWSFRDRG 70

Query: 60  RRKSFLETVRYGVMYFMLSILNYAFYVKLLLTFQ------------GLQPLLATVLSAVS 107
            R+   E + +     +  +L+ A         Q                + A ++  + 
Sbjct: 71  GRERHHEALLFFAFSGVGVLLSMAPLWFSSYVLQLRVPMVSLTVENLADFVSAYIIGNLL 130

Query: 108 SMLFVFLLYIRFMT 121
            M F F  + R++ 
Sbjct: 131 QMAFRFWAFRRWVF 144



 Score = 37.2 bits (85), Expect = 0.68,   Method: Composition-based stats.
 Identities = 11/61 (18%), Positives = 31/61 (50%)

Query: 62  KSFLETVRYGVMYFMLSILNYAFYVKLLLTFQGLQPLLATVLSAVSSMLFVFLLYIRFMT 121
           +   E +++ ++     I++ A +  L LT    +P+ A V++ + +++  ++L   +  
Sbjct: 7   QRHHELIKFAIVGGTTFIIDSAIFYTLKLTILEPKPVTAKVIAGIVAVIASYVLNREWSF 66

Query: 122 R 122
           R
Sbjct: 67  R 67


>gi|118618096|ref|YP_906428.1| hypothetical protein MUL_2629 [Mycobacterium ulcerans Agy99]
 gi|118570206|gb|ABL04957.1| conserved hypothetical membrane protein [Mycobacterium ulcerans
           Agy99]
          Length = 227

 Score = 79.9 bits (196), Expect = 1e-13,   Method: Composition-based stats.
 Identities = 23/134 (17%), Positives = 48/134 (35%), Gaps = 15/134 (11%)

Query: 3   QCIIFIINIVVVFFIDVMGFFIL--MKCGADPFYSRIFSIAVAFLVTWIPSRLFIFLKL- 59
           + I F I     F ID   F+ L        P  +++ +  VA + +++ +R + F    
Sbjct: 24  ELIKFAIVGGTTFIIDSAIFYTLKLTILEPKPVTAKVIAGIVAVIASYVLNREWSFRDRG 83

Query: 60  RRKSFLETVRYGVMYFMLSILNYAFYVKLLLTFQ------------GLQPLLATVLSAVS 107
            R+   E + +     +  +L+ A         Q                + A ++  + 
Sbjct: 84  GRERHHEALLFFAFSGVGVLLSMAPLWFSSYVLQLRVPMVSLTVENLADFVSAYIIGNLL 143

Query: 108 SMLFVFLLYIRFMT 121
            M F F  + R++ 
Sbjct: 144 QMAFRFWAFRRWVF 157



 Score = 37.6 bits (86), Expect = 0.67,   Method: Composition-based stats.
 Identities = 11/61 (18%), Positives = 31/61 (50%)

Query: 62  KSFLETVRYGVMYFMLSILNYAFYVKLLLTFQGLQPLLATVLSAVSSMLFVFLLYIRFMT 121
           +   E +++ ++     I++ A +  L LT    +P+ A V++ + +++  ++L   +  
Sbjct: 20  QRHHELIKFAIVGGTTFIIDSAIFYTLKLTILEPKPVTAKVIAGIVAVIASYVLNREWSF 79

Query: 122 R 122
           R
Sbjct: 80  R 80


>gi|41409493|ref|NP_962329.1| hypothetical protein MAP3395 [Mycobacterium avium subsp.
           paratuberculosis K-10]
 gi|118464004|ref|YP_883387.1| hypothetical protein MAV_4247 [Mycobacterium avium 104]
 gi|254776681|ref|ZP_05218197.1| hypothetical protein MaviaA2_18721 [Mycobacterium avium subsp.
           avium ATCC 25291]
 gi|41398324|gb|AAS05945.1| hypothetical protein MAP_3395 [Mycobacterium avium subsp.
           paratuberculosis K-10]
 gi|118165291|gb|ABK66188.1| conserved hypothetical protein [Mycobacterium avium 104]
          Length = 221

 Score = 79.9 bits (196), Expect = 1e-13,   Method: Composition-based stats.
 Identities = 23/134 (17%), Positives = 48/134 (35%), Gaps = 15/134 (11%)

Query: 3   QCIIFIINIVVVFFIDVMGFFIL--MKCGADPFYSRIFSIAVAFLVTWIPSRLFIFLKL- 59
           + I F I     F ID   F+ L        P  +++ +  VA + +++ +R + F    
Sbjct: 24  ELIKFAIVGGTTFVIDSAIFYTLKLTILEPKPVTAKVIAGIVAVIASYVLNREWSFRNRG 83

Query: 60  RRKSFLETVRYGVMYFMLSILNYAFYVKLLLTFQG------------LQPLLATVLSAVS 107
            R+   E + +     +  +L+ A         Q                + A ++  + 
Sbjct: 84  GRERHHEALLFFAFSGVGVLLSMAPLWFSSYVLQLRQPTVSLTVENVADFISAYIIGNLL 143

Query: 108 SMLFVFLLYIRFMT 121
            M F F  + R++ 
Sbjct: 144 QMAFRFWAFRRWVF 157



 Score = 37.2 bits (85), Expect = 0.80,   Method: Composition-based stats.
 Identities = 10/60 (16%), Positives = 30/60 (50%)

Query: 63  SFLETVRYGVMYFMLSILNYAFYVKLLLTFQGLQPLLATVLSAVSSMLFVFLLYIRFMTR 122
              E +++ ++     +++ A +  L LT    +P+ A V++ + +++  ++L   +  R
Sbjct: 21  RHHELIKFAIVGGTTFVIDSAIFYTLKLTILEPKPVTAKVIAGIVAVIASYVLNREWSFR 80


>gi|294993782|ref|ZP_06799473.1| hypothetical protein Mtub2_04526 [Mycobacterium tuberculosis 210]
 gi|308232406|ref|ZP_07415943.2| conserved membrane protein [Mycobacterium tuberculosis SUMu001]
 gi|308370214|ref|ZP_07420665.2| conserved membrane protein [Mycobacterium tuberculosis SUMu002]
 gi|308371298|ref|ZP_07424472.2| conserved membrane protein [Mycobacterium tuberculosis SUMu003]
 gi|308372488|ref|ZP_07428840.2| conserved membrane protein [Mycobacterium tuberculosis SUMu004]
 gi|308374829|ref|ZP_07437539.2| conserved membrane protein [Mycobacterium tuberculosis SUMu006]
 gi|308376057|ref|ZP_07445940.2| conserved membrane protein [Mycobacterium tuberculosis SUMu007]
 gi|308377289|ref|ZP_07441753.2| conserved membrane protein [Mycobacterium tuberculosis SUMu008]
 gi|308378256|ref|ZP_07482035.2| conserved membrane protein [Mycobacterium tuberculosis SUMu009]
 gi|308380637|ref|ZP_07490605.2| conserved membrane protein [Mycobacterium tuberculosis SUMu011]
 gi|308214147|gb|EFO73546.1| conserved membrane protein [Mycobacterium tuberculosis SUMu001]
 gi|308325078|gb|EFP13929.1| conserved membrane protein [Mycobacterium tuberculosis SUMu002]
 gi|308329299|gb|EFP18150.1| conserved membrane protein [Mycobacterium tuberculosis SUMu003]
 gi|308333130|gb|EFP21981.1| conserved membrane protein [Mycobacterium tuberculosis SUMu004]
 gi|308340651|gb|EFP29502.1| conserved membrane protein [Mycobacterium tuberculosis SUMu006]
 gi|308344384|gb|EFP33235.1| conserved membrane protein [Mycobacterium tuberculosis SUMu007]
 gi|308348388|gb|EFP37239.1| conserved membrane protein [Mycobacterium tuberculosis SUMu008]
 gi|308353225|gb|EFP42076.1| conserved membrane protein [Mycobacterium tuberculosis SUMu009]
 gi|308360966|gb|EFP49817.1| conserved membrane protein [Mycobacterium tuberculosis SUMu011]
          Length = 223

 Score = 79.9 bits (196), Expect = 1e-13,   Method: Composition-based stats.
 Identities = 23/134 (17%), Positives = 48/134 (35%), Gaps = 15/134 (11%)

Query: 3   QCIIFIINIVVVFFIDVMGFFIL--MKCGADPFYSRIFSIAVAFLVTWIPSRLFIFLKL- 59
           + I F I     F ID   F+ L        P  +++ +  VA + +++ +R + F    
Sbjct: 24  ELIKFAIVGGTTFIIDTAIFYTLKLTVLEPKPVTAKVIAGIVAVIASYVLNREWSFRDRG 83

Query: 60  RRKSFLETVRYGVMYFMLSILNYAFYVKLLLTFQ------------GLQPLLATVLSAVS 107
            R+   E + +     +  +L+ A         Q                + A ++  + 
Sbjct: 84  GRERHHEALLFFAFSGVGVLLSMAPLWFSSYILQLRVPTVSLTMENIADFISAYIIGNLL 143

Query: 108 SMLFVFLLYIRFMT 121
            M F F  + R++ 
Sbjct: 144 QMAFRFWAFRRWVF 157



 Score = 37.6 bits (86), Expect = 0.67,   Method: Composition-based stats.
 Identities = 11/61 (18%), Positives = 31/61 (50%)

Query: 62  KSFLETVRYGVMYFMLSILNYAFYVKLLLTFQGLQPLLATVLSAVSSMLFVFLLYIRFMT 121
           +   E +++ ++     I++ A +  L LT    +P+ A V++ + +++  ++L   +  
Sbjct: 20  QRHHELIKFAIVGGTTFIIDTAIFYTLKLTVLEPKPVTAKVIAGIVAVIASYVLNREWSF 79

Query: 122 R 122
           R
Sbjct: 80  R 80


>gi|15610413|ref|NP_217794.1| transmembrane protein [Mycobacterium tuberculosis H37Rv]
 gi|148663140|ref|YP_001284663.1| putative transmembrane protein [Mycobacterium tuberculosis H37Ra]
 gi|148824478|ref|YP_001289233.1| transmembrane protein [Mycobacterium tuberculosis F11]
 gi|167968908|ref|ZP_02551185.1| conserved transmembrane protein [Mycobacterium tuberculosis H37Ra]
 gi|215405290|ref|ZP_03417471.1| transmembrane protein [Mycobacterium tuberculosis 02_1987]
 gi|215413155|ref|ZP_03421856.1| transmembrane protein [Mycobacterium tuberculosis 94_M4241A]
 gi|215428761|ref|ZP_03426680.1| transmembrane protein [Mycobacterium tuberculosis T92]
 gi|215432242|ref|ZP_03430161.1| transmembrane protein [Mycobacterium tuberculosis EAS054]
 gi|215447582|ref|ZP_03434334.1| transmembrane protein [Mycobacterium tuberculosis T85]
 gi|218755060|ref|ZP_03533856.1| transmembrane protein [Mycobacterium tuberculosis GM 1503]
 gi|219559337|ref|ZP_03538413.1| transmembrane protein [Mycobacterium tuberculosis T17]
 gi|253800320|ref|YP_003033321.1| hypothetical protein TBMG_03325 [Mycobacterium tuberculosis KZN
           1435]
 gi|254233887|ref|ZP_04927212.1| hypothetical protein TBCG_03216 [Mycobacterium tuberculosis C]
 gi|254365899|ref|ZP_04981944.1| conserved transmembrane protein [Mycobacterium tuberculosis str.
           Haarlem]
 gi|254552379|ref|ZP_05142826.1| hypothetical protein Mtube_18343 [Mycobacterium tuberculosis
           '98-R604 INH-RIF-EM']
 gi|260188326|ref|ZP_05765800.1| hypothetical protein MtubCP_20188 [Mycobacterium tuberculosis
           CPHL_A]
 gi|260202439|ref|ZP_05769930.1| hypothetical protein MtubT4_20703 [Mycobacterium tuberculosis T46]
 gi|260206629|ref|ZP_05774120.1| hypothetical protein MtubK8_20237 [Mycobacterium tuberculosis K85]
 gi|289444858|ref|ZP_06434602.1| transmembrane protein [Mycobacterium tuberculosis T46]
 gi|289448965|ref|ZP_06438709.1| conserved transmembrane protein [Mycobacterium tuberculosis CPHL_A]
 gi|289555554|ref|ZP_06444764.1| conserved membrane protein [Mycobacterium tuberculosis KZN 605]
 gi|289571503|ref|ZP_06451730.1| conserved membrane protein [Mycobacterium tuberculosis T17]
 gi|289575996|ref|ZP_06456223.1| transmembrane protein [Mycobacterium tuberculosis K85]
 gi|289747094|ref|ZP_06506472.1| conserved transmembrane protein [Mycobacterium tuberculosis
           02_1987]
 gi|289751971|ref|ZP_06511349.1| conserved membrane protein [Mycobacterium tuberculosis T92]
 gi|289755399|ref|ZP_06514777.1| conserved transmembrane protein [Mycobacterium tuberculosis EAS054]
 gi|289759417|ref|ZP_06518795.1| transmembrane protein [Mycobacterium tuberculosis T85]
 gi|289763464|ref|ZP_06522842.1| conserved hypothetical protein [Mycobacterium tuberculosis GM 1503]
 gi|297635931|ref|ZP_06953711.1| hypothetical protein MtubK4_17487 [Mycobacterium tuberculosis KZN
           4207]
 gi|297732928|ref|ZP_06962046.1| hypothetical protein MtubKR_17642 [Mycobacterium tuberculosis KZN
           R506]
 gi|306795039|ref|ZP_07433341.1| conserved membrane protein [Mycobacterium tuberculosis SUMu005]
 gi|306973726|ref|ZP_07486387.1| conserved membrane protein [Mycobacterium tuberculosis SUMu010]
 gi|313660260|ref|ZP_07817140.1| hypothetical protein MtubKV_17642 [Mycobacterium tuberculosis KZN
           V2475]
 gi|1877332|emb|CAB07080.1| PROBABLE CONSERVED TRANSMEMBRANE PROTEIN [Mycobacterium
           tuberculosis H37Rv]
 gi|124599416|gb|EAY58520.1| hypothetical protein TBCG_03216 [Mycobacterium tuberculosis C]
 gi|134151412|gb|EBA43457.1| conserved transmembrane protein [Mycobacterium tuberculosis str.
           Haarlem]
 gi|148507292|gb|ABQ75101.1| putative conserved transmembrane protein [Mycobacterium
           tuberculosis H37Ra]
 gi|148723005|gb|ABR07630.1| conserved transmembrane protein [Mycobacterium tuberculosis F11]
 gi|253321822|gb|ACT26425.1| transmembrane protein [Mycobacterium tuberculosis KZN 1435]
 gi|289417777|gb|EFD15017.1| transmembrane protein [Mycobacterium tuberculosis T46]
 gi|289421923|gb|EFD19124.1| conserved transmembrane protein [Mycobacterium tuberculosis CPHL_A]
 gi|289440186|gb|EFD22679.1| conserved membrane protein [Mycobacterium tuberculosis KZN 605]
 gi|289540427|gb|EFD45005.1| transmembrane protein [Mycobacterium tuberculosis K85]
 gi|289545257|gb|EFD48905.1| conserved membrane protein [Mycobacterium tuberculosis T17]
 gi|289687622|gb|EFD55110.1| conserved transmembrane protein [Mycobacterium tuberculosis
           02_1987]
 gi|289692558|gb|EFD59987.1| conserved membrane protein [Mycobacterium tuberculosis T92]
 gi|289695986|gb|EFD63415.1| conserved transmembrane protein [Mycobacterium tuberculosis EAS054]
 gi|289710970|gb|EFD74986.1| conserved hypothetical protein [Mycobacterium tuberculosis GM 1503]
 gi|289714981|gb|EFD78993.1| transmembrane protein [Mycobacterium tuberculosis T85]
 gi|308336817|gb|EFP25668.1| conserved membrane protein [Mycobacterium tuberculosis SUMu005]
 gi|308356965|gb|EFP45816.1| conserved membrane protein [Mycobacterium tuberculosis SUMu010]
 gi|323718146|gb|EGB27328.1| membrane protein [Mycobacterium tuberculosis CDC1551A]
 gi|326902495|gb|EGE49428.1| conserved membrane protein [Mycobacterium tuberculosis W-148]
 gi|328460053|gb|AEB05476.1| conserved membrane protein [Mycobacterium tuberculosis KZN 4207]
          Length = 272

 Score = 79.9 bits (196), Expect = 1e-13,   Method: Composition-based stats.
 Identities = 23/134 (17%), Positives = 48/134 (35%), Gaps = 15/134 (11%)

Query: 3   QCIIFIINIVVVFFIDVMGFFIL--MKCGADPFYSRIFSIAVAFLVTWIPSRLFIFLKL- 59
           + I F I     F ID   F+ L        P  +++ +  VA + +++ +R + F    
Sbjct: 73  ELIKFAIVGGTTFIIDTAIFYTLKLTVLEPKPVTAKVIAGIVAVIASYVLNREWSFRDRG 132

Query: 60  RRKSFLETVRYGVMYFMLSILNYAFYVKLLLTFQ------------GLQPLLATVLSAVS 107
            R+   E + +     +  +L+ A         Q                + A ++  + 
Sbjct: 133 GRERHHEALLFFAFSGVGVLLSMAPLWFSSYILQLRVPTVSLTMENIADFISAYIIGNLL 192

Query: 108 SMLFVFLLYIRFMT 121
            M F F  + R++ 
Sbjct: 193 QMAFRFWAFRRWVF 206



 Score = 39.1 bits (90), Expect = 0.23,   Method: Composition-based stats.
 Identities = 17/102 (16%), Positives = 43/102 (42%), Gaps = 5/102 (4%)

Query: 21  GFFILMKCGADPFYSRIFSIAVAFLVTWIPSRLFIFLKLRRKSFLETVRYGVMYFMLSIL 80
             +          +S + S A A +      RL   ++   +   E +++ ++     I+
Sbjct: 33  VTYHFASILCSSVHSLVVSFADATIA-----RLPGVVQPYAQRHHELIKFAIVGGTTFII 87

Query: 81  NYAFYVKLLLTFQGLQPLLATVLSAVSSMLFVFLLYIRFMTR 122
           + A +  L LT    +P+ A V++ + +++  ++L   +  R
Sbjct: 88  DTAIFYTLKLTVLEPKPVTAKVIAGIVAVIASYVLNREWSFR 129


>gi|15827311|ref|NP_301574.1| hypothetical protein ML0734 [Mycobacterium leprae TN]
 gi|221229789|ref|YP_002503205.1| hypothetical protein MLBr_00734 [Mycobacterium leprae Br4923]
 gi|466840|gb|AAA85916.1| B1308_C1_121 [Mycobacterium leprae]
 gi|13092860|emb|CAC30243.1| putative membrane protein [Mycobacterium leprae]
 gi|219932896|emb|CAR70828.1| putative membrane protein [Mycobacterium leprae Br4923]
          Length = 228

 Score = 79.9 bits (196), Expect = 1e-13,   Method: Composition-based stats.
 Identities = 24/134 (17%), Positives = 48/134 (35%), Gaps = 15/134 (11%)

Query: 3   QCIIFIINIVVVFFIDVMGFFIL--MKCGADPFYSRIFSIAVAFLVTWIPSRLFIFLKL- 59
           + I F I     F ID   F+ L        P  +++ +  VA + +++ +R + F    
Sbjct: 24  ELIKFAIVGGTTFIIDSAIFYTLKLTILEPKPVTAKVVAGIVAVIASYVLNREWSFRDRG 83

Query: 60  RRKSFLETVRYGVMYFMLSILNYAFYVKLLLTFQ------------GLQPLLATVLSAVS 107
            R+   E + +     +  +L+ A         Q                L A ++  + 
Sbjct: 84  GRERHNEALLFFAFSGIGVLLSMAPLWFSSYVLQLRAPTVSLTVENLADFLSAYIIGNLL 143

Query: 108 SMLFVFLLYIRFMT 121
            M F F  + R++ 
Sbjct: 144 QMAFRFWAFRRWVF 157



 Score = 36.8 bits (84), Expect = 1.1,   Method: Composition-based stats.
 Identities = 11/61 (18%), Positives = 32/61 (52%)

Query: 62  KSFLETVRYGVMYFMLSILNYAFYVKLLLTFQGLQPLLATVLSAVSSMLFVFLLYIRFMT 121
           + + E +++ ++     I++ A +  L LT    +P+ A V++ + +++  ++L   +  
Sbjct: 20  QRYHELIKFAIVGGTTFIIDSAIFYTLKLTILEPKPVTAKVVAGIVAVIASYVLNREWSF 79

Query: 122 R 122
           R
Sbjct: 80  R 80


>gi|226305624|ref|YP_002765584.1| hypothetical protein RER_21370 [Rhodococcus erythropolis PR4]
 gi|226184741|dbj|BAH32845.1| conserved hypothetical membrane protein [Rhodococcus erythropolis
           PR4]
          Length = 217

 Score = 79.6 bits (195), Expect = 1e-13,   Method: Composition-based stats.
 Identities = 26/134 (19%), Positives = 49/134 (36%), Gaps = 15/134 (11%)

Query: 3   QCIIFIINIVVVFFIDVMGFFIL--MKCGADPFYSRIFSIAVAFLVTWIPSRLFIFLKLR 60
           + I F I     F ID   F+ L      + P  ++I +  VA + ++I +R + F    
Sbjct: 36  ELIKFAIVGGTTFLIDSGIFYTLKLSILESKPITAKIIAGVVAVIASYILNREWSFKNRG 95

Query: 61  -RKSFLETVRYGVMYFML------------SILNYAFYVKLLLTFQGLQPLLATVLSAVS 107
            R+   E   + ++  +              + N       L T      + A V+  + 
Sbjct: 96  GREPAHEAALFFIISAIGVVISFIPLYISSYVFNLRVPEVSLATENIADFISAYVIGNLL 155

Query: 108 SMLFVFLLYIRFMT 121
            M F F  + +F+ 
Sbjct: 156 QMAFRFWAFRKFVF 169



 Score = 39.1 bits (90), Expect = 0.21,   Method: Composition-based stats.
 Identities = 7/60 (11%), Positives = 29/60 (48%)

Query: 63  SFLETVRYGVMYFMLSILNYAFYVKLLLTFQGLQPLLATVLSAVSSMLFVFLLYIRFMTR 122
              E +++ ++     +++   +  L L+    +P+ A +++ V +++  ++L   +  +
Sbjct: 33  RHSELIKFAIVGGTTFLIDSGIFYTLKLSILESKPITAKIIAGVVAVIASYILNREWSFK 92


>gi|167384074|ref|XP_001736800.1| dolichol-phosphate mannosyltransferase [Entamoeba dispar SAW760]
 gi|165900686|gb|EDR26951.1| dolichol-phosphate mannosyltransferase, putative [Entamoeba dispar
           SAW760]
          Length = 353

 Score = 79.6 bits (195), Expect = 1e-13,   Method: Composition-based stats.
 Identities = 16/122 (13%), Positives = 46/122 (37%), Gaps = 4/122 (3%)

Query: 4   CIIFIINIVVVFFIDVMGFFILMKCGADPFYSRIFSIAVAFLVTWIPSRLFIF--LKLRR 61
            + FI+   +   ID++ F + +  G    +++  S   A    +  + L+ F      +
Sbjct: 231 LLKFIVVGGLGTIIDILIFTLFISIGLPGGFAQTLSFITALCNNFFLNSLWTFPQQVDAK 290

Query: 62  KSFLETVRYGVMYFMLSILNYAFYVKLLLTFQGLQPLLATVLSAVSSML--FVFLLYIRF 119
           +   + +++G++  +  I+    +    +      P +  +L  V   +    F+     
Sbjct: 291 QKQKQFIKFGIVSGIAFIIRSLLFKFGRIYVPDKFPYIQMLLFVVIGTVTIINFIGSKLI 350

Query: 120 MT 121
           + 
Sbjct: 351 VF 352


>gi|209526708|ref|ZP_03275231.1| amine oxidase [Arthrospira maxima CS-328]
 gi|209492840|gb|EDZ93172.1| amine oxidase [Arthrospira maxima CS-328]
          Length = 621

 Score = 79.6 bits (195), Expect = 1e-13,   Method: Composition-based stats.
 Identities = 24/121 (19%), Positives = 49/121 (40%), Gaps = 1/121 (0%)

Query: 1   MKQCIIFIINIVVVFFIDVMGFFILMKCGADPFYSRIFSIAVAFLVTWIPSRLFIFLKLR 60
           ++Q   +++       +DV+ F +L + G    Y+   S  +     +  SR F+F    
Sbjct: 491 LRQFGGYLLTGGSATVVDVLVFSLLTQAGIWYVYALGISYFLGLSTNFWLSRRFVFGIYW 550

Query: 61  RKSFLETVRYGVMYFMLSILNYAFYVKLLLTFQGLQPLLATVLSAVSSMLFVFLLYIRFM 120
           R   ++   +  +    S+L     ++LL+   G  P  A ++SA    L  F  +  + 
Sbjct: 551 RNWLMQYGVFATVAL-NSLLANLGLLQLLINELGWSPTPARLVSAACVALISFTGHKLYS 609

Query: 121 T 121
            
Sbjct: 610 F 610


>gi|15842867|ref|NP_337904.1| hypothetical protein MT3377 [Mycobacterium tuberculosis CDC1551]
 gi|298526753|ref|ZP_07014162.1| conserved hypothetical protein [Mycobacterium tuberculosis
           94_M4241A]
 gi|13883198|gb|AAK47718.1| conserved hypothetical protein [Mycobacterium tuberculosis CDC1551]
 gi|298496547|gb|EFI31841.1| conserved hypothetical protein [Mycobacterium tuberculosis
           94_M4241A]
          Length = 256

 Score = 79.6 bits (195), Expect = 1e-13,   Method: Composition-based stats.
 Identities = 23/134 (17%), Positives = 48/134 (35%), Gaps = 15/134 (11%)

Query: 3   QCIIFIINIVVVFFIDVMGFFIL--MKCGADPFYSRIFSIAVAFLVTWIPSRLFIFLKL- 59
           + I F I     F ID   F+ L        P  +++ +  VA + +++ +R + F    
Sbjct: 57  ELIKFAIVGGTTFIIDTAIFYTLKLTVLEPKPVTAKVIAGIVAVIASYVLNREWSFRDRG 116

Query: 60  RRKSFLETVRYGVMYFMLSILNYAFYVKLLLTFQ------------GLQPLLATVLSAVS 107
            R+   E + +     +  +L+ A         Q                + A ++  + 
Sbjct: 117 GRERHHEALLFFAFSGVGVLLSMAPLWFSSYILQLRVPTVSLTMENIADFISAYIIGNLL 176

Query: 108 SMLFVFLLYIRFMT 121
            M F F  + R++ 
Sbjct: 177 QMAFRFWAFRRWVF 190



 Score = 38.7 bits (89), Expect = 0.25,   Method: Composition-based stats.
 Identities = 17/102 (16%), Positives = 43/102 (42%), Gaps = 5/102 (4%)

Query: 21  GFFILMKCGADPFYSRIFSIAVAFLVTWIPSRLFIFLKLRRKSFLETVRYGVMYFMLSIL 80
             +          +S + S A A +      RL   ++   +   E +++ ++     I+
Sbjct: 17  VTYHFASILCSSVHSLVVSFADATIA-----RLPGVVQPYAQRHHELIKFAIVGGTTFII 71

Query: 81  NYAFYVKLLLTFQGLQPLLATVLSAVSSMLFVFLLYIRFMTR 122
           + A +  L LT    +P+ A V++ + +++  ++L   +  R
Sbjct: 72  DTAIFYTLKLTVLEPKPVTAKVIAGIVAVIASYVLNREWSFR 113


>gi|31794457|ref|NP_856950.1| transmembrane protein [Mycobacterium bovis AF2122/97]
 gi|121639166|ref|YP_979390.1| putative transmembrane protein [Mycobacterium bovis BCG str.
           Pasteur 1173P2]
 gi|224991659|ref|YP_002646348.1| putative transmembrane protein [Mycobacterium bovis BCG str. Tokyo
           172]
 gi|31620053|emb|CAD95397.1| PROBABLE CONSERVED TRANSMEMBRANE PROTEIN [Mycobacterium bovis
           AF2122/97]
 gi|121494814|emb|CAL73295.1| Probable conserved transmembrane protein [Mycobacterium bovis BCG
           str. Pasteur 1173P2]
 gi|224774774|dbj|BAH27580.1| putative transmembrane protein [Mycobacterium bovis BCG str. Tokyo
           172]
          Length = 272

 Score = 79.6 bits (195), Expect = 1e-13,   Method: Composition-based stats.
 Identities = 23/134 (17%), Positives = 48/134 (35%), Gaps = 15/134 (11%)

Query: 3   QCIIFIINIVVVFFIDVMGFFIL--MKCGADPFYSRIFSIAVAFLVTWIPSRLFIFLKL- 59
           + I F I     F ID   F+ L        P  +++ +  VA + +++ +R + F    
Sbjct: 73  ELIKFAIVGGTTFIIDTAIFYTLKLTVLEPKPVTAKVIAGIVAVIASYVLNREWSFRDRG 132

Query: 60  RRKSFLETVRYGVMYFMLSILNYAFYVKLLLTFQ------------GLQPLLATVLSAVS 107
            R+   E + +     +  +L+ A         Q                + A ++  + 
Sbjct: 133 GRERHHEALLFFAFSGVGVLLSMAPLWFSSYILQLRVPTVSLTMENIADFISAYIIGNLL 192

Query: 108 SMLFVFLLYIRFMT 121
            M F F  + R++ 
Sbjct: 193 QMAFRFWAFRRWVF 206



 Score = 38.7 bits (89), Expect = 0.25,   Method: Composition-based stats.
 Identities = 17/102 (16%), Positives = 43/102 (42%), Gaps = 5/102 (4%)

Query: 21  GFFILMKCGADPFYSRIFSIAVAFLVTWIPSRLFIFLKLRRKSFLETVRYGVMYFMLSIL 80
             +          +S + S A A +      RL   ++   +   E +++ ++     I+
Sbjct: 33  VTYHFASILCSSVHSLVVSFADATIA-----RLPGVVQPYAQRHHELIKFAIVGGTTFII 87

Query: 81  NYAFYVKLLLTFQGLQPLLATVLSAVSSMLFVFLLYIRFMTR 122
           + A +  L LT    +P+ A V++ + +++  ++L   +  R
Sbjct: 88  DTAIFYTLKLTVLEPKPVTAKVIAGIVAVIASYVLNREWSFR 129


>gi|29830739|ref|NP_825373.1| glycosyl transferase [Streptomyces avermitilis MA-4680]
 gi|29607852|dbj|BAC71908.1| putative glycosyltransferase [Streptomyces avermitilis MA-4680]
          Length = 513

 Score = 79.6 bits (195), Expect = 1e-13,   Method: Composition-based stats.
 Identities = 12/124 (9%), Positives = 41/124 (33%), Gaps = 5/124 (4%)

Query: 2   KQCIIFIINIVVVFFIDVMGFFILMKCGADPFYSRIFSIAVAFLVTWIPSRLFIFLKLRR 61
           +Q + F +   +     ++ +            +   ++ V+ +     +R   F    R
Sbjct: 287 RQLVGFCVVGGLSTLFYLLLYSGFRSFT-GSQIANALALLVSAVANTAANRRLTFGVRGR 345

Query: 62  KSFL----ETVRYGVMYFMLSILNYAFYVKLLLTFQGLQPLLATVLSAVSSMLFVFLLYI 117
              +    + +    +   L+  + A       +      L   + + +++ +  FLL+ 
Sbjct: 346 GGAVRHQAQGLVVFGIGLALTSGSLAALNAATSSPAHATELAVLIAANLAATVLRFLLFR 405

Query: 118 RFMT 121
            ++ 
Sbjct: 406 AWVF 409


>gi|85709080|ref|ZP_01040146.1| putative dolichol monophosphate mannose synthase [Erythrobacter sp.
           NAP1]
 gi|85690614|gb|EAQ30617.1| putative dolichol monophosphate mannose synthase [Erythrobacter sp.
           NAP1]
          Length = 363

 Score = 79.6 bits (195), Expect = 1e-13,   Method: Composition-based stats.
 Identities = 21/126 (16%), Positives = 44/126 (34%), Gaps = 7/126 (5%)

Query: 3   QCIIFIINIVVVFFIDVMGFF-ILMKCGADPFYSRIFSIAVAFLVTWIPSRLFIFLKLRR 61
           +  +F     +   + +     +L         S+  ++  A    +  +    +   R 
Sbjct: 239 RFALFGTVGALGVIVHMAVLASLLFVFEEAFTVSQAAAVLTAMSFNFWLNNWLTYRDRRL 298

Query: 62  KSFLETVR----YGVMYFMLSILNYAFYVKLLLTFQGLQPLLATVLSAVSSMLFVFLLYI 117
           K + E +R    + +   +    N A     LL  QGL   LA +   +   ++ + L  
Sbjct: 299 KGWGEFLRGWAGFCLTCAVGGFANVAV--ATLLQSQGLFWALAALAGILIGSVWNYALSS 356

Query: 118 RFMTRR 123
           RF+  R
Sbjct: 357 RFVWGR 362


>gi|167044443|gb|ABZ09119.1| putative glycosyl transferase [uncultured marine crenarchaeote
           HF4000_APKG6D9]
          Length = 388

 Score = 79.6 bits (195), Expect = 1e-13,   Method: Composition-based stats.
 Identities = 12/126 (9%), Positives = 48/126 (38%), Gaps = 6/126 (4%)

Query: 1   MKQCIIFIINIVVVFFIDVMGFFILMKCG--ADPFYSRIFSIAVAFLVTWIPSRLFIFLK 58
           + +   F       F ++ +   +    G      ++ +  I  +    ++ ++ + F  
Sbjct: 258 LSKAARFYTVGASGFLVNYLISLLFTNGGLDMWYLHATVLGIFASITSNFLLNKTWTFGD 317

Query: 59  LR---RKSFLETVRYGVMYFMLSILNYAFYVKLLLTFQGLQPLLATVLSAVSSMLFVFLL 115
                +K+  +  ++ +   + +++     V  L+    +   LA +++ +++    F+L
Sbjct: 318 RDFRIKKTISQYGKFVMFSSLGALVQLG-MVYFLVDGNDVSYPLALIVAVITAAFGNFVL 376

Query: 116 YIRFMT 121
             ++  
Sbjct: 377 NKKWTF 382



 Score = 39.9 bits (92), Expect = 0.12,   Method: Composition-based stats.
 Identities = 6/60 (10%), Positives = 23/60 (38%), Gaps = 1/60 (1%)

Query: 1   MKQCIIFIINIVVVFFIDVMGFFILMKCGA-DPFYSRIFSIAVAFLVTWIPSRLFIFLKL 59
           + Q   F++   +   + +   + L+         + I ++  A    ++ ++ + F + 
Sbjct: 326 ISQYGKFVMFSSLGALVQLGMVYFLVDGNDVSYPLALIVAVITAAFGNFVLNKKWTFNEK 385



 Score = 39.5 bits (91), Expect = 0.16,   Method: Composition-based stats.
 Identities = 13/60 (21%), Positives = 23/60 (38%)

Query: 62  KSFLETVRYGVMYFMLSILNYAFYVKLLLTFQGLQPLLATVLSAVSSMLFVFLLYIRFMT 121
           K   +  R+  +     ++NY   +        +  L ATVL   +S+   FLL   +  
Sbjct: 256 KFLSKAARFYTVGASGFLVNYLISLLFTNGGLDMWYLHATVLGIFASITSNFLLNKTWTF 315


>gi|86739677|ref|YP_480077.1| glycosyl transferase family protein [Frankia sp. CcI3]
 gi|86566539|gb|ABD10348.1| glycosyl transferase, family 2 [Frankia sp. CcI3]
          Length = 488

 Score = 79.6 bits (195), Expect = 1e-13,   Method: Composition-based stats.
 Identities = 15/118 (12%), Positives = 46/118 (38%), Gaps = 1/118 (0%)

Query: 6   IFIINIVVVFFIDVMGFFILMKCGADPFYSRIFSIAVAFLVTWIPSRLFIFLKLRRKSFL 65
            F +        +++G  +L   G     + I +  +A    ++   L ++ +       
Sbjct: 312 RFALVGASGTVPNLLGTAVLHHVGLHYLVAAIVATQIAVGWNFLGCELLVWDRETGSRLR 371

Query: 66  ETVRYGVMYFMLSILNYAFYVKLLLTFQGLQPLLATVLSAVSSMLFVFLLYIRFMTRR 123
               + ++  +  ++        L+    L   ++T++S  ++++  +L+  R + RR
Sbjct: 372 RYPAFALINNLDLVIRLPLLAV-LVGRWHLGVGISTLMSLAAAVIVRYLVVDRLVYRR 428


>gi|329765228|ref|ZP_08256808.1| glycosyl transferase family protein [Candidatus Nitrosoarchaeum
           limnia SFB1]
 gi|329138134|gb|EGG42390.1| glycosyl transferase family protein [Candidatus Nitrosoarchaeum
           limnia SFB1]
          Length = 384

 Score = 79.6 bits (195), Expect = 2e-13,   Method: Composition-based stats.
 Identities = 10/126 (7%), Positives = 45/126 (35%), Gaps = 5/126 (3%)

Query: 1   MKQCIIFIINIVVVFFIDVMGFFILM-KCGADPFYSRIFSIAVAFLVTWIPSRLFIFLKL 59
           + +   F         ++ +   +          ++ I  I V+    ++ ++ + F   
Sbjct: 255 VSKAARFFSVGASGLLVNYLMSMLFTTSFNMWYLHATILGIIVSISSNFVLNKYWTFEDR 314

Query: 60  ---RRKSFLETVRYGVMYFMLSILNYAFYVKLLLTFQGLQPLLATVLSAVSSMLFVFLLY 116
               +++ ++  ++     + +++        L+    +   +A V +  ++    F+L 
Sbjct: 315 EFTPKRTIIQYGKFAGFSSIGALVQLGLVYY-LVDEISISYPIALVSAVATAAFSNFILN 373

Query: 117 IRFMTR 122
            ++  +
Sbjct: 374 KKWTFK 379



 Score = 39.9 bits (92), Expect = 0.12,   Method: Composition-based stats.
 Identities = 6/58 (10%), Positives = 23/58 (39%), Gaps = 1/58 (1%)

Query: 3   QCIIFIINIVVVFFIDVM-GFFILMKCGADPFYSRIFSIAVAFLVTWIPSRLFIFLKL 59
           Q   F     +   + +   ++++ +       + + ++A A    +I ++ + F + 
Sbjct: 324 QYGKFAGFSSIGALVQLGLVYYLVDEISISYPIALVSAVATAAFSNFILNKKWTFKEK 381


>gi|158317649|ref|YP_001510157.1| GtrA family protein [Frankia sp. EAN1pec]
 gi|158113054|gb|ABW15251.1| GtrA family protein [Frankia sp. EAN1pec]
          Length = 191

 Score = 79.2 bits (194), Expect = 2e-13,   Method: Composition-based stats.
 Identities = 22/127 (17%), Positives = 43/127 (33%), Gaps = 6/127 (4%)

Query: 1   MKQCIIFIINIVVVFFIDVMGFFIL-MKCGADPFYSRIFSIAVAFLVTWIPSRLFIFLKL 59
           + +   F +   V + ID     +     G  P  ++  S  VA   +++ +R + F   
Sbjct: 40  IHEVGKFGVVGAVCYAIDFAVSNLCHTLLGMGPLSAKTVSTVVAATCSYVGNRQWSFNHR 99

Query: 60  -RRKSFLETVRYGVMYFMLSILNYAFY----VKLLLTFQGLQPLLATVLSAVSSMLFVFL 114
            R     E   + ++  +   +  A        L L       L   VL      +F F 
Sbjct: 100 ARTGLRREYTLFVILNAVGLAIALACLGFAKYVLHLEGVLAFNLFGNVLGTGLGTVFRFW 159

Query: 115 LYIRFMT 121
            Y +++ 
Sbjct: 160 AYKKYVF 166


>gi|282863429|ref|ZP_06272488.1| GtrA family protein [Streptomyces sp. ACTE]
 gi|282561764|gb|EFB67307.1| GtrA family protein [Streptomyces sp. ACTE]
          Length = 434

 Score = 79.2 bits (194), Expect = 2e-13,   Method: Composition-based stats.
 Identities = 16/124 (12%), Positives = 46/124 (37%), Gaps = 5/124 (4%)

Query: 2   KQCIIFIINIVVVFFIDVMGFFILMKCGADPFYSRIFSIAVAFLVTWIPSRLFIFLKLRR 61
           +Q + F +   +   + +   + L + GA P  +   ++ V+ +     +R   F    R
Sbjct: 290 RQLVGFCVVGALSTLVYLA-LYSLFRLGAGPQIANGAALLVSAVANTAANRRLTFGVRGR 348

Query: 62  ----KSFLETVRYGVMYFMLSILNYAFYVKLLLTFQGLQPLLATVLSAVSSMLFVFLLYI 117
               +   + +    +   L+  + A       +      L   + + +++ +  FLL+ 
Sbjct: 349 GGSVRHQAQGLVVFAIGLALTSGSLAALDTASGSPSHGTELAVLIAANLAATVLRFLLFR 408

Query: 118 RFMT 121
            ++ 
Sbjct: 409 AWVF 412


>gi|182438269|ref|YP_001825988.1| hypothetical protein SGR_4476 [Streptomyces griseus subsp. griseus
           NBRC 13350]
 gi|326778920|ref|ZP_08238185.1| GtrA family protein [Streptomyces cf. griseus XylebKG-1]
 gi|178466785|dbj|BAG21305.1| conserved hypothetical protein [Streptomyces griseus subsp. griseus
           NBRC 13350]
 gi|326659253|gb|EGE44099.1| GtrA family protein [Streptomyces cf. griseus XylebKG-1]
          Length = 173

 Score = 79.2 bits (194), Expect = 2e-13,   Method: Composition-based stats.
 Identities = 14/126 (11%), Positives = 41/126 (32%), Gaps = 5/126 (3%)

Query: 2   KQCIIFIINIVVVFFIDVMGFFILMKCGADPFY-SRIFSIAVAFLVTWIPSRLFIFLKLR 60
           ++   F         +++  F +L          + + +  VA L  ++  R + +    
Sbjct: 16  REVAKFGAVGAFGLLVNIAVFNLLRHTTDLQVVRASVIATFVAILFNYVGFRYWTYRDRD 75

Query: 61  R-KSFLETVRYGVMYFMLSILNYAFYVKLLLTFQGLQPLLA---TVLSAVSSMLFVFLLY 116
           +     E   + +     +++           F    P+ +    ++    + LF F  Y
Sbjct: 76  KTGRTRELALFLLFSAAGAVIETGVLYLATYGFGWNTPVQSNVFKIVGIGVATLFRFWSY 135

Query: 117 IRFMTR 122
             ++ +
Sbjct: 136 RTWVFK 141


>gi|297194012|ref|ZP_06911410.1| integral membrane protein [Streptomyces pristinaespiralis ATCC
           25486]
 gi|197722838|gb|EDY66746.1| integral membrane protein [Streptomyces pristinaespiralis ATCC
           25486]
          Length = 173

 Score = 79.2 bits (194), Expect = 2e-13,   Method: Composition-based stats.
 Identities = 18/127 (14%), Positives = 41/127 (32%), Gaps = 5/127 (3%)

Query: 1   MKQCIIFIINIVVVFFIDVMGFFILMKCGADPFY-SRIFSIAVAFLVTWIPSRLFIFLKL 59
           +++   F         +++  F ++      P   + I +  VA    ++  R F +   
Sbjct: 16  IREVAKFGAVGGAGLLVNLAVFNLVRHVTEVPVVRASILATVVAIAFNYVGFRYFTYRDR 75

Query: 60  RRKSF-LETVRYGVMYFMLSILNYAFYVKLLLTFQGLQPLLA---TVLSAVSSMLFVFLL 115
            +     E   + +   +  ++           F    PL +     L    + LF F  
Sbjct: 76  DKSRRTKELTLFLLFSAVGLVIENGVLYTATYGFGWDTPLQSNVFKFLGIGVATLFRFWS 135

Query: 116 YIRFMTR 122
           Y  ++ R
Sbjct: 136 YRSWVFR 142


>gi|284050330|ref|ZP_06380540.1| hypothetical protein AplaP_02527 [Arthrospira platensis str.
           Paraca]
          Length = 621

 Score = 79.2 bits (194), Expect = 2e-13,   Method: Composition-based stats.
 Identities = 24/121 (19%), Positives = 49/121 (40%), Gaps = 1/121 (0%)

Query: 1   MKQCIIFIINIVVVFFIDVMGFFILMKCGADPFYSRIFSIAVAFLVTWIPSRLFIFLKLR 60
           ++Q   +++       +DV+ F +L + G    Y+   S  +     +  SR F+F    
Sbjct: 491 LRQFGGYLLTGGSATVVDVLVFSLLTQAGIWYVYALGISYFLGLSTNFWLSRRFVFGIYW 550

Query: 61  RKSFLETVRYGVMYFMLSILNYAFYVKLLLTFQGLQPLLATVLSAVSSMLFVFLLYIRFM 120
           R   ++   +  +    S+L     ++LL+   G  P  A ++SA    L  F  +  + 
Sbjct: 551 RNWLMQYGVFATVAL-NSLLANLGLLQLLINELGWSPTPARLVSAACVALISFTGHKLYS 609

Query: 121 T 121
            
Sbjct: 610 F 610


>gi|298489769|ref|YP_003719946.1| dolichyl-phosphate beta-d-mannosyltransferase ['Nostoc azollae'
           0708]
 gi|298231687|gb|ADI62823.1| Dolichyl-phosphate beta-D-mannosyltransferase ['Nostoc azollae'
           0708]
          Length = 413

 Score = 79.2 bits (194), Expect = 2e-13,   Method: Composition-based stats.
 Identities = 18/131 (13%), Positives = 48/131 (36%), Gaps = 10/131 (7%)

Query: 1   MKQCIIFIINIVVVFFIDVMGFFIL---MKCGADPFYSRIFSIAVAFLVTWIPSRLFIF- 56
           + + I F +      F+D+   ++L            S+I S  VA    ++ +  + F 
Sbjct: 279 VGRFIRFGVVGFSGVFVDMAVLYLLSDPSTLALPLTRSKIISGEVAIFNNFLWNDAWTFA 338

Query: 57  -----LKLRRKSFLETVRYGVMYFMLSILNYAFYVKLLLTFQGLQPLLATVLSAVSSMLF 111
                 K   ++    +++ V+     +LN      +          +A +++   + ++
Sbjct: 339 DVSMQQKGWNQTIKRFLKFNVICLAGLVLNVVVLNIVF-NLLIPNRYIANLIAIAVATIW 397

Query: 112 VFLLYIRFMTR 122
            F + ++   R
Sbjct: 398 NFWVNLKLSWR 408


>gi|291568871|dbj|BAI91143.1| hypothetical protein [Arthrospira platensis NIES-39]
          Length = 622

 Score = 79.2 bits (194), Expect = 2e-13,   Method: Composition-based stats.
 Identities = 24/121 (19%), Positives = 49/121 (40%), Gaps = 1/121 (0%)

Query: 1   MKQCIIFIINIVVVFFIDVMGFFILMKCGADPFYSRIFSIAVAFLVTWIPSRLFIFLKLR 60
           ++Q   +++       +DV+ F +L + G    Y+   S  +     +  SR F+F    
Sbjct: 492 LRQFGGYLLTGGSATVVDVLVFSLLTQAGIWYVYALGISYFLGLSTNFWLSRRFVFGIYW 551

Query: 61  RKSFLETVRYGVMYFMLSILNYAFYVKLLLTFQGLQPLLATVLSAVSSMLFVFLLYIRFM 120
           R   ++   +  +    S+L     ++LL+   G  P  A ++SA    L  F  +  + 
Sbjct: 552 RNWLMQYGVFATVAL-NSLLANLGLLQLLINELGWSPTPARLVSAACVALISFTGHKLYS 610

Query: 121 T 121
            
Sbjct: 611 F 611


>gi|148272182|ref|YP_001221743.1| hypothetical protein CMM_1002 [Clavibacter michiganensis subsp.
           michiganensis NCPPB 382]
 gi|147830112|emb|CAN01041.1| putative membrane protein [Clavibacter michiganensis subsp.
           michiganensis NCPPB 382]
          Length = 172

 Score = 79.2 bits (194), Expect = 2e-13,   Method: Composition-based stats.
 Identities = 24/131 (18%), Positives = 47/131 (35%), Gaps = 12/131 (9%)

Query: 3   QCIIFIINIVVVFFIDVMGFFILMK-------CGADPFYSRIFSIAVAFLVTWIPSRLFI 55
           Q   F +     F +D+  F +L           A P  +++ S  VA  V W+ +R + 
Sbjct: 13  QIAQFGLVGGAGFLVDLAVFNLLRATVFHPDAVEAGPLLAKVASTVVAIAVNWVGNRYWT 72

Query: 56  FLK-LRRKSFLETVRYGVMYFMLSILNYAFYVKLLL----TFQGLQPLLATVLSAVSSML 110
           F K    +   E + +  +  +  ++  A           T      + A V+       
Sbjct: 73  FGKQRTTRRGREALEFLAVSLLGMVIGLACLYVSHYVLGLTSPLADNVSANVIGLGLGSA 132

Query: 111 FVFLLYIRFMT 121
             F+LY +++ 
Sbjct: 133 VRFVLYRQWVY 143


>gi|218248620|ref|YP_002373991.1| Dolichyl-phosphate beta-D-mannosyltransferase [Cyanothece sp. PCC
           8801]
 gi|218169098|gb|ACK67835.1| Dolichyl-phosphate beta-D-mannosyltransferase [Cyanothece sp. PCC
           8801]
          Length = 397

 Score = 79.2 bits (194), Expect = 2e-13,   Method: Composition-based stats.
 Identities = 17/129 (13%), Positives = 48/129 (37%), Gaps = 10/129 (7%)

Query: 3   QCIIFIINIVVVFFIDVMGFFILM---KCGADPFYSRIFSIAVAFLVTWIPSRLFIFLK- 58
           + I F +  +    +D+   ++L      G     S+I +  +A +  +I +  + F   
Sbjct: 265 RFIQFCLVGLSGVVVDMGFLYLLSDPSTLGLPLTRSKIIAAELAIINNFIWNDFWTFGDI 324

Query: 59  -----LRRKSFLETVRYGVMYFMLSILNYAFYVKLLLTFQGLQPLLATVLSAVSSMLFVF 113
                 +R+     +++ ++   + ++     + +      L   +A +L+      F F
Sbjct: 325 ARRQPGKRQRLKRLIKFNIICL-VGLILNVLLLNVFFNVFNLNRYIANLLAIGLVTFFNF 383

Query: 114 LLYIRFMTR 122
              ++   R
Sbjct: 384 WFNLKLSWR 392


>gi|81298961|ref|YP_399169.1| dolichyl-phosphate beta-D-mannosyltransferase [Synechococcus
           elongatus PCC 7942]
 gi|81167842|gb|ABB56182.1| Dolichyl-phosphate beta-D-mannosyltransferase [Synechococcus
           elongatus PCC 7942]
          Length = 388

 Score = 78.8 bits (193), Expect = 2e-13,   Method: Composition-based stats.
 Identities = 19/127 (14%), Positives = 46/127 (36%), Gaps = 9/127 (7%)

Query: 3   QCIIFIINIVVVFFIDVMGFFILM---KCGADPFYSRIFSIAVAFLVTWIPSRLFIFLK- 58
           + + F+        +D +  ++L    + G     S+  +  VA L  ++ +  + F   
Sbjct: 261 RFLKFVGAGATGVIVDSVVLYLLHDPSRLGWPLLLSKFIAAEVAILNNFVFNEFWTFGDL 320

Query: 59  ----LRRKSFLETVRYGVMYFMLSILNYAFYVKLLLTFQGLQPLLATVLSAVSSMLFVFL 114
                RR      +++ ++  +  I      + LL+    L  L +  ++     L+ F 
Sbjct: 321 ARGSQRRYWPRRFLKFNLICSLG-IFLNLLILSLLVEGLKLHYLPSNWVAIAVVTLWNFW 379

Query: 115 LYIRFMT 121
           L  +   
Sbjct: 380 LNRKLTW 386


>gi|84495360|ref|ZP_00994479.1| putative glycosyl transferase [Janibacter sp. HTCC2649]
 gi|84384853|gb|EAQ00733.1| putative glycosyl transferase [Janibacter sp. HTCC2649]
          Length = 423

 Score = 78.8 bits (193), Expect = 2e-13,   Method: Composition-based stats.
 Identities = 19/124 (15%), Positives = 42/124 (33%), Gaps = 4/124 (3%)

Query: 2   KQCIIFIINIVVVFFIDVMGFFILMKCGADPFYSRIFSIAVAFLVTWIPSRLFIFLKLRR 61
           +Q   F++  V      +  F +L +  A    +   ++ VA +V    +R + F    R
Sbjct: 259 RQAASFVVIGVASTVFHLGLFALLRQGMASATLANAIALLVATIVNTSWNRHWTFGLRGR 318

Query: 62  KSF----LETVRYGVMYFMLSILNYAFYVKLLLTFQGLQPLLATVLSAVSSMLFVFLLYI 117
           +      L+ +   V+   L+         +           A  ++   S    F+L  
Sbjct: 319 EGAGRQQLQALVVFVLTLALTTAGLGLLHTVAPGAPTWLETTAVAITTALSTAVKFVLMR 378

Query: 118 RFMT 121
            ++ 
Sbjct: 379 TWIF 382


>gi|251800061|ref|YP_003014792.1| glycosyl transferase family 2 [Paenibacillus sp. JDR-2]
 gi|247547687|gb|ACT04706.1| glycosyl transferase family 2 [Paenibacillus sp. JDR-2]
          Length = 337

 Score = 78.4 bits (192), Expect = 3e-13,   Method: Composition-based stats.
 Identities = 20/119 (16%), Positives = 46/119 (38%), Gaps = 2/119 (1%)

Query: 4   CIIFIINIVVVFFIDVMGFFILMKCGADPFYSRIFSIAVAFLVTWIPSRLFIFLK-LRRK 62
            + F+ +      ID +  F+L         S I +  ++ +  +  +R ++F       
Sbjct: 220 FLKFVTSSGFSAVIDFVLLFLLQWMTGSLLASVIGARVISSIFNFTMNRRYVFNDGQGIS 279

Query: 63  SFLETVRYGVMYFMLSILNYAFYVKLLLTFQGLQPLLATVLSAVSSMLFVFLLYIRFMT 121
                 RY  +  ++ + NYA          G+   +A +++ V    F +L+  +F+ 
Sbjct: 280 VRKSLPRYFSLVVIILVANYALLYL-FHESIGIPLFIAKLMTEVLLFAFSYLVQRKFVY 337


>gi|167042918|gb|ABZ07633.1| putative glycosyl transferase [uncultured marine crenarchaeote
           HF4000_ANIW137N13]
          Length = 387

 Score = 78.4 bits (192), Expect = 3e-13,   Method: Composition-based stats.
 Identities = 13/122 (10%), Positives = 45/122 (36%), Gaps = 6/122 (4%)

Query: 6   IFIINIVVVFFIDVMG--FFILMKCGADPFYSRIFSIAVAFLVTWIPSRLFIFLKLR--- 60
            F         ++ +    F          ++    I V+    +I ++++ F       
Sbjct: 262 RFYTVGASGLLVNYLVSLLFADAIINFWYIHATTIGIIVSMSSNFILNKIWTFEDRNFEA 321

Query: 61  RKSFLETVRYGVMYFMLSILNYAFYVKLLLTFQGLQPLLATVLSAVSSMLFVFLLYIRFM 120
           +K+  +  ++     + +++       ++  +Q     LA +L+ +++    F+L  ++ 
Sbjct: 322 KKTLAQYGKFVGFSSLGALIQLGMVYVMVDNYQ-FAYSLALILAVITAASSNFILNKKWT 380

Query: 121 TR 122
            +
Sbjct: 381 FK 382



 Score = 40.3 bits (93), Expect = 0.10,   Method: Composition-based stats.
 Identities = 7/60 (11%), Positives = 23/60 (38%), Gaps = 1/60 (1%)

Query: 1   MKQCIIFIINIVVVFFIDVMGFFILM-KCGADPFYSRIFSIAVAFLVTWIPSRLFIFLKL 59
           + Q   F+    +   I +   ++++         + I ++  A    +I ++ + F + 
Sbjct: 325 LAQYGKFVGFSSLGALIQLGMVYVMVDNYQFAYSLALILAVITAASSNFILNKKWTFKEK 384



 Score = 38.7 bits (89), Expect = 0.26,   Method: Composition-based stats.
 Identities = 11/68 (16%), Positives = 23/68 (33%)

Query: 62  KSFLETVRYGVMYFMLSILNYAFYVKLLLTFQGLQPLLATVLSAVSSMLFVFLLYIRFMT 121
           +   +  R+  +     ++NY   +           + AT +  + SM   F+L   +  
Sbjct: 255 RFISKAGRFYTVGASGLLVNYLVSLLFADAIINFWYIHATTIGIIVSMSSNFILNKIWTF 314

Query: 122 RRVYFIKK 129
               F  K
Sbjct: 315 EDRNFEAK 322


>gi|227497924|ref|ZP_03928104.1| GtrA family protein [Actinomyces urogenitalis DSM 15434]
 gi|226832660|gb|EEH65043.1| GtrA family protein [Actinomyces urogenitalis DSM 15434]
          Length = 209

 Score = 78.4 bits (192), Expect = 3e-13,   Method: Composition-based stats.
 Identities = 21/131 (16%), Positives = 46/131 (35%), Gaps = 10/131 (7%)

Query: 1   MKQCIIFIINIVVVFFIDVMGFFILMK-----CGADPFYSRIFSIAVAFLVTWIPSRLFI 55
           +++ I F +   + F ID+  F +L           P  + + S  +A + +W+ +RL+ 
Sbjct: 26  VREFIQFGLVGALSFIIDLSLFNVLQHGPIGVLAGHPNTANVVSATIATIFSWVANRLWT 85

Query: 56  FLKLRR-KSFLETVRYGVMYFMLSILNYAFYVKLL----LTFQGLQPLLATVLSAVSSML 110
           +    +     E + +        ++             L       + A V+  V    
Sbjct: 86  YRGRTQANVAREALLFTFANVGGVLITQFCLFFSHEVLGLHSPLADNVAAYVVGFVLGTA 145

Query: 111 FVFLLYIRFMT 121
           F F+ Y   + 
Sbjct: 146 FRFVFYHYIVF 156


>gi|56420586|ref|YP_147904.1| hypothetical protein GK2051 [Geobacillus kaustophilus HTA426]
 gi|56380428|dbj|BAD76336.1| hypothetical conserved protein [Geobacillus kaustophilus HTA426]
          Length = 136

 Score = 78.4 bits (192), Expect = 3e-13,   Method: Composition-based stats.
 Identities = 17/118 (14%), Positives = 42/118 (35%), Gaps = 3/118 (2%)

Query: 4   CIIFIINIVVVFFIDVMGFFILMKCGADPFYSRIFSIAVAFLVTWIPSRLFIFLKLRRKS 63
              F +  V    +D   FF+L   G     +++ S       +++ +R + F   +R +
Sbjct: 15  IWRFAVVGVGNTMVDFAVFFLLTAAGVPTAIAQVVSYGAGVANSYVWNRRWTFQMKQRAN 74

Query: 64  FLETVRYGVMYFMLSILNYAFYVKLLLTFQGLQPLLATVLSAVSSMLFVFLLYIRFMT 121
             E +R+  +  +   ++    +            LA   + +  M   F+    ++ 
Sbjct: 75  IGELLRFLAVNGLSLGVSLVVLLAAERLGPL---WLAKGAATIMGMAVNFIGSRCWVF 129



 Score = 34.5 bits (78), Expect = 5.5,   Method: Composition-based stats.
 Identities = 8/63 (12%), Positives = 25/63 (39%), Gaps = 1/63 (1%)

Query: 1   MKQCIIFIINIVVVFFIDVMGFFILMKCGADPFYSRIFSIAVAFLVTWIPSRLFIFLKLR 60
           + + + F+    +   + ++      + G     ++  +  +   V +I SR ++F   R
Sbjct: 75  IGELLRFLAVNGLSLGVSLVVLLAAERLGPLWL-AKGAATIMGMAVNFIGSRCWVFAAPR 133

Query: 61  RKS 63
            + 
Sbjct: 134 SER 136


>gi|239917061|ref|YP_002956619.1| predicted membrane protein [Micrococcus luteus NCTC 2665]
 gi|281414477|ref|ZP_06246219.1| predicted membrane protein [Micrococcus luteus NCTC 2665]
 gi|239838268|gb|ACS30065.1| predicted membrane protein [Micrococcus luteus NCTC 2665]
          Length = 202

 Score = 78.4 bits (192), Expect = 3e-13,   Method: Composition-based stats.
 Identities = 20/128 (15%), Positives = 44/128 (34%), Gaps = 7/128 (5%)

Query: 2   KQCIIFIINIVVVFFIDVMGFFILMK--CGADPFYSRIFSIAVAFLVTWIPSRLFIFLKL 59
           ++   F       F +D + F+ +M          ++I    VA L +W+ +R + F + 
Sbjct: 18  REVAKFGTVGAAAFVVDSLVFWWMMTGPLEGSNVKAKIVGGVVATLFSWVANRYWTFREK 77

Query: 60  RRK-SFLETVRYGVMYFMLSILNYAFYVKLLLTFQGLQP----LLATVLSAVSSMLFVFL 114
           R      E V + +M  +   +                P    +   V+      +F + 
Sbjct: 78  RSSNKTRELVMFLLMNAIGLGIQAGCVFIAQYLMGVTDPGGLFIAGNVVGLFFGTVFRYF 137

Query: 115 LYIRFMTR 122
            Y  ++ +
Sbjct: 138 AYRFWVFK 145



 Score = 39.9 bits (92), Expect = 0.11,   Method: Composition-based stats.
 Identities = 7/60 (11%), Positives = 24/60 (40%)

Query: 63  SFLETVRYGVMYFMLSILNYAFYVKLLLTFQGLQPLLATVLSAVSSMLFVFLLYIRFMTR 122
            + E  ++G +     +++   +  ++        + A ++  V + LF ++    +  R
Sbjct: 16  LWREVAKFGTVGAAAFVVDSLVFWWMMTGPLEGSNVKAKIVGGVVATLFSWVANRYWTFR 75


>gi|297157928|gb|ADI07640.1| putative cell surface polysaccharide biosynthesis protein
           [Streptomyces bingchenggensis BCW-1]
          Length = 170

 Score = 78.4 bits (192), Expect = 3e-13,   Method: Composition-based stats.
 Identities = 17/125 (13%), Positives = 39/125 (31%), Gaps = 5/125 (4%)

Query: 3   QCIIFIINIVVVFFIDVMGFFILMKCGA-DPFYSRIFSIAVAFLVTWIPSRLFIFLKLRR 61
           + + F         +++  F ++          + I +  VA    ++  R F +    +
Sbjct: 20  EILKFGAVGGAGVLVNLGVFNLVSHFTELPTVRASIVATIVAIAFNYVGFRYFTYRDRDK 79

Query: 62  -KSFLETVRYGVMYFMLSILNYAFYVKLLLTFQG---LQPLLATVLSAVSSMLFVFLLYI 117
                E   + +   +  I+           F     LQ  +   +    + LF F  Y 
Sbjct: 80  QGRTKELTLFLLFSAVGLIIENGVLYTATYGFGWDSQLQNNVFKFVGIGIATLFRFWSYR 139

Query: 118 RFMTR 122
            ++ R
Sbjct: 140 TWVFR 144


>gi|254819511|ref|ZP_05224512.1| hypothetical protein MintA_06279 [Mycobacterium intracellulare ATCC
           13950]
          Length = 219

 Score = 78.0 bits (191), Expect = 4e-13,   Method: Composition-based stats.
 Identities = 23/134 (17%), Positives = 48/134 (35%), Gaps = 15/134 (11%)

Query: 3   QCIIFIINIVVVFFIDVMGFFIL--MKCGADPFYSRIFSIAVAFLVTWIPSRLFIFLKL- 59
           + I F I     F ID   F+ L        P  +++ +  VA + +++ +R + F    
Sbjct: 24  ELIKFAIVGGTTFVIDSAIFYTLKLTILEPKPVTAKVIAGIVAVIASYVLNREWSFRNRG 83

Query: 60  RRKSFLETVRYGVMYFMLSILNYAFYVKLLLTFQ------------GLQPLLATVLSAVS 107
            R+   E + +     +  +L+ A         Q                + A ++  + 
Sbjct: 84  GRERHHEALLFFAFSGVGVLLSMAPLWFSSYVLQLRVPTVSLAVENLADFISAYIIGNLL 143

Query: 108 SMLFVFLLYIRFMT 121
            M F F  + R++ 
Sbjct: 144 QMAFRFWAFRRWVF 157



 Score = 36.4 bits (83), Expect = 1.3,   Method: Composition-based stats.
 Identities = 10/60 (16%), Positives = 30/60 (50%)

Query: 63  SFLETVRYGVMYFMLSILNYAFYVKLLLTFQGLQPLLATVLSAVSSMLFVFLLYIRFMTR 122
              E +++ ++     +++ A +  L LT    +P+ A V++ + +++  ++L   +  R
Sbjct: 21  RHHELIKFAIVGGTTFVIDSAIFYTLKLTILEPKPVTAKVIAGIVAVIASYVLNREWSFR 80


>gi|229829803|ref|ZP_04455872.1| hypothetical protein GCWU000342_01901 [Shuttleworthia satelles DSM
           14600]
 gi|229791792|gb|EEP27906.1| hypothetical protein GCWU000342_01901 [Shuttleworthia satelles DSM
           14600]
          Length = 406

 Score = 78.0 bits (191), Expect = 4e-13,   Method: Composition-based stats.
 Identities = 21/128 (16%), Positives = 47/128 (36%), Gaps = 6/128 (4%)

Query: 3   QCIIFIINIVVVFFIDVMGFFILMKCGADPFYSRIFSIAVAFLVTWIPSRLFIFLKLRRK 62
           Q I F    +  F +D    + LM        + + +  ++    +  +R  +F    R 
Sbjct: 283 QIISFAGVSLASFGLDY-LLYALMTLMIPVVGANVLARLISAAFNYSLNRKLVFHHRGR- 340

Query: 63  SFLETVRYGVMYFMLSILNYAFYVKLLLTFQGLQPLLATVLSAVSSMLFVFLLYIRFMT- 121
                 RY +   ++   +        LT  GL  L A +++  +  +  +L+   F+  
Sbjct: 341 LGRSLSRYALTAVLVLCADTCLVYG--LTALGLGALTAKLIAEPTIFILSYLVQKNFVFV 398

Query: 122 -RRVYFIK 128
            + V ++ 
Sbjct: 399 RKEVPYVA 406


>gi|239942787|ref|ZP_04694724.1| putative glycosyl transferase [Streptomyces roseosporus NRRL 15998]
 gi|239989246|ref|ZP_04709910.1| putative glycosyl transferase [Streptomyces roseosporus NRRL 11379]
          Length = 458

 Score = 78.0 bits (191), Expect = 4e-13,   Method: Composition-based stats.
 Identities = 17/124 (13%), Positives = 44/124 (35%), Gaps = 5/124 (4%)

Query: 2   KQCIIFIINIVVVFFIDVMGFFILMKCGADPFYSRIFSIAVAFLVTWIPSRLFIFLKLRR 61
           +Q I F +  V+     +   + L + G  P  +   ++ V+ +     +R   F    R
Sbjct: 318 RQLIGFCVVGVLSTLFYLA-LYSLFRLGVGPQVANGGALLVSAVANTAANRRLTFGVRGR 376

Query: 62  KSFL----ETVRYGVMYFMLSILNYAFYVKLLLTFQGLQPLLATVLSAVSSMLFVFLLYI 117
              +    + +    +   L+  + A       +      L   + + +++ +  FLL  
Sbjct: 377 SGAVRHQAQGLVVFAIGLALTSGSLAALGAASGSPSHGTELAVLITANLAATVLRFLLLR 436

Query: 118 RFMT 121
            ++ 
Sbjct: 437 AWVF 440


>gi|242399798|ref|YP_002995223.1| Dolichol-phosphate mannosyltransferase, fused to membrane-bound
           GtrA- like domain [Thermococcus sibiricus MM 739]
 gi|242266192|gb|ACS90874.1| Dolichol-phosphate mannosyltransferase, fused to membrane-bound
           GtrA- like domain [Thermococcus sibiricus MM 739]
          Length = 351

 Score = 78.0 bits (191), Expect = 4e-13,   Method: Composition-based stats.
 Identities = 18/123 (14%), Positives = 50/123 (40%), Gaps = 4/123 (3%)

Query: 1   MKQCIIFIINIVVVFFIDVMGFFILM-KCGADPFYSRIFSIAVAFLVTWIPSRLFIFLK- 58
           + + + F +  +    ++    +  +   G D   + + +  ++ L  ++ + ++ F   
Sbjct: 230 IDRLVKFSVVGLSGVLVNEGTLWGFVEFLGWDKRLAVLPATELSVLNNFVWNDIWTFKDL 289

Query: 59  LRRKSFLETVRYGVMYFMLSILNYAFYVKLLLTFQGLQPLLATVLSAVSSMLFVFLLYIR 118
            R+  +L  + +       +++ +A Y+ LL    GL  L+A ++    S +  FL    
Sbjct: 290 KRKALYLRLLNFHFAALTGALVQWAIYLVLLHV--GLHYLVANLIGIGFSFIVRFLFNRN 347

Query: 119 FMT 121
              
Sbjct: 348 ITW 350



 Score = 39.9 bits (92), Expect = 0.12,   Method: Composition-based stats.
 Identities = 7/55 (12%), Positives = 22/55 (40%)

Query: 3   QCIIFIINIVVVFFIDVMGFFILMKCGADPFYSRIFSIAVAFLVTWIPSRLFIFL 57
           + + F    +    +    + +L+  G     + +  I  +F+V ++ +R   + 
Sbjct: 297 RLLNFHFAALTGALVQWAIYLVLLHVGLHYLVANLIGIGFSFIVRFLFNRNITWG 351



 Score = 36.4 bits (83), Expect = 1.1,   Method: Composition-based stats.
 Identities = 11/82 (13%), Positives = 28/82 (34%), Gaps = 3/82 (3%)

Query: 45  LVTWIPSRLFIFLKLRRKSFLETVRYGVMYFMLSILNYAFYVKLLLTFQGLQPLLATVLS 104
           +  ++  +    L          V++ V+     ++N        + F G    LA + +
Sbjct: 213 IFNYL--KHLYRLMRWEGEIDRLVKFSVVGLSGVLVNEGTL-WGFVEFLGWDKRLAVLPA 269

Query: 105 AVSSMLFVFLLYIRFMTRRVYF 126
              S+L  F+    +  + +  
Sbjct: 270 TELSVLNNFVWNDIWTFKDLKR 291


>gi|58038615|ref|YP_190579.1| dolichol-phosphate mannosyltransferase [Gluconobacter oxydans 621H]
 gi|58001029|gb|AAW59923.1| Dolichol-phosphate mannosyltransferase [Gluconobacter oxydans 621H]
          Length = 368

 Score = 78.0 bits (191), Expect = 4e-13,   Method: Composition-based stats.
 Identities = 18/123 (14%), Positives = 49/123 (39%), Gaps = 3/123 (2%)

Query: 3   QCIIFIINIVVVFFIDVMGFFILMKCGADPFYSRIFSIAVAFLVTWIPSRLFIFLKLRRK 62
           + + F +  ++   ++V    +   CG    ++++   AVA L  ++ +  F +   R K
Sbjct: 246 RFMAFALVGLIGVAVNVAVLNLAGACGLGFSWAQLAGTAVAILTNFMLNNRFTYHDRRLK 305

Query: 63  S---FLETVRYGVMYFMLSILNYAFYVKLLLTFQGLQPLLATVLSAVSSMLFVFLLYIRF 119
               +   V +  +  + +I N      +L +        ++   AV  +++ + +    
Sbjct: 306 GVKLWRGLVIFIAVCSLGAIANIGIARMMLDSAGHGHWDRSSAAGAVVGVVWNYAVSSTL 365

Query: 120 MTR 122
           + R
Sbjct: 366 VWR 368


>gi|209884631|ref|YP_002288488.1| dolichyl-phosphate beta-D-mannosyltransferase [Oligotropha
           carboxidovorans OM5]
 gi|209872827|gb|ACI92623.1| dolichyl-phosphate beta-D-mannosyltransferase [Oligotropha
           carboxidovorans OM5]
          Length = 378

 Score = 78.0 bits (191), Expect = 4e-13,   Method: Composition-based stats.
 Identities = 9/124 (7%), Positives = 41/124 (33%), Gaps = 5/124 (4%)

Query: 3   QCIIFIINIVVVFFIDVMGFFILMKCGADPFYSRIFSIAVAFLVTWIPSRLFIFLK---L 59
           + ++F     +   + +   ++ +   A    ++  +   A    ++ +    +      
Sbjct: 256 RFLMFAFVGGIGLLVHLATLYLALAMNAPFAVAQGIAAFTAMTGNFLLNNRLTYRDQRLR 315

Query: 60  RRKSFLETVRYGVMYFMLSILNYAFYVKLLLTFQGLQPLLATVLSAVSSMLFVFLLYIRF 119
             K     + + ++  +  + N      +          LA +  A+  +++ + +    
Sbjct: 316 GAKLIRGLIAFYIVCSVGLLANVGVAFSVYDQNAVW--WLAGIAGALMGVVWNYGISSLL 373

Query: 120 MTRR 123
           + R+
Sbjct: 374 VWRK 377


>gi|56751364|ref|YP_172065.1| alphaalpha-trehalose-phosphate synthase [Synechococcus elongatus
           PCC 6301]
 gi|56686323|dbj|BAD79545.1| alphaalpha-trehalose-phosphate synthase [Synechococcus elongatus
           PCC 6301]
          Length = 327

 Score = 78.0 bits (191), Expect = 4e-13,   Method: Composition-based stats.
 Identities = 19/127 (14%), Positives = 46/127 (36%), Gaps = 9/127 (7%)

Query: 3   QCIIFIINIVVVFFIDVMGFFILM---KCGADPFYSRIFSIAVAFLVTWIPSRLFIFLK- 58
           + + F+        +D +  ++L    + G     S+  +  VA L  ++ +  + F   
Sbjct: 200 RFLKFVGAGATGVIVDSVVLYLLHDPSRLGWPLLLSKFIAAEVAILNNFVFNEFWTFGDL 259

Query: 59  ----LRRKSFLETVRYGVMYFMLSILNYAFYVKLLLTFQGLQPLLATVLSAVSSMLFVFL 114
                RR      +++ ++  +  I      + LL+    L  L +  ++     L+ F 
Sbjct: 260 ARGSQRRYWPRRFLKFNLICSLG-IFLNLLILSLLVEGLKLHYLPSNWVAIAVVTLWNFW 318

Query: 115 LYIRFMT 121
           L  +   
Sbjct: 319 LNRKLTW 325


>gi|17231618|ref|NP_488166.1| dolichol-phosphate mannosyltransferase [Nostoc sp. PCC 7120]
 gi|17133261|dbj|BAB75825.1| dolichol-phosphate mannosyltransferase [Nostoc sp. PCC 7120]
          Length = 414

 Score = 78.0 bits (191), Expect = 4e-13,   Method: Composition-based stats.
 Identities = 14/131 (10%), Positives = 47/131 (35%), Gaps = 10/131 (7%)

Query: 1   MKQCIIFIINIVVVFFIDVMGFFIL---MKCGADPFYSRIFSIAVAFLVTWIPSRLFIFL 57
           + + + F +  +   F+D++  ++L            S+I +  +A    ++ +  + F 
Sbjct: 280 IDRFLRFALVGLSGVFVDMVLLYLLSDPSTLALPLTRSKIIAGEIAIFNNFLWNDAWTFA 339

Query: 58  K------LRRKSFLETVRYGVMYFMLSILNYAFYVKLLLTFQGLQPLLATVLSAVSSMLF 111
                     +      ++ V+     +LN      +          +A +++   + ++
Sbjct: 340 DVTMKQQEWHQRLKRFAKFNVICLAGLVLNVLVLNLVFNFLIP-NRYVANLVAIAVATIW 398

Query: 112 VFLLYIRFMTR 122
            F + ++   R
Sbjct: 399 NFWVNLKLSWR 409


>gi|310639844|ref|YP_003944602.1| gtra-like protein [Paenibacillus polymyxa SC2]
 gi|309244794|gb|ADO54361.1| GtrA-like protein [Paenibacillus polymyxa SC2]
          Length = 136

 Score = 78.0 bits (191), Expect = 4e-13,   Method: Composition-based stats.
 Identities = 20/120 (16%), Positives = 49/120 (40%), Gaps = 3/120 (2%)

Query: 4   CIIFIINIVVVFFIDVMGFFILMKCGADPFYSRIFSIAVAFLVTWIPSRLFIFLKLR--R 61
            I F I  +V   +D + F +L   G     ++I S +     ++I +  + F K +   
Sbjct: 7   MIRFGIVGLVNTGVDYIIFMLLAWTGVPVVVAQIISYSCGTANSYILNSKWTFSKQQANN 66

Query: 62  KSFLETVRYGVMYFMLSILNYAFYVKLLLTFQGLQPLLATVLSAVSSMLFVFLLYIRFMT 121
            S  + +++ V+  ++  +        L T   L   L  +++  + M+  ++    ++ 
Sbjct: 67  TSKGQLLKFIVINLIVLGITSLLLQV-LHTETKLPLALGKLIATAAGMIINYIGSRYWVF 125


>gi|291446256|ref|ZP_06585646.1| glycosyl transferase [Streptomyces roseosporus NRRL 15998]
 gi|291349203|gb|EFE76107.1| glycosyl transferase [Streptomyces roseosporus NRRL 15998]
          Length = 468

 Score = 77.6 bits (190), Expect = 5e-13,   Method: Composition-based stats.
 Identities = 17/124 (13%), Positives = 44/124 (35%), Gaps = 5/124 (4%)

Query: 2   KQCIIFIINIVVVFFIDVMGFFILMKCGADPFYSRIFSIAVAFLVTWIPSRLFIFLKLRR 61
           +Q I F +  V+     +   + L + G  P  +   ++ V+ +     +R   F    R
Sbjct: 328 RQLIGFCVVGVLSTLFYLA-LYSLFRLGVGPQVANGGALLVSAVANTAANRRLTFGVRGR 386

Query: 62  KSFL----ETVRYGVMYFMLSILNYAFYVKLLLTFQGLQPLLATVLSAVSSMLFVFLLYI 117
              +    + +    +   L+  + A       +      L   + + +++ +  FLL  
Sbjct: 387 SGAVRHQAQGLVVFAIGLALTSGSLAALGAASGSPSHGTELAVLITANLAATVLRFLLLR 446

Query: 118 RFMT 121
            ++ 
Sbjct: 447 AWVF 450


>gi|308176556|ref|YP_003915962.1| GtrA-like protein [Arthrobacter arilaitensis Re117]
 gi|307744019|emb|CBT74991.1| GtrA-like protein [Arthrobacter arilaitensis Re117]
          Length = 189

 Score = 77.6 bits (190), Expect = 5e-13,   Method: Composition-based stats.
 Identities = 22/129 (17%), Positives = 48/129 (37%), Gaps = 7/129 (5%)

Query: 2   KQCIIFIINIVVVFFIDVMGFFILMK--CGADPFYSRIFSIAVAFLVTWIPSRLFIFLKL 59
           ++   F +   + F ID   +  L+          ++I +  VA + +W+ +R + F   
Sbjct: 18  REVAKFGVVGGIAFIIDSGIYVWLLHGPMSDSQVKAKIIAGIVATMFSWVANRYWTFRHR 77

Query: 60  RR-KSFLETVRYGVMYFMLSILNYAFYVKLLLTFQGLQP----LLATVLSAVSSMLFVFL 114
           R+     E V + +M  +   +  A             P    +  +V+  V   +F F 
Sbjct: 78  RQANVLRELVMFIIMNAIGLGIAAACVWVTKYWLGLTDPTSVFIAGSVVGLVLGTIFRFF 137

Query: 115 LYIRFMTRR 123
            Y  ++  +
Sbjct: 138 AYRFWVFGK 146



 Score = 39.9 bits (92), Expect = 0.12,   Method: Composition-based stats.
 Identities = 11/60 (18%), Positives = 28/60 (46%)

Query: 63  SFLETVRYGVMYFMLSILNYAFYVKLLLTFQGLQPLLATVLSAVSSMLFVFLLYIRFMTR 122
            + E  ++GV+  +  I++   YV LL        + A +++ + + +F ++    +  R
Sbjct: 16  LWREVAKFGVVGGIAFIIDSGIYVWLLHGPMSDSQVKAKIIAGIVATMFSWVANRYWTFR 75


>gi|289641476|ref|ZP_06473639.1| GtrA family protein [Frankia symbiont of Datisca glomerata]
 gi|289508686|gb|EFD29622.1| GtrA family protein [Frankia symbiont of Datisca glomerata]
          Length = 169

 Score = 77.6 bits (190), Expect = 5e-13,   Method: Composition-based stats.
 Identities = 21/125 (16%), Positives = 41/125 (32%), Gaps = 6/125 (4%)

Query: 3   QCIIFIINIVVVFFIDVMGFFILMK-CGADPFYSRIFSIAVAFLVTWIPSRLFIFLKL-R 60
           +   F +     + +DV+   +     G     ++  S  VA    +I +R + F    R
Sbjct: 16  EMAKFGVVGGFCYLVDVLVSNLCHGVLGIGWLSAKTVSTIVAATCAYIGNRHWSFTHRAR 75

Query: 61  RKSFLETVRYGVMYFMLSILNYAFY----VKLLLTFQGLQPLLATVLSAVSSMLFVFLLY 116
                E   + ++  +   +  A        L L       L   V+      +F F  Y
Sbjct: 76  TGLRREYTLFVILNAIGLGIALACLGIARYVLDLNSVLAFNLAGNVVGTGLGTIFRFWAY 135

Query: 117 IRFMT 121
            R++ 
Sbjct: 136 KRWVF 140


>gi|167045255|gb|ABZ09914.1| putative glycosyl transferase [uncultured marine crenarchaeote
           HF4000_APKG9M20]
 gi|167045343|gb|ABZ10000.1| putative glycosyl transferase [uncultured marine crenarchaeote
           HF4000_APKG10D8]
          Length = 387

 Score = 77.6 bits (190), Expect = 5e-13,   Method: Composition-based stats.
 Identities = 16/122 (13%), Positives = 50/122 (40%), Gaps = 6/122 (4%)

Query: 6   IFIINIVVVFFIDVMG--FFILMKCGADPFYSRIFSIAVAFLVTWIPSRLFIFLKLR--- 60
            F    +    ++ +    F          ++ I  I V+    +I ++++ F       
Sbjct: 262 RFFTVGLSGLLVNYLVSLLFADAVMNFWYIHATIIGIIVSMSSNFILNKIWTFEDRNFEA 321

Query: 61  RKSFLETVRYGVMYFMLSILNYAFYVKLLLTFQGLQPLLATVLSAVSSMLFVFLLYIRFM 120
           +K+ ++  ++     + +++       L+  +Q + P LA +L+ +++    F+L  ++ 
Sbjct: 322 KKTLIQYGKFVGFSSLGALIQLGMVYVLVDNYQFVYP-LALMLAVITAASSNFILNKKWT 380

Query: 121 TR 122
            +
Sbjct: 381 FK 382



 Score = 41.0 bits (95), Expect = 0.052,   Method: Composition-based stats.
 Identities = 11/68 (16%), Positives = 24/68 (35%)

Query: 62  KSFLETVRYGVMYFMLSILNYAFYVKLLLTFQGLQPLLATVLSAVSSMLFVFLLYIRFMT 121
           +   +  R+  +     ++NY   +           + AT++  + SM   F+L   +  
Sbjct: 255 RFISKAGRFFTVGLSGLLVNYLVSLLFADAVMNFWYIHATIIGIIVSMSSNFILNKIWTF 314

Query: 122 RRVYFIKK 129
               F  K
Sbjct: 315 EDRNFEAK 322



 Score = 38.0 bits (87), Expect = 0.42,   Method: Composition-based stats.
 Identities = 7/58 (12%), Positives = 22/58 (37%), Gaps = 1/58 (1%)

Query: 3   QCIIFIINIVVVFFIDVMGFFILM-KCGADPFYSRIFSIAVAFLVTWIPSRLFIFLKL 59
           Q   F+    +   I +   ++L+         + + ++  A    +I ++ + F + 
Sbjct: 327 QYGKFVGFSSLGALIQLGMVYVLVDNYQFVYPLALMLAVITAASSNFILNKKWTFKEK 384


>gi|111221043|ref|YP_711837.1| putative dolichol-phosphate mannosyltransferase [Frankia alni
           ACN14a]
 gi|111148575|emb|CAJ60248.1| putative dolichol-phosphate mannosyltransferase [Frankia alni
           ACN14a]
          Length = 482

 Score = 77.6 bits (190), Expect = 5e-13,   Method: Composition-based stats.
 Identities = 18/118 (15%), Positives = 44/118 (37%), Gaps = 1/118 (0%)

Query: 6   IFIINIVVVFFIDVMGFFILMKCGADPFYSRIFSIAVAFLVTWIPSRLFIFLKLRRKSFL 65
            F +        +++G   L   G     + I +  VA    ++   L ++ +       
Sbjct: 315 RFALVGASGTVPNLVGTAALHHLGLHYLAAAILATQVAIAWNFVGCELLVWDRQAGSRLR 374

Query: 66  ETVRYGVMYFMLSILNYAFYVKLLLTFQGLQPLLATVLSAVSSMLFVFLLYIRFMTRR 123
               + ++  +  ++        L+   G     AT+LS  ++++  +L+  R + RR
Sbjct: 375 RYPAFAIINNLDLVVRLPLLAL-LVGRWGFGVGTATLLSLAAAVIIRYLVVERLVYRR 431


>gi|297562814|ref|YP_003681788.1| GtrA family protein [Nocardiopsis dassonvillei subsp. dassonvillei
           DSM 43111]
 gi|296847262|gb|ADH69282.1| GtrA family protein [Nocardiopsis dassonvillei subsp. dassonvillei
           DSM 43111]
          Length = 169

 Score = 77.6 bits (190), Expect = 5e-13,   Method: Composition-based stats.
 Identities = 21/127 (16%), Positives = 43/127 (33%), Gaps = 6/127 (4%)

Query: 1   MKQCIIFIINIVVVFFIDVMGFFILMKC-GADPFYSRIFSIAVAFLVTWIPSRLFIFLKL 59
           +++   F     V + + +    +L    GA P   ++     +  V ++ +R + F   
Sbjct: 15  VREVGKFGSVGAVAYVVQLGTTNLLWSAAGAGPLTGQVIGTLCSIAVAFVGNRFWTFGDR 74

Query: 60  -RRKSFLETVRYGVMYFMLSILNYAFY----VKLLLTFQGLQPLLATVLSAVSSMLFVFL 114
            R     ET  + +M  +  +L  A        L         +   V+      LF F 
Sbjct: 75  ARTGYGRETALFLLMNGVGMLLQLACLGFSVYVLGFDGPLASNIAGNVVGVGLGTLFRFF 134

Query: 115 LYIRFMT 121
            Y  ++ 
Sbjct: 135 SYRTWVF 141


>gi|308067141|ref|YP_003868746.1| membrane protein [Paenibacillus polymyxa E681]
 gi|305856420|gb|ADM68208.1| Predicted membrane protein [Paenibacillus polymyxa E681]
          Length = 140

 Score = 77.6 bits (190), Expect = 5e-13,   Method: Composition-based stats.
 Identities = 19/120 (15%), Positives = 47/120 (39%), Gaps = 3/120 (2%)

Query: 4   CIIFIINIVVVFFIDVMGFFILMKCGADPFYSRIFSIAVAFLVTWIPSRLFIFLK--LRR 61
            I F I  +V   +D + F +L   G     ++I S +     ++I +  + F K     
Sbjct: 11  MIRFGIVGLVNTGVDYILFILLAWVGVPVIVAQIISYSCGTANSYILNSKWTFNKQLSND 70

Query: 62  KSFLETVRYGVMYFMLSILNYAFYVKLLLTFQGLQPLLATVLSAVSSMLFVFLLYIRFMT 121
            +  +  ++ V+  ++  +        L T   L   L  +++  + M+  ++    ++ 
Sbjct: 71  TNKRQLPKFIVINLIVLGITSLLLQV-LHTGTELPLALGKLIATAAGMIINYIGSRYWVF 129


>gi|302865356|ref|YP_003833993.1| GtrA family protein [Micromonospora aurantiaca ATCC 27029]
 gi|315501900|ref|YP_004080787.1| gtra family protein [Micromonospora sp. L5]
 gi|302568215|gb|ADL44417.1| GtrA family protein [Micromonospora aurantiaca ATCC 27029]
 gi|315408519|gb|ADU06636.1| GtrA family protein [Micromonospora sp. L5]
          Length = 178

 Score = 77.6 bits (190), Expect = 5e-13,   Method: Composition-based stats.
 Identities = 20/133 (15%), Positives = 41/133 (30%), Gaps = 12/133 (9%)

Query: 1   MKQCIIFIINIVVVFFIDVMGFFILMKCG-ADPFYSRIFSIAVAFLVTWIPSRLFIFLKL 59
           + +   F     + F +D + F  L       P  ++  S  +A  V ++ +R + +   
Sbjct: 27  IHELSKFATVGGLAFVVDFILFNYLSSGRDMAPLAAKTISTVIAATVAFLGNRFWTWRHR 86

Query: 60  RRK-SFLETVRYGVMYFMLSILNYAFYVKLLLTF----------QGLQPLLATVLSAVSS 108
           +R     E   +     +   +  A                        + + V+     
Sbjct: 87  QRSNPAREYALFFFFNAVGLGIAVACLAISHYGLGAIWPAVFQTPLADNIASFVVGTGLG 146

Query: 109 MLFVFLLYIRFMT 121
            LF F  Y RF+ 
Sbjct: 147 TLFRFWSYRRFVF 159


>gi|161527574|ref|YP_001581400.1| glycosyl transferase family protein [Nitrosopumilus maritimus SCM1]
 gi|160338875|gb|ABX11962.1| glycosyl transferase family 2 [Nitrosopumilus maritimus SCM1]
          Length = 386

 Score = 77.6 bits (190), Expect = 5e-13,   Method: Composition-based stats.
 Identities = 14/127 (11%), Positives = 47/127 (37%), Gaps = 6/127 (4%)

Query: 1   MKQCIIFIINIVVVFFIDVMGFFILMKCG--ADPFYSRIFSIAVAFLVTWIPSRLFIFLK 58
           + +   F       F ++ +   +           ++ +  I  +    +I ++ + F  
Sbjct: 256 LYKAARFYTVGASGFVVNYLISLLFAGGISDMWYLHANVIGIIASISTNFILNKAWTFGD 315

Query: 59  LR---RKSFLETVRYGVMYFMLSILNYAFYVKLLLTFQGLQPLLATVLSAVSSMLFVFLL 115
                +K+  +  ++ +   + +++     V  L+    +   LA +L+  ++    F+L
Sbjct: 316 RDFRIKKTMSQYGKFALFSSLGALVQLG-MVYFLVDSAEISYPLALILAVATAAFGNFVL 374

Query: 116 YIRFMTR 122
             +F  +
Sbjct: 375 NKKFTFK 381



 Score = 40.3 bits (93), Expect = 0.084,   Method: Composition-based stats.
 Identities = 9/60 (15%), Positives = 24/60 (40%), Gaps = 1/60 (1%)

Query: 1   MKQCIIFIINIVVVFFIDVM-GFFILMKCGADPFYSRIFSIAVAFLVTWIPSRLFIFLKL 59
           M Q   F +   +   + +   +F++         + I ++A A    ++ ++ F F + 
Sbjct: 324 MSQYGKFALFSSLGALVQLGMVYFLVDSAEISYPLALILAVATAAFGNFVLNKKFTFKEK 383



 Score = 38.3 bits (88), Expect = 0.37,   Method: Composition-based stats.
 Identities = 10/60 (16%), Positives = 23/60 (38%)

Query: 62  KSFLETVRYGVMYFMLSILNYAFYVKLLLTFQGLQPLLATVLSAVSSMLFVFLLYIRFMT 121
           K   +  R+  +     ++NY   +        +  L A V+  ++S+   F+L   +  
Sbjct: 254 KFLYKAARFYTVGASGFVVNYLISLLFAGGISDMWYLHANVIGIIASISTNFILNKAWTF 313


>gi|75907001|ref|YP_321297.1| glycosyl transferase family protein [Anabaena variabilis ATCC
           29413]
 gi|75700726|gb|ABA20402.1| Glycosyl transferase, family 2 [Anabaena variabilis ATCC 29413]
          Length = 414

 Score = 77.6 bits (190), Expect = 5e-13,   Method: Composition-based stats.
 Identities = 14/131 (10%), Positives = 47/131 (35%), Gaps = 10/131 (7%)

Query: 1   MKQCIIFIINIVVVFFIDVMGFFIL---MKCGADPFYSRIFSIAVAFLVTWIPSRLFIFL 57
           + + + F +  +   F+D++  ++L            S+I +  +A    ++ +  + F 
Sbjct: 280 IDRFLRFALVGLSGVFVDMVLLYLLSDPSTLALPLTRSKIIAGEIAIFNNFLWNDAWTFA 339

Query: 58  K------LRRKSFLETVRYGVMYFMLSILNYAFYVKLLLTFQGLQPLLATVLSAVSSMLF 111
                     +      ++ V+     +LN      +          +A +++   + ++
Sbjct: 340 DVTMKQQEWHQRLKRFAKFNVICLAGLVLNVLVLNLVFNFLIP-NRYVANLVAIAVATIW 398

Query: 112 VFLLYIRFMTR 122
            F + ++   R
Sbjct: 399 NFWVNLKLSWR 409


>gi|251794123|ref|YP_003008854.1| GtrA family protein [Paenibacillus sp. JDR-2]
 gi|247541749|gb|ACS98767.1| GtrA family protein [Paenibacillus sp. JDR-2]
          Length = 148

 Score = 77.6 bits (190), Expect = 5e-13,   Method: Composition-based stats.
 Identities = 20/129 (15%), Positives = 57/129 (44%), Gaps = 7/129 (5%)

Query: 1   MKQCIIFIINIVVVFFIDVMGFFILMKCGADPFYSRIFSIAVAFLVTWIPSRLFIFLKLR 60
           +KQ ++F +  ++   +D + + IL+  G     +++ S +   + +++ + L  F    
Sbjct: 20  LKQFVVFNMVGLLNTLVDFVVYGILVWAGLYVLPAQVISYSAGMVNSYVLNSLITFKGAS 79

Query: 61  RKS------FLETVRYGVMYFMLSILNYAFYVKLLLTFQGLQPLLATVLSAVSSMLFVFL 114
           ++           VR+ ++   +  ++    +  L    GL PL A +L+   +++  F 
Sbjct: 80  KREGEYKADRGRAVRFILLNAAVLGVSM-LLLYELTEAAGLGPLTAKLLATGVTVVLNFA 138

Query: 115 LYIRFMTRR 123
               ++ ++
Sbjct: 139 GSKWWVFKQ 147


>gi|289770393|ref|ZP_06529771.1| glycosyl transferase [Streptomyces lividans TK24]
 gi|289700592|gb|EFD68021.1| glycosyl transferase [Streptomyces lividans TK24]
          Length = 449

 Score = 77.6 bits (190), Expect = 6e-13,   Method: Composition-based stats.
 Identities = 13/124 (10%), Positives = 41/124 (33%), Gaps = 5/124 (4%)

Query: 2   KQCIIFIINIVVVFFIDVMGFFILMKCGADPFYSRIFSIAVAFLVTWIPSRLFIFLKLRR 61
           +Q + F +   +     ++ +       A    +   ++ V+ +     +R   F    R
Sbjct: 287 RQLVGFCVVGALSTLFYLLLYSGFRHF-AGSQLANALALLVSAVANTAANRRLTFGVRGR 345

Query: 62  KSFL----ETVRYGVMYFMLSILNYAFYVKLLLTFQGLQPLLATVLSAVSSMLFVFLLYI 117
              +    + +    +   L+  + A              L   + + +++ +  FLL+ 
Sbjct: 346 GGAVRHQAQGLVVFGIGLALTSGSLAALSAATAHPDHSTELAVLIAANLAATVLRFLLFR 405

Query: 118 RFMT 121
            ++ 
Sbjct: 406 AWVF 409


>gi|52079690|ref|YP_078481.1| membrane protein YngA [Bacillus licheniformis ATCC 14580]
 gi|52785052|ref|YP_090881.1| YngA [Bacillus licheniformis ATCC 14580]
 gi|52002901|gb|AAU22843.1| conserved membrane protein YngA [Bacillus licheniformis ATCC 14580]
 gi|52347554|gb|AAU40188.1| YngA [Bacillus licheniformis ATCC 14580]
          Length = 131

 Score = 77.2 bits (189), Expect = 6e-13,   Method: Composition-based stats.
 Identities = 18/119 (15%), Positives = 44/119 (36%), Gaps = 2/119 (1%)

Query: 4   CIIFIINIVVVFFIDVMGFFILMKCGADPFYSRIFSIAVAFLVTWIPSRLFIFLKLRRKS 63
            + F         +D + FF+L         +++FS +     ++I +R + F    +  
Sbjct: 9   LVRFGTVGAGNTLVDFVVFFLLTSLHVPYLAAQLFSYSAGVANSYIWNRTWTFQVKEKAH 68

Query: 64  FLETVRYGVMYFMLSILNYAFYVKLLLTFQGLQPLLATVLSAVSSMLFVFLLYIRFMTR 122
             E VR+ ++    +   +           GL   ++ + + V+ M   F     ++ +
Sbjct: 69  GAEIVRFIMINLAAAGATFVLLYI--FQKAGLSLFISKMSATVAGMAINFTGNKLWVFQ 125



 Score = 35.3 bits (80), Expect = 2.7,   Method: Composition-based stats.
 Identities = 10/61 (16%), Positives = 26/61 (42%)

Query: 3   QCIIFIINIVVVFFIDVMGFFILMKCGADPFYSRIFSIAVAFLVTWIPSRLFIFLKLRRK 62
           + + FI+  +       +  +I  K G   F S++ +      + +  ++L++F +    
Sbjct: 71  EIVRFIMINLAAAGATFVLLYIFQKAGLSLFISKMSATVAGMAINFTGNKLWVFQEPGTD 130

Query: 63  S 63
           S
Sbjct: 131 S 131


>gi|325962626|ref|YP_004240532.1| membrane protein [Arthrobacter phenanthrenivorans Sphe3]
 gi|323468713|gb|ADX72398.1| putative membrane protein [Arthrobacter phenanthrenivorans Sphe3]
          Length = 188

 Score = 77.2 bits (189), Expect = 6e-13,   Method: Composition-based stats.
 Identities = 21/126 (16%), Positives = 44/126 (34%), Gaps = 6/126 (4%)

Query: 2   KQCIIFIINIVVVFFIDVMGFFILMK--CGADPFYSRIFSIAVAFLVTWIPSRLFIFLKL 59
           ++   F     V F ID    + LM          +R    ++A + +WI +RL+ F   
Sbjct: 18  REVAKFGAVGGVAFVIDNGLTYYLMHGPMTDSEAKARFVGASLATVFSWIANRLWTFRHR 77

Query: 60  RR-KSFLETVRYGVMYFMLSILNYAFYVKLLLTFQGLQ---PLLATVLSAVSSMLFVFLL 115
           R+     E + + ++  +   ++  F                  A V+  + + +  F  
Sbjct: 78  RQANVLREFLMFVLINGIGIGISTGFTALAKYGMGVTDKNLLFSAGVVGILVATVVRFFA 137

Query: 116 YIRFMT 121
           Y   + 
Sbjct: 138 YRFLVF 143



 Score = 39.5 bits (91), Expect = 0.15,   Method: Composition-based stats.
 Identities = 7/59 (11%), Positives = 22/59 (37%)

Query: 64  FLETVRYGVMYFMLSILNYAFYVKLLLTFQGLQPLLATVLSAVSSMLFVFLLYIRFMTR 122
           + E  ++G +  +  +++      L+          A  + A  + +F ++    +  R
Sbjct: 17  WREVAKFGAVGGVAFVIDNGLTYYLMHGPMTDSEAKARFVGASLATVFSWIANRLWTFR 75


>gi|326382021|ref|ZP_08203714.1| GtrA family protein [Gordonia neofelifaecis NRRL B-59395]
 gi|326199447|gb|EGD56628.1| GtrA family protein [Gordonia neofelifaecis NRRL B-59395]
          Length = 179

 Score = 77.2 bits (189), Expect = 7e-13,   Method: Composition-based stats.
 Identities = 25/133 (18%), Positives = 51/133 (38%), Gaps = 14/133 (10%)

Query: 3   QCIIFIINIVVVFFIDVMGFFILMK--CGADPFYSRIFSIAVAFLVTWIPSRLFIFLKL- 59
           + I F I     F +D+  ++ L+     A P  +RI S  VA +++++ +R + F    
Sbjct: 17  ELIKFAIVGGTTFVVDMAVYYALVFSVLEAKPVIARIISGVVAVILSYVLNREWAFKNRG 76

Query: 60  RRKSFLETVRYGVMYFMLSILNYAFYVKLL-----------LTFQGLQPLLATVLSAVSS 108
            R+   E + +  +  +  +L  A                 +    +  +L  ++  +  
Sbjct: 77  GREKHHEAMLFFGISGIGVLLAAAPLWLGNNVFNMRENIQGVELAIVDFILGFIIGNLLG 136

Query: 109 MLFVFLLYIRFMT 121
           M F F    RF  
Sbjct: 137 MGFRFWALRRFAF 149



 Score = 39.5 bits (91), Expect = 0.15,   Method: Composition-based stats.
 Identities = 9/59 (15%), Positives = 31/59 (52%)

Query: 64  FLETVRYGVMYFMLSILNYAFYVKLLLTFQGLQPLLATVLSAVSSMLFVFLLYIRFMTR 122
             E +++ ++     +++ A Y  L+ +    +P++A ++S V +++  ++L   +  +
Sbjct: 15  HSELIKFAIVGGTTFVVDMAVYYALVFSVLEAKPVIARIISGVVAVILSYVLNREWAFK 73


>gi|297529791|ref|YP_003671066.1| GtrA family protein [Geobacillus sp. C56-T3]
 gi|297253043|gb|ADI26489.1| GtrA family protein [Geobacillus sp. C56-T3]
          Length = 141

 Score = 77.2 bits (189), Expect = 7e-13,   Method: Composition-based stats.
 Identities = 22/118 (18%), Positives = 47/118 (39%), Gaps = 3/118 (2%)

Query: 4   CIIFIINIVVVFFIDVMGFFILMKCGADPFYSRIFSIAVAFLVTWIPSRLFIFLKLRRKS 63
              F I  V    +D   FF+L   GA    +++ S       ++I +RL+ F   R+ +
Sbjct: 15  VWRFAIVGVSNTAVDFAVFFLLTAAGAPAAAAQVVSYGAGMANSYIWNRLWTFQVKRKAN 74

Query: 64  FLETVRYGVMYFMLSILNYAFYVKLLLTFQGLQPLLATVLSAVSSMLFVFLLYIRFMT 121
             E +R+ V+  +   ++    +            LA + + ++ M   F+    ++ 
Sbjct: 75  IGELLRFLVVNGLSLGVSLGVLLATERLTPL---WLAKMAATIAGMAVNFIGSRYWVF 129



 Score = 34.9 bits (79), Expect = 4.3,   Method: Composition-based stats.
 Identities = 6/59 (10%), Positives = 24/59 (40%), Gaps = 1/59 (1%)

Query: 1   MKQCIIFIINIVVVFFIDVMGFFILMKCGADPFYSRIFSIAVAFLVTWIPSRLFIFLKL 59
           + + + F++   +   + +       +       +++ +      V +I SR ++F++ 
Sbjct: 75  IGELLRFLVVNGLSLGVSLGVLLATERLTPLWL-AKMAATIAGMAVNFIGSRYWVFVEK 132


>gi|21222425|ref|NP_628204.1| glycosyl transferase [Streptomyces coelicolor A3(2)]
 gi|13122186|emb|CAC32362.1| putative glycosyl transferase [Streptomyces coelicolor A3(2)]
          Length = 449

 Score = 77.2 bits (189), Expect = 7e-13,   Method: Composition-based stats.
 Identities = 13/124 (10%), Positives = 41/124 (33%), Gaps = 5/124 (4%)

Query: 2   KQCIIFIINIVVVFFIDVMGFFILMKCGADPFYSRIFSIAVAFLVTWIPSRLFIFLKLRR 61
           +Q + F +   +     ++ +       A    +   ++ V+ +     +R   F    R
Sbjct: 287 RQLVGFCVVGALSTLFYLLLYSGFRHF-AGSQLANALALLVSAVANTAANRRLTFGVRGR 345

Query: 62  KSFL----ETVRYGVMYFMLSILNYAFYVKLLLTFQGLQPLLATVLSAVSSMLFVFLLYI 117
              +    + +    +   L+  + A              L   + + +++ +  FLL+ 
Sbjct: 346 GGAVRHQAQGLVVFGIGLALTSGSLAALSAATAHPDHSTELAVLIAANLAATVLRFLLFR 405

Query: 118 RFMT 121
            ++ 
Sbjct: 406 AWVF 409


>gi|326772113|ref|ZP_08231398.1| integral membrane protein [Actinomyces viscosus C505]
 gi|326638246|gb|EGE39147.1| integral membrane protein [Actinomyces viscosus C505]
          Length = 187

 Score = 77.2 bits (189), Expect = 7e-13,   Method: Composition-based stats.
 Identities = 19/131 (14%), Positives = 45/131 (34%), Gaps = 10/131 (7%)

Query: 1   MKQCIIFIINIVVVFFIDVMGFFILMK-----CGADPFYSRIFSIAVAFLVTWIPSRLFI 55
           +K+ + F +     + IDV  F +L           P  +++ + + A + +WI +R + 
Sbjct: 20  VKEFMQFGMVGAAAYVIDVGLFNLLQHGPTGVLSGHPNSAQLMASSTATVFSWIANRYWT 79

Query: 56  FLKL-RRKSFLETVRYGVMYFMLSILNYAFYVKLLL----TFQGLQPLLATVLSAVSSML 110
           +    ++    E   + +       +     +        T      + A V+       
Sbjct: 80  YRGRTQKNVAREATLFVLANLGGIAITQFCLLFTHHVLGLTSPLADNVAAYVVGFGLGTA 139

Query: 111 FVFLLYIRFMT 121
           F F+ Y   + 
Sbjct: 140 FRFVFYHYIVF 150



 Score = 35.6 bits (81), Expect = 2.4,   Method: Composition-based stats.
 Identities = 8/61 (13%), Positives = 28/61 (45%), Gaps = 3/61 (4%)

Query: 65  LETVRYGVMYFMLSILNYAFYVKLLLTFQGL---QPLLATVLSAVSSMLFVFLLYIRFMT 121
            E +++G++     +++   +  L     G+    P  A ++++ ++ +F ++    +  
Sbjct: 21  KEFMQFGMVGAAAYVIDVGLFNLLQHGPTGVLSGHPNSAQLMASSTATVFSWIANRYWTY 80

Query: 122 R 122
           R
Sbjct: 81  R 81


>gi|315650130|ref|ZP_07903206.1| dolichyl-phosphate beta-D-mannosyltransferase [Eubacterium
           saburreum DSM 3986]
 gi|315487622|gb|EFU77929.1| dolichyl-phosphate beta-D-mannosyltransferase [Eubacterium
           saburreum DSM 3986]
          Length = 353

 Score = 77.2 bits (189), Expect = 7e-13,   Method: Composition-based stats.
 Identities = 18/124 (14%), Positives = 53/124 (42%), Gaps = 3/124 (2%)

Query: 3   QCIIFIINIVVVFFIDVMGFFILMKCGADPFYSRIFSIAVAFLVTWIPSRLFIFLKLRRK 62
           Q I F  + ++ F +D + + I +    +  +S  F+  ++    +  ++ F+F +  + 
Sbjct: 221 QIIKFCGSSMLSFIVDFLVYSIGLLISGNILFSNAFARIISLHFNFFINKRFVFEEGEKS 280

Query: 63  SFL--ETVRYGVMYFMLSILNYAFYVKLLLTFQGLQPLLATVLSAVSSMLFVFLLYIRFM 120
                E ++Y  +   + ++N       ++    +   +A +L+ V      +L+  + +
Sbjct: 281 RLRGKEYLKYLGLAAFIFVMNTLILR-GIVETFRINAYIAKILTEVILFTLSYLVQKKLV 339

Query: 121 TRRV 124
             +V
Sbjct: 340 FSKV 343


>gi|297200793|ref|ZP_06918190.1| glycosyl transferase [Streptomyces sviceus ATCC 29083]
 gi|297147732|gb|EDY56398.2| glycosyl transferase [Streptomyces sviceus ATCC 29083]
          Length = 481

 Score = 76.9 bits (188), Expect = 8e-13,   Method: Composition-based stats.
 Identities = 10/124 (8%), Positives = 39/124 (31%), Gaps = 5/124 (4%)

Query: 2   KQCIIFIINIVVVFFIDVMGFFILMKCGADPFYSRIFSIAVAFLVTWIPSRLFIFLKLRR 61
           +Q + F +   +     ++ +    + G     +   ++ V+ +     +R   F    R
Sbjct: 287 RQLVGFCVVGGLSTLFYLVLYSAFRQFG-GSQTANALALLVSAVANTAANRRLTFGVRGR 345

Query: 62  KSFL----ETVRYGVMYFMLSILNYAFYVKLLLTFQGLQPLLATVLSAVSSMLFVFLLYI 117
              +    + +    +   L+  + A              L   + + +++ +   +   
Sbjct: 346 GGAVRHQAQGLVVFGIGLALTSGSLAALNAASSDPAHSTELAVLIAANLAATVLRLVDSR 405

Query: 118 RFMT 121
            ++ 
Sbjct: 406 AWVF 409


>gi|258654805|ref|YP_003203961.1| GtrA family protein [Nakamurella multipartita DSM 44233]
 gi|258558030|gb|ACV80972.1| GtrA family protein [Nakamurella multipartita DSM 44233]
          Length = 435

 Score = 76.9 bits (188), Expect = 8e-13,   Method: Composition-based stats.
 Identities = 19/126 (15%), Positives = 43/126 (34%), Gaps = 5/126 (3%)

Query: 2   KQCIIFIINIVVVFFIDVMGFFILMKCGADPFYSRIFSIAVAFLVTWIPSRLFIFLKLRR 61
           KQ + F    V       +  F L + G D   +   ++A+  +     +R   F    R
Sbjct: 293 KQIVRFAAIGVASTLA-YLVLFFLFRLGVDAQAANFLALAITAVANTAANRRITFGIQGR 351

Query: 62  KSFL----ETVRYGVMYFMLSILNYAFYVKLLLTFQGLQPLLATVLSAVSSMLFVFLLYI 117
              +    +     ++   ++  + A    +         +   VL+ + +    F+L  
Sbjct: 352 TGAVRHQFQGFGVFLLGLGITSGSLALLTAITAQPSVPVEIAVLVLANLVATAVRFVLLR 411

Query: 118 RFMTRR 123
            ++ RR
Sbjct: 412 SWVFRR 417


>gi|302553697|ref|ZP_07306039.1| integral membrane protein [Streptomyces viridochromogenes DSM
           40736]
 gi|302471315|gb|EFL34408.1| integral membrane protein [Streptomyces viridochromogenes DSM
           40736]
          Length = 181

 Score = 76.9 bits (188), Expect = 8e-13,   Method: Composition-based stats.
 Identities = 14/126 (11%), Positives = 37/126 (29%), Gaps = 5/126 (3%)

Query: 2   KQCIIFIINIVVVFFIDVMGFFILMK-CGADPFYSRIFSIAVAFLVTWIPSRLFIFLKLR 60
           ++   F    ++ + +D+  F  L    G DP  ++  S   A  V +  + L  +    
Sbjct: 46  RELAGFAAVGLLAYAVDLTLFTCLRGPAGLDPLTAKTLSFVAACSVAYAGNALGTYRSAP 105

Query: 61  RKSFLETVRYGVMYFMLSILNYAFYVKLLLTFQG----LQPLLATVLSAVSSMLFVFLLY 116
            +       +  +    + +                     +   V+    + +  F   
Sbjct: 106 ARGLRPYAVFFAVNLAGAAVQLLCLAVSHYGLGLTSQRADTVSGAVVGMALATVLRFWGT 165

Query: 117 IRFMTR 122
             ++ R
Sbjct: 166 RTWVFR 171


>gi|319646513|ref|ZP_08000742.1| YngA protein [Bacillus sp. BT1B_CT2]
 gi|317391101|gb|EFV71899.1| YngA protein [Bacillus sp. BT1B_CT2]
          Length = 131

 Score = 76.9 bits (188), Expect = 8e-13,   Method: Composition-based stats.
 Identities = 18/119 (15%), Positives = 44/119 (36%), Gaps = 2/119 (1%)

Query: 4   CIIFIINIVVVFFIDVMGFFILMKCGADPFYSRIFSIAVAFLVTWIPSRLFIFLKLRRKS 63
            + F         +D + FF+L         +++FS +     ++I +R + F    +  
Sbjct: 9   LVRFGTVGAGNTLVDFVVFFLLTSLHVPYLAAQLFSYSAGVANSYIWNRTWTFQVKEKAH 68

Query: 64  FLETVRYGVMYFMLSILNYAFYVKLLLTFQGLQPLLATVLSAVSSMLFVFLLYIRFMTR 122
             E VR+ ++    +   +           GL   ++ + + V+ M   F     ++ +
Sbjct: 69  GAEIVRFIMINLAAAGATFVLLYI--FQKAGLSLFISKMSATVAGMAINFTGNKLWVFQ 125



 Score = 35.3 bits (80), Expect = 3.1,   Method: Composition-based stats.
 Identities = 9/58 (15%), Positives = 25/58 (43%)

Query: 3   QCIIFIINIVVVFFIDVMGFFILMKCGADPFYSRIFSIAVAFLVTWIPSRLFIFLKLR 60
           + + FI+  +       +  +I  K G   F S++ +      + +  ++L++F +  
Sbjct: 71  EIVRFIMINLAAAGATFVLLYIFQKAGLSLFISKMSATVAGMAINFTGNKLWVFQEPG 128


>gi|27380750|ref|NP_772279.1| dolichol monophosphate mannose synthase [Bradyrhizobium japonicum
           USDA 110]
 gi|27353915|dbj|BAC50904.1| bll5639 [Bradyrhizobium japonicum USDA 110]
          Length = 377

 Score = 76.9 bits (188), Expect = 8e-13,   Method: Composition-based stats.
 Identities = 16/125 (12%), Positives = 44/125 (35%), Gaps = 6/125 (4%)

Query: 3   QCIIFIINIVVVFFIDVMGFFI-LMKCGADPFYSRIFSIAVAFLVTWIPSRLFIFLKLRR 61
           + I+F +   +   + +   FI L    A    ++     VA    ++ +    +   R 
Sbjct: 254 RFILFAMVGGIGLVVHLATLFIGLHVFKAPFAEAQAAGAVVAMTSNFVLNNFLTYRDQRL 313

Query: 62  KS---FLETVRYGVMYFMLSILNYAFYVKLLLTFQGLQPLLATVLSAVSSMLFVFLLYIR 118
           K        + + ++  +  + N      +          LA +  A+  +++ + +   
Sbjct: 314 KGFALLRGLIAFYIVCSVGLLANVGVAFSVYDQEPIW--WLAGLAGALMGVVWNYAMSGL 371

Query: 119 FMTRR 123
           F+ R+
Sbjct: 372 FVWRK 376



 Score = 34.1 bits (77), Expect = 5.8,   Method: Composition-based stats.
 Identities = 10/59 (16%), Positives = 22/59 (37%)

Query: 1   MKQCIIFIINIVVVFFIDVMGFFILMKCGADPFYSRIFSIAVAFLVTWIPSRLFIFLKL 59
           ++  I F I   V    +V   F +       + + +    +  +  +  S LF++ K 
Sbjct: 319 LRGLIAFYIVCSVGLLANVGVAFSVYDQEPIWWLAGLAGALMGVVWNYAMSGLFVWRKK 377


>gi|134102922|ref|YP_001108583.1| hypothetical protein SACE_6489 [Saccharopolyspora erythraea NRRL
           2338]
 gi|291007992|ref|ZP_06565965.1| hypothetical protein SeryN2_26016 [Saccharopolyspora erythraea NRRL
           2338]
 gi|133915545|emb|CAM05658.1| hypothetical protein SACE_6489 [Saccharopolyspora erythraea NRRL
           2338]
          Length = 176

 Score = 76.9 bits (188), Expect = 8e-13,   Method: Composition-based stats.
 Identities = 21/135 (15%), Positives = 49/135 (36%), Gaps = 15/135 (11%)

Query: 2   KQCIIFIINIVVVFFIDVMGFFIL--MKCGADPFYSRIFSIAVAFLVTWIPSRLFIFLKL 59
           ++ + F +   V FFID   F++L        P  +++ ++ VA +V+++ +R + F   
Sbjct: 23  RELLKFGLVGGVTFFIDTAVFYLLKLTVLDPKPVTAKVVAVLVATIVSYVLNREWSFRTR 82

Query: 60  -RRKSFLETVRYGVMYFMLSILNYAFYVKLLLTFQ------------GLQPLLATVLSAV 106
             R+   E   Y  +  +   L  A                              ++  +
Sbjct: 83  GGRERHHEATLYFAVSGIGVALYAAPLWISRYVLHLQTPFTTRFVEEIADFTAGQIVGLL 142

Query: 107 SSMLFVFLLYIRFMT 121
             M F +  + +++ 
Sbjct: 143 VGMAFRWWAFRKWVF 157



 Score = 39.5 bits (91), Expect = 0.16,   Method: Composition-based stats.
 Identities = 11/60 (18%), Positives = 30/60 (50%)

Query: 63  SFLETVRYGVMYFMLSILNYAFYVKLLLTFQGLQPLLATVLSAVSSMLFVFLLYIRFMTR 122
              E +++G++  +   ++ A +  L LT    +P+ A V++ + + +  ++L   +  R
Sbjct: 21  RHRELLKFGLVGGVTFFIDTAVFYLLKLTVLDPKPVTAKVVAVLVATIVSYVLNREWSFR 80


>gi|330465767|ref|YP_004403510.1| GtrA family protein [Verrucosispora maris AB-18-032]
 gi|328808738|gb|AEB42910.1| GtrA family protein [Verrucosispora maris AB-18-032]
          Length = 175

 Score = 76.9 bits (188), Expect = 9e-13,   Method: Composition-based stats.
 Identities = 21/133 (15%), Positives = 44/133 (33%), Gaps = 12/133 (9%)

Query: 1   MKQCIIFIINIVVVFFIDVMGFFILMK-CGADPFYSRIFSIAVAFLVTWIPSRLFIFLKL 59
           +++   F     V F ID   F  L+     +   ++  +  +A    ++ +R + +   
Sbjct: 26  VREMSKFATVGGVAFLIDFALFNYLIGPARVEQITAKTIATVIAATFAFLGNRFWTWRHR 85

Query: 60  RRKS-FLETVRYGVMYFMLSILNYAFYVKLLLTFQGLQP----------LLATVLSAVSS 108
           +R     E   +     +   +  A          G+ P          + + V+     
Sbjct: 86  KRSHPAREYALFFFFNAVGLGIAVACLAISRYGLGGIWPEVFQTRLADNIASFVVGTGLG 145

Query: 109 MLFVFLLYIRFMT 121
            LF F  Y RF+ 
Sbjct: 146 TLFRFWSYRRFVF 158


>gi|145593417|ref|YP_001157714.1| GtrA family protein [Salinispora tropica CNB-440]
 gi|145302754|gb|ABP53336.1| GtrA family protein [Salinispora tropica CNB-440]
          Length = 230

 Score = 76.9 bits (188), Expect = 9e-13,   Method: Composition-based stats.
 Identities = 18/128 (14%), Positives = 42/128 (32%), Gaps = 6/128 (4%)

Query: 1   MKQCIIFIINIVVVFFIDVMGFFIL--MKCGADPFYSRIFSIAVAFLVTWIPSRLFIFLK 58
           + + + F I   V   I+   F  L           + + +   A + +++ +R + +  
Sbjct: 15  VNEALKFGIVGGVNTVINYAVFNALALTVFQGGALKATVVATVTATITSYLMNRHWTYRD 74

Query: 59  LRRKS-FLETVRYGVMYFMLSILNYAFYVKLLLTFQGLQPL---LATVLSAVSSMLFVFL 114
             + +   E   + +      ++                 L   LA  +  V + LF F 
Sbjct: 75  RPKTAVRREYALFFLFNGAGLLIELGVLTAAKYGLGVTSLLALNLAKTMGVVLATLFRFW 134

Query: 115 LYIRFMTR 122
            Y  F+ +
Sbjct: 135 SYRTFVFQ 142


>gi|108803636|ref|YP_643573.1| putative GAF sensor protein [Rubrobacter xylanophilus DSM 9941]
 gi|108764879|gb|ABG03761.1| putative GAF sensor protein [Rubrobacter xylanophilus DSM 9941]
          Length = 521

 Score = 76.9 bits (188), Expect = 9e-13,   Method: Composition-based stats.
 Identities = 24/129 (18%), Positives = 47/129 (36%), Gaps = 7/129 (5%)

Query: 3   QCIIFIINIVVVFFIDVMGFFILM-KCGADPFYSRIFSIAVAFLVTWIPSRLFIFLKLRR 61
           +   F +       ++ +    L     A    + +F++ V+ L  ++ +  F +  +R 
Sbjct: 258 RFWKFAMVGASGVLVNNLTLITLAEYFEAHKVIAWMFAVGVSILSNFLLNNAFTWRDVRH 317

Query: 62  KSFLETVRYGV----MYFMLSILNYAFYVKLLLTFQGLQPL--LATVLSAVSSMLFVFLL 115
            S +  +  G     +  M    N+A Y  LL       P   L  +L   +     F+L
Sbjct: 318 SSRIHFLLRGALAYPVAIMGIGANFAVYYPLLKYVSDEFPYYVLFNLLGIAAGTSVNFIL 377

Query: 116 YIRFMTRRV 124
             R + RR 
Sbjct: 378 SSRLVFRRP 386


>gi|254384904|ref|ZP_05000240.1| integral membrane protein [Streptomyces sp. Mg1]
 gi|194343785|gb|EDX24751.1| integral membrane protein [Streptomyces sp. Mg1]
          Length = 188

 Score = 76.9 bits (188), Expect = 1e-12,   Method: Composition-based stats.
 Identities = 12/127 (9%), Positives = 39/127 (30%), Gaps = 5/127 (3%)

Query: 1   MKQCIIFIINIVVVFFIDVMGFFILMKCGADPFY-SRIFSIAVAFLVTWIPSRLFIFLKL 59
           +++   F     +   +++  F ++          + + +  VA    ++  R F +   
Sbjct: 17  VREVAKFGAVGGLGVLVNLGVFNLIRSTTDLQVVRASVIATVVAIATNYLGFRYFAYRDR 76

Query: 60  RRK-SFLETVRYGVMYFMLSILNYAFYVKLLLTFQG---LQPLLATVLSAVSSMLFVFLL 115
            +     E   +     +  ++           F     L+      +    + +F F  
Sbjct: 77  AQSGRTRELALFVAFSVIGLVIENGVLYTATYGFGWDGKLETNAFKFIGIGVATVFRFWS 136

Query: 116 YIRFMTR 122
           Y  ++ +
Sbjct: 137 YRTWVFK 143


>gi|75906247|ref|YP_320543.1| glycosyl transferase family protein [Anabaena variabilis ATCC
           29413]
 gi|75699972|gb|ABA19648.1| Glycosyl transferase, family 2 [Anabaena variabilis ATCC 29413]
          Length = 412

 Score = 76.5 bits (187), Expect = 1e-12,   Method: Composition-based stats.
 Identities = 15/129 (11%), Positives = 47/129 (36%), Gaps = 10/129 (7%)

Query: 3   QCIIFIINIVVVFFIDVMGFFIL---MKCGADPFYSRIFSIAVAFLVTWIPSRLFIFLK- 58
           + I F +  +   F+D++  ++L            S+I +  +A    ++ +  + F   
Sbjct: 280 KFIRFGLVGLSGVFVDMVILYLLSDPSTLAWPLTRSKIIASEIAIFNNFLWNDAWTFADV 339

Query: 59  -----LRRKSFLETVRYGVMYFMLSILNYAFYVKLLLTFQGLQPLLATVLSAVSSMLFVF 113
                   +     +++ ++     +LN      +          +A +++   + ++ F
Sbjct: 340 SMQQQHWHQRLKRFLKFNIVCLAGVVLNVLILNIIFNYLIP-NRYIANLIAIAIATVWNF 398

Query: 114 LLYIRFMTR 122
            + +R   R
Sbjct: 399 WVNLRLSWR 407


>gi|85860731|ref|YP_462933.1| cell wall biogenesis glycosyltransferase [Syntrophus aciditrophicus
           SB]
 gi|85723822|gb|ABC78765.1| glycosyltransferase involved in cell wall biogenesis [Syntrophus
           aciditrophicus SB]
          Length = 373

 Score = 76.5 bits (187), Expect = 1e-12,   Method: Composition-based stats.
 Identities = 15/134 (11%), Positives = 46/134 (34%), Gaps = 12/134 (8%)

Query: 1   MKQCIIFIINIVVVFFIDVMGFFILMKCG---------ADPFYSRIFSIAVAFLVTWIPS 51
           + +   F +       +D+   ++ M+                +R+     A    ++ +
Sbjct: 235 LAEFTKFCLIGGFGMMVDLTFVYLSMQIFVIFGIVSKLFQFRIARVIGFIFAVTSNFLLN 294

Query: 52  RLFIF-LKLRRKSFLETVRYGVMYFMLSILNYA--FYVKLLLTFQGLQPLLATVLSAVSS 108
           R F F    +   + + + + ++  +   +N+    Y+   + F     L A  +  +  
Sbjct: 295 RRFTFSRAEQGNIYRQYLSFFLVSLIGFTINWLVSVYLYEHIHFFNTHYLTAAFMGILGG 354

Query: 109 MLFVFLLYIRFMTR 122
            +  F+    F+ +
Sbjct: 355 TVINFMGSKLFVFK 368


>gi|17230262|ref|NP_486810.1| dolichyl-phosphate-mannose synthase [Nostoc sp. PCC 7120]
 gi|17131863|dbj|BAB74469.1| dolichyl-phosphate-mannose synthase [Nostoc sp. PCC 7120]
          Length = 412

 Score = 76.1 bits (186), Expect = 1e-12,   Method: Composition-based stats.
 Identities = 15/131 (11%), Positives = 49/131 (37%), Gaps = 10/131 (7%)

Query: 1   MKQCIIFIINIVVVFFIDVMGFFIL---MKCGADPFYSRIFSIAVAFLVTWIPSRLFIF- 56
           + + I F +  +   F+D++  ++L            S+I +  +A    ++ +  + F 
Sbjct: 278 LDKFIRFGLVGLSGVFVDMVILYLLSDPSTLAWPLTRSKIIASEIAIFNNFLWNDAWTFA 337

Query: 57  -----LKLRRKSFLETVRYGVMYFMLSILNYAFYVKLLLTFQGLQPLLATVLSAVSSMLF 111
                 +   +     +++ ++     +LN      +          +A +++   + ++
Sbjct: 338 DVSMQQRGWNQRVKRFLKFNIVCLAGVVLNVLILNIIFNYLIP-NRYIANLIAIAIATVW 396

Query: 112 VFLLYIRFMTR 122
            F + +R   R
Sbjct: 397 NFWVNLRLSWR 407


>gi|320532574|ref|ZP_08033379.1| GtrA-like protein [Actinomyces sp. oral taxon 171 str. F0337]
 gi|320135202|gb|EFW27345.1| GtrA-like protein [Actinomyces sp. oral taxon 171 str. F0337]
          Length = 187

 Score = 76.1 bits (186), Expect = 1e-12,   Method: Composition-based stats.
 Identities = 19/131 (14%), Positives = 46/131 (35%), Gaps = 10/131 (7%)

Query: 1   MKQCIIFIINIVVVFFIDVMGFFILMK-----CGADPFYSRIFSIAVAFLVTWIPSRLFI 55
           +K+ + F +     + IDV  F +L           P  +++ + ++A + +WI +R + 
Sbjct: 20  IKEFMQFGMVGAAAYVIDVGLFNLLQHGPTGFLSGHPNSAQLMASSIATVFSWIANRYWT 79

Query: 56  FLKL-RRKSFLETVRYGVMYFMLSILNYAFYVKLLL----TFQGLQPLLATVLSAVSSML 110
           +    ++    E   + +       +     +        T      + A V+       
Sbjct: 80  YRGRTQKNVAREATLFVLANLGGIAITQFCLLFTHHVLGLTSPLADNIAAYVVGFGLGTA 139

Query: 111 FVFLLYIRFMT 121
           F F+ Y   + 
Sbjct: 140 FRFVFYHYIVF 150



 Score = 35.3 bits (80), Expect = 2.6,   Method: Composition-based stats.
 Identities = 8/63 (12%), Positives = 26/63 (41%), Gaps = 3/63 (4%)

Query: 63  SFLETVRYGVMYFMLSILNYAFYVKLLLTFQGL---QPLLATVLSAVSSMLFVFLLYIRF 119
              E +++G++     +++   +  L     G     P  A ++++  + +F ++    +
Sbjct: 19  LIKEFMQFGMVGAAAYVIDVGLFNLLQHGPTGFLSGHPNSAQLMASSIATVFSWIANRYW 78

Query: 120 MTR 122
             R
Sbjct: 79  TYR 81


>gi|298248906|ref|ZP_06972710.1| GtrA family protein [Ktedonobacter racemifer DSM 44963]
 gi|297546910|gb|EFH80777.1| GtrA family protein [Ktedonobacter racemifer DSM 44963]
          Length = 204

 Score = 76.1 bits (186), Expect = 1e-12,   Method: Composition-based stats.
 Identities = 15/130 (11%), Positives = 46/130 (35%), Gaps = 11/130 (8%)

Query: 3   QCIIFIINIVVVFFIDVMGFFILMKCGADP-----FYSRIFSIAVAFLVTWIPSRLFIFL 57
           Q + + +   V   IDV     L+                 + A   + ++  ++ + F 
Sbjct: 43  QVVRYCLVGGVNTLIDVSILNALLWRFPTHNMQLLVVENSVAYAGGAVSSFFLNKYWTFR 102

Query: 58  KLRRKSFLETVRYGVMYFMLSILNYAFYVK------LLLTFQGLQPLLATVLSAVSSMLF 111
           + ++ +  E  R+ +   +  + N A            +    +   ++ +L+  ++ + 
Sbjct: 103 RKQQPTRQEVGRFLLSVALEILSNNALLWLAGMALSPFMANVIVWGNISKLLAVAANAVL 162

Query: 112 VFLLYIRFMT 121
            +LL   ++ 
Sbjct: 163 SYLLMRFWIF 172



 Score = 37.6 bits (86), Expect = 0.59,   Method: Composition-based stats.
 Identities = 12/75 (16%), Positives = 28/75 (37%), Gaps = 3/75 (4%)

Query: 52  RLFIFLKLRRKSFLETVRYGVMYFMLSILNYAFYVKLLLTFQGLQ---PLLATVLSAVSS 108
           R        R +  + VRY ++  + ++++ +    LL  F        ++   ++    
Sbjct: 29  RALFPGGGGRGTCWQVVRYCLVGGVNTLIDVSILNALLWRFPTHNMQLLVVENSVAYAGG 88

Query: 109 MLFVFLLYIRFMTRR 123
            +  F L   +  RR
Sbjct: 89  AVSSFFLNKYWTFRR 103


>gi|222053429|ref|YP_002535791.1| GtrA family protein [Geobacter sp. FRC-32]
 gi|221562718|gb|ACM18690.1| GtrA family protein [Geobacter sp. FRC-32]
          Length = 148

 Score = 76.1 bits (186), Expect = 1e-12,   Method: Composition-based stats.
 Identities = 21/122 (17%), Positives = 50/122 (40%), Gaps = 2/122 (1%)

Query: 1   MKQCIIFIINIVVVFFIDVMGFFILMKCGADPFYSRIFSIAVAFLVTWIPSRLFIFLKLR 60
           ++Q   F +  ++   +D   FF+L   G     ++  S +     ++  ++ + F    
Sbjct: 21  VRQLTRFNLVGILNTTVDFSLFFLLDMLGMPYLLAQTCSYSCGIANSYFFNKYWTFGMTG 80

Query: 61  RKSFLETVRYGVMYFMLSILNYAFYVKLLLTFQGLQPLLATVLSAVSSMLFVFLLYIRFM 120
            KS  E +R+ ++      ++    V L  +      L + + + + +MLF F    + +
Sbjct: 81  IKSA-EMLRFAMVSLTALGIS-VLLVYLFHSTLNFSLLTSKIAATILTMLFSFFGSRQLV 138

Query: 121 TR 122
            R
Sbjct: 139 FR 140


>gi|85372832|ref|YP_456894.1| putative dolichol-phosphate mannosyltransferase [Erythrobacter
           litoralis HTCC2594]
 gi|84785915|gb|ABC62097.1| putative dolichol-phosphate mannosyltransferase [Erythrobacter
           litoralis HTCC2594]
          Length = 374

 Score = 76.1 bits (186), Expect = 1e-12,   Method: Composition-based stats.
 Identities = 13/125 (10%), Positives = 42/125 (33%), Gaps = 6/125 (4%)

Query: 3   QCIIFIINIVVVFFIDVMGFF-ILMKCGADPFYSRIFSIAVAFLVTWIPSRLFIFLKLRR 61
           + ++F    +V   + +   +  L   GA    ++  +   A    +  + +F +   + 
Sbjct: 251 KLLMFGAVGLVGTLVHLALLWGALTGLGASFAIAQGSATLGAMTFNFALNNVFTYRDRKL 310

Query: 62  KSFL---ETVRYGVMYFMLSILNYAFYVKLLLTFQGLQPLLATVLSAVSSMLFVFLLYIR 118
             +      + +     + ++ N       LL  +     +A +  A+   ++ +     
Sbjct: 311 TGWRWVTGWLSFCAACGIGAVANVGI--GTLLYTEAWSWWIAGLAGALIGSVWNYAATSW 368

Query: 119 FMTRR 123
              R+
Sbjct: 369 LTWRK 373



 Score = 34.5 bits (78), Expect = 4.5,   Method: Composition-based stats.
 Identities = 4/55 (7%), Positives = 16/55 (29%)

Query: 5   IIFIINIVVVFFIDVMGFFILMKCGADPFYSRIFSIAVAFLVTWIPSRLFIFLKL 59
           + F     +    +V    +L       + + +    +  +  +  +    + K 
Sbjct: 320 LSFCAACGIGAVANVGIGTLLYTEAWSWWIAGLAGALIGSVWNYAATSWLTWRKR 374


>gi|256824699|ref|YP_003148659.1| hypothetical protein Ksed_08400 [Kytococcus sedentarius DSM 20547]
 gi|256688092|gb|ACV05894.1| predicted membrane protein [Kytococcus sedentarius DSM 20547]
          Length = 220

 Score = 76.1 bits (186), Expect = 1e-12,   Method: Composition-based stats.
 Identities = 27/138 (19%), Positives = 54/138 (39%), Gaps = 18/138 (13%)

Query: 2   KQCIIFIINIVVVFFIDVMGFFILMK-------------CGADPFYSRIFSIAVAFLVTW 48
           ++   F +  ++ F ID   + +LM               G  P  S++ + AVA    W
Sbjct: 20  REASKFGVIGLLAFIIDTGLYNLLMYGPVLSANAAPEGVLGDHPLTSKVVATAVATAFAW 79

Query: 49  IPSRLFIFLKLRRKSFLE----TVRYGVMYFMLSILNYAFYVKLL-LTFQGLQPLLATVL 103
           + +R + F K RR +        + + ++  +++++   F   +L    Q    +    +
Sbjct: 80  LGNRYWTFRKTRRANVTREAALFILFNILGLLIALICLWFSHYILGFRSQLADNISGNGV 139

Query: 104 SAVSSMLFVFLLYIRFMT 121
             V   LF F  Y  F+ 
Sbjct: 140 GLVLGTLFRFWAYRTFVF 157


>gi|315231501|ref|YP_004071937.1| dolichol-phosphate mannosyltransferase [Thermococcus barophilus MP]
 gi|315184529|gb|ADT84714.1| dolichol-phosphate mannosyltransferase [Thermococcus barophilus MP]
          Length = 354

 Score = 76.1 bits (186), Expect = 1e-12,   Method: Composition-based stats.
 Identities = 16/124 (12%), Positives = 44/124 (35%), Gaps = 7/124 (5%)

Query: 3   QCIIFIINIVVVFFIDVMGFFILMKCGADP----FYSRIFSIAVAFLVTWIPSRLFIFLK 58
           + I F I  +    ++    ++              + +F+  +A L  +  + L+ F  
Sbjct: 232 RLIKFSIVGMSGIVVNQFFLWLFANILGGGIANLMIANVFATELAILNNFTWNDLWTFKD 291

Query: 59  -LRRKSFLETVRYGVMYFMLSILNYAFYVKLLLTFQGLQPLLATVLSAVSSMLFVFLLYI 117
              +  +     + +     +++ +  +    L F G+  L+A ++    S +  FL+  
Sbjct: 292 LKNKPLYKRLFSFHLAALTGAVVQWTIFGV--LIFLGMHYLIANLIGIGFSFIVRFLVNR 349

Query: 118 RFMT 121
               
Sbjct: 350 HITW 353



 Score = 41.4 bits (96), Expect = 0.041,   Method: Composition-based stats.
 Identities = 9/56 (16%), Positives = 23/56 (41%)

Query: 2   KQCIIFIINIVVVFFIDVMGFFILMKCGADPFYSRIFSIAVAFLVTWIPSRLFIFL 57
           K+   F +  +    +    F +L+  G     + +  I  +F+V ++ +R   + 
Sbjct: 299 KRLFSFHLAALTGAVVQWTIFGVLIFLGMHYLIANLIGIGFSFIVRFLVNRHITWG 354



 Score = 34.9 bits (79), Expect = 3.3,   Method: Composition-based stats.
 Identities = 9/80 (11%), Positives = 27/80 (33%), Gaps = 4/80 (5%)

Query: 45  LVTWIPSRLFIFLKLRRKSFLETVRYGVMYFMLSILNYAFYVKL--LLTFQGLQPLLATV 102
           +  ++  R    L          +++ ++     ++N  F      +L       ++A V
Sbjct: 213 IFNYL--RHLYRLMKWEGEIDRLIKFSIVGMSGIVVNQFFLWLFANILGGGIANLMIANV 270

Query: 103 LSAVSSMLFVFLLYIRFMTR 122
            +   ++L  F     +  +
Sbjct: 271 FATELAILNNFTWNDLWTFK 290


>gi|257054666|ref|YP_003132498.1| hypothetical protein Svir_06000 [Saccharomonospora viridis DSM
           43017]
 gi|256584538|gb|ACU95671.1| predicted membrane protein [Saccharomonospora viridis DSM 43017]
          Length = 180

 Score = 76.1 bits (186), Expect = 2e-12,   Method: Composition-based stats.
 Identities = 19/135 (14%), Positives = 52/135 (38%), Gaps = 15/135 (11%)

Query: 2   KQCIIFIINIVVVFFIDVMGFFIL--MKCGADPFYSRIFSIAVAFLVTWIPSRLFIFLKL 59
           ++ + F++     F +D   +++L        P  ++  +I +A +V+++ +R + F   
Sbjct: 23  RELVKFVVVGSTTFVVDNGIWYLLKLTILNTKPTTAKAIAILIATIVSYVLNREWSFRTR 82

Query: 60  -RRKSFLETVRYGVMYFMLSILNYAFYV------------KLLLTFQGLQPLLATVLSAV 106
             R+   E   + ++  +   +N                   L   +       +V+  +
Sbjct: 83  GGRERAHEATLFFLVSGVAVAINLVPLYMSRYVLNLEVPHVSLFVQEIADFASGSVIGML 142

Query: 107 SSMLFVFLLYIRFMT 121
            +M F F  + R++ 
Sbjct: 143 LAMAFRFWGFRRWVF 157



 Score = 39.1 bits (90), Expect = 0.22,   Method: Composition-based stats.
 Identities = 10/59 (16%), Positives = 26/59 (44%)

Query: 64  FLETVRYGVMYFMLSILNYAFYVKLLLTFQGLQPLLATVLSAVSSMLFVFLLYIRFMTR 122
             E V++ V+     +++   +  L LT    +P  A  ++ + + +  ++L   +  R
Sbjct: 22  HRELVKFVVVGSTTFVVDNGIWYLLKLTILNTKPTTAKAIAILIATIVSYVLNREWSFR 80


>gi|256786502|ref|ZP_05524933.1| glycosyl transferase [Streptomyces lividans TK24]
          Length = 421

 Score = 76.1 bits (186), Expect = 2e-12,   Method: Composition-based stats.
 Identities = 13/124 (10%), Positives = 41/124 (33%), Gaps = 5/124 (4%)

Query: 2   KQCIIFIINIVVVFFIDVMGFFILMKCGADPFYSRIFSIAVAFLVTWIPSRLFIFLKLRR 61
           +Q + F +   +     ++ +       A    +   ++ V+ +     +R   F    R
Sbjct: 259 RQLVGFCVVGALSTLFYLLLYSGFRHF-AGSQLANALALLVSAVANTAANRRLTFGVRGR 317

Query: 62  KSFL----ETVRYGVMYFMLSILNYAFYVKLLLTFQGLQPLLATVLSAVSSMLFVFLLYI 117
              +    + +    +   L+  + A              L   + + +++ +  FLL+ 
Sbjct: 318 GGAVRHQAQGLVVFGIGLALTSGSLAALSAATAHPDHSTELAVLIAANLAATVLRFLLFR 377

Query: 118 RFMT 121
            ++ 
Sbjct: 378 AWVF 381


>gi|148256600|ref|YP_001241185.1| putative dolichol-phosphate mannosyltransferase [Bradyrhizobium sp.
           BTAi1]
 gi|146408773|gb|ABQ37279.1| putative dolichol-phosphate mannosyltransferase [Bradyrhizobium sp.
           BTAi1]
          Length = 377

 Score = 76.1 bits (186), Expect = 2e-12,   Method: Composition-based stats.
 Identities = 15/125 (12%), Positives = 43/125 (34%), Gaps = 6/125 (4%)

Query: 3   QCIIFIINIVVVFFIDVMGFFILMKCGADPFY-SRIFSIAVAFLVTWIPSRLFIFLKLRR 61
           + ++F +       + +   F+ +     PF  ++     VA    +I +    +   R 
Sbjct: 254 RFLLFAMVGGTGLVVHLATLFLGLNLFDLPFAEAQALGAFVAMTSNFILNNFLTYRDQRL 313

Query: 62  KS---FLETVRYGVMYFMLSILNYAFYVKLLLTFQGLQPLLATVLSAVSSMLFVFLLYIR 118
           K        + + ++  +  + N      +          LA    A+  +++ + +   
Sbjct: 314 KGLAILRGLLMFYLVCSVGLLANVGVAFSVYDQEPIW--WLAGAAGALMGVVWNYAISGL 371

Query: 119 FMTRR 123
           F+ R+
Sbjct: 372 FVWRK 376


>gi|325067580|ref|ZP_08126253.1| GtrA family protein [Actinomyces oris K20]
          Length = 186

 Score = 76.1 bits (186), Expect = 2e-12,   Method: Composition-based stats.
 Identities = 19/131 (14%), Positives = 44/131 (33%), Gaps = 10/131 (7%)

Query: 1   MKQCIIFIINIVVVFFIDVMGFFILMK-----CGADPFYSRIFSIAVAFLVTWIPSRLFI 55
           +K+ + F +     + IDV  F +L           P  +++ + + A   +WI +R + 
Sbjct: 17  VKEFMQFGMVGAAAYVIDVGLFNLLQHGPTGVLSGHPNSAQLLASSTATAFSWIANRYWT 76

Query: 56  FLKL-RRKSFLETVRYGVMYFMLSILNYAFYVKLLL----TFQGLQPLLATVLSAVSSML 110
           +    ++    E   + +       +     +        T      + A V+       
Sbjct: 77  YRGRTQKNVAREATLFVLANLGGIAITQFCLLFTHHVLGLTSPLADNVAAYVVGFGLGTA 136

Query: 111 FVFLLYIRFMT 121
           F F+ Y   + 
Sbjct: 137 FRFVFYHYIVF 147



 Score = 34.5 bits (78), Expect = 5.2,   Method: Composition-based stats.
 Identities = 9/61 (14%), Positives = 27/61 (44%), Gaps = 3/61 (4%)

Query: 65  LETVRYGVMYFMLSILNYAFYVKLLLTFQGL---QPLLATVLSAVSSMLFVFLLYIRFMT 121
            E +++G++     +++   +  L     G+    P  A +L++ ++  F ++    +  
Sbjct: 18  KEFMQFGMVGAAAYVIDVGLFNLLQHGPTGVLSGHPNSAQLLASSTATAFSWIANRYWTY 77

Query: 122 R 122
           R
Sbjct: 78  R 78


>gi|302552562|ref|ZP_07304904.1| glycosyl transferase [Streptomyces viridochromogenes DSM 40736]
 gi|302470180|gb|EFL33273.1| glycosyl transferase [Streptomyces viridochromogenes DSM 40736]
          Length = 477

 Score = 75.7 bits (185), Expect = 2e-12,   Method: Composition-based stats.
 Identities = 11/124 (8%), Positives = 39/124 (31%), Gaps = 5/124 (4%)

Query: 2   KQCIIFIINIVVVFFIDVMGFFILMKCGADPFYSRIFSIAVAFLVTWIPSRLFIFLKLRR 61
           +Q + F +   +     ++ +            +   ++ V+ +     +R   F     
Sbjct: 305 RQLVGFCVVGGLSTLFYLLLYSGFRVFT-GSQVANALALLVSAVANTAANRRLTFGVRGS 363

Query: 62  KSFL----ETVRYGVMYFMLSILNYAFYVKLLLTFQGLQPLLATVLSAVSSMLFVFLLYI 117
              +    + +    +   L+  + A              L   + + +++ +  FLL+ 
Sbjct: 364 GGAVRHQAQGLVVFGIGLALTSGSLAALGAATTEPAHSTELAVLIAANLAATVLRFLLFR 423

Query: 118 RFMT 121
            ++ 
Sbjct: 424 AWVF 427


>gi|182437358|ref|YP_001825077.1| putative glycosyl transferase [Streptomyces griseus subsp. griseus
           NBRC 13350]
 gi|178465874|dbj|BAG20394.1| putative glycosyl transferase [Streptomyces griseus subsp. griseus
           NBRC 13350]
          Length = 448

 Score = 75.7 bits (185), Expect = 2e-12,   Method: Composition-based stats.
 Identities = 14/124 (11%), Positives = 43/124 (34%), Gaps = 5/124 (4%)

Query: 2   KQCIIFIINIVVVFFIDVMGFFILMKCGADPFYSRIFSIAVAFLVTWIPSRLFIFLKLRR 61
           +Q + F +   +     +   + L + G  P  +   ++ ++ +     +R   F    R
Sbjct: 314 RQLVGFCVVGALSTLFYLA-LYSLFRLGVGPQLANGGALLLSAVANTAANRRLTFGVRGR 372

Query: 62  KSFL----ETVRYGVMYFMLSILNYAFYVKLLLTFQGLQPLLATVLSAVSSMLFVFLLYI 117
              +    + +    +   L+  + A       +      L   + + +++ +  FLL  
Sbjct: 373 SGAVRHQAQGLVVFAIGLALTSGSLAALGAASGSASHGTELAVLITANLAATVLRFLLLR 432

Query: 118 RFMT 121
            ++ 
Sbjct: 433 AWVF 436


>gi|309812504|ref|ZP_07706257.1| GtrA-like protein [Dermacoccus sp. Ellin185]
 gi|308433559|gb|EFP57438.1| GtrA-like protein [Dermacoccus sp. Ellin185]
          Length = 177

 Score = 75.7 bits (185), Expect = 2e-12,   Method: Composition-based stats.
 Identities = 26/133 (19%), Positives = 49/133 (36%), Gaps = 13/133 (9%)

Query: 2   KQCIIFIINIVVVFFIDVMGFFILMKCGAD--------PFYSRIFSIAVAFLVTWIPSRL 53
           +Q I F++   + F  D  GF +L   G D           +++ S A+  LV W+ +R 
Sbjct: 25  QQLISFVVVGGLAFVADAGGFNVLRYAGPDGHGIMYDQAVTAKLVSTALGVLVAWLGNRY 84

Query: 54  FIFLKLRRKS-FLETVRYGVMYFMLSILNYAFYVKLLLTFQ----GLQPLLATVLSAVSS 108
           + F   RR+    E + +  +  +  ++                     + A  +  V +
Sbjct: 85  WTFKDTRREQVHHEVLIFLAVSAVGGLIAMGCLGFSHYVLGLTSKLADNISANGVGLVLA 144

Query: 109 MLFVFLLYIRFMT 121
            LF F  Y   + 
Sbjct: 145 TLFRFWGYKTLVF 157


>gi|260435642|ref|ZP_05789612.1| possible glycosyltransferase [Synechococcus sp. WH 8109]
 gi|260413516|gb|EEX06812.1| possible glycosyltransferase [Synechococcus sp. WH 8109]
          Length = 376

 Score = 75.7 bits (185), Expect = 2e-12,   Method: Composition-based stats.
 Identities = 16/124 (12%), Positives = 43/124 (34%), Gaps = 5/124 (4%)

Query: 2   KQCIIFIINIVVVFFIDVMGFFILMKCGADPFY-SRIFSIAVAFLVTWIPSRLFIFLKLR 60
           ++ I F +       + ++   +LM      F  +   ++  A    ++ +    F   R
Sbjct: 251 RRAISFGLVGASGVMVQLLSTALLMGLFNLEFQQALPVAVITAASSNYLVNNALTFRDRR 310

Query: 61  ---RKSFLETVRYGVMYFMLSILNYAFYVKLLLTFQGLQPLLATVLSAVSSMLFVFLLYI 117
              R+     +++ ++  + ++ N         T      L A +   V   ++ +    
Sbjct: 311 QSGRQLIRGLLKFLLVASLPALANVGL-ATSFYTLIQAHALWAQLAGIVVVYVWNYAASS 369

Query: 118 RFMT 121
           RF+ 
Sbjct: 370 RFVW 373


>gi|258511843|ref|YP_003185277.1| Dolichyl-phosphate beta-D-mannosyltransferase [Alicyclobacillus
           acidocaldarius subsp. acidocaldarius DSM 446]
 gi|257478569|gb|ACV58888.1| Dolichyl-phosphate beta-D-mannosyltransferase [Alicyclobacillus
           acidocaldarius subsp. acidocaldarius DSM 446]
          Length = 384

 Score = 75.7 bits (185), Expect = 2e-12,   Method: Composition-based stats.
 Identities = 10/126 (7%), Positives = 36/126 (28%), Gaps = 5/126 (3%)

Query: 2   KQCIIFIINIVVVFFIDVMGFFILMK-CGADPFYSRIFSIAVAFLVTWIPSRLFIFL--K 58
           ++  +F +  +    ++     +L          + + +  VA L  +  +    +    
Sbjct: 234 RRFFLFCLIGLSGVVVNEAVLSLLWYGFHLRDTVASVAASFVAMLNNYFWNDRVTWKSES 293

Query: 59  LRRKSFLETVRYGVMYFMLSILNYAFYVKLLLTFQGLQPLLATVLSAVSSMLFVFLLYIR 118
             R    +   +  +  +   +             G+       +  + S  + + +  R
Sbjct: 294 SGRGWGWKLPVFVGISVVGIAITTLVMRGC--EGFGVPVPAGQAIGILVSTAWSYWMNSR 351

Query: 119 FMTRRV 124
              R +
Sbjct: 352 VTWRNI 357



 Score = 37.2 bits (85), Expect = 0.69,   Method: Composition-based stats.
 Identities = 11/77 (14%), Positives = 27/77 (35%), Gaps = 3/77 (3%)

Query: 46  VTWIPSRLFIFLKLRRKSFLETVRYGVMYFMLSILNYAFYVKLLLTFQGLQPLLATVLSA 105
             +   R  + L  +         + ++     ++N A     L     L+  +A+V ++
Sbjct: 217 WNYF--RHLVRLVSQSPPDRRFFLFCLIGLSGVVVNEAVLSL-LWYGFHLRDTVASVAAS 273

Query: 106 VSSMLFVFLLYIRFMTR 122
             +ML  +    R   +
Sbjct: 274 FVAMLNNYFWNDRVTWK 290



 Score = 36.0 bits (82), Expect = 1.9,   Method: Composition-based stats.
 Identities = 8/62 (12%), Positives = 21/62 (33%)

Query: 7   FIINIVVVFFIDVMGFFILMKCGADPFYSRIFSIAVAFLVTWIPSRLFIFLKLRRKSFLE 66
           F+   VV   I  +        G      +   I V+   ++  +    +  + R++  +
Sbjct: 305 FVGISVVGIAITTLVMRGCEGFGVPVPAGQAIGILVSTAWSYWMNSRVTWRNIEREARGD 364

Query: 67  TV 68
            +
Sbjct: 365 AI 366


>gi|298248556|ref|ZP_06972361.1| GtrA family protein [Ktedonobacter racemifer DSM 44963]
 gi|297551215|gb|EFH85081.1| GtrA family protein [Ktedonobacter racemifer DSM 44963]
          Length = 195

 Score = 75.7 bits (185), Expect = 2e-12,   Method: Composition-based stats.
 Identities = 15/130 (11%), Positives = 45/130 (34%), Gaps = 11/130 (8%)

Query: 3   QCIIFIINIVVVFFIDVMGFFILMKCGADP-----FYSRIFSIAVAFLVTWIPSRLFIFL 57
           Q + + +   +   IDV     L+                 + A   + ++  ++ + F 
Sbjct: 34  QFLRYCLVGGINTIIDVSVLNALLWRDPSHNVQLLVAYNSVAYASGAVSSFFLNKYWTFR 93

Query: 58  KLRRKSFLETVRYGVMYFMLSILNYAFYVKLLLTFQGLQPLLA------TVLSAVSSMLF 111
           + ++ +  E  R+ +   +  + N A      +        +A       +L+  ++ + 
Sbjct: 94  RKQQPTRQEVGRFLISVALEILSNNALLWLAGMALSPFMANVAVWGNTSKLLAVAANAVL 153

Query: 112 VFLLYIRFMT 121
            +LL   ++ 
Sbjct: 154 SYLLMRFWIF 163



 Score = 35.3 bits (80), Expect = 2.7,   Method: Composition-based stats.
 Identities = 10/65 (15%), Positives = 25/65 (38%), Gaps = 3/65 (4%)

Query: 62  KSFLETVRYGVMYFMLSILNYAFYVKLLLTFQGLQP---LLATVLSAVSSMLFVFLLYIR 118
            +  + +RY ++  + +I++ +    LL           +    ++  S  +  F L   
Sbjct: 30  STGFQFLRYCLVGGINTIIDVSVLNALLWRDPSHNVQLLVAYNSVAYASGAVSSFFLNKY 89

Query: 119 FMTRR 123
           +  RR
Sbjct: 90  WTFRR 94


>gi|311068385|ref|YP_003973308.1| YngA protein [Bacillus atrophaeus 1942]
 gi|310868902|gb|ADP32377.1| YngA [Bacillus atrophaeus 1942]
          Length = 121

 Score = 75.7 bits (185), Expect = 2e-12,   Method: Composition-based stats.
 Identities = 21/111 (18%), Positives = 46/111 (41%), Gaps = 2/111 (1%)

Query: 11  IVVVFFIDVMGFFILMKCGADPFYSRIFSIAVAFLVTWIPSRLFIFLKLRRKSFLETVRY 70
            V    ID   FF+L  C      ++I S +   + +++ +R + F   R+    E VR+
Sbjct: 2   GVGNTLIDFGVFFLLTACHVPYLPAQICSYSAGIINSYVWNRNWTFRVKRKADGKEIVRF 61

Query: 71  GVMYFMLSILNYAFYVKLLLTFQGLQPLLATVLSAVSSMLFVFLLYIRFMT 121
            ++    S + +      L    G   L++ + + +  M+  F+    ++ 
Sbjct: 62  LMINIAASGITFLLLY--LFQKGGCSLLVSKLAATIGGMMMNFIGNRIWVF 110



 Score = 42.2 bits (98), Expect = 0.027,   Method: Composition-based stats.
 Identities = 9/58 (15%), Positives = 27/58 (46%)

Query: 2   KQCIIFIINIVVVFFIDVMGFFILMKCGADPFYSRIFSIAVAFLVTWIPSRLFIFLKL 59
           K+ + F++  +    I  +  ++  K G     S++ +     ++ +I +R+++F   
Sbjct: 56  KEIVRFLMINIAASGITFLLLYLFQKGGCSLLVSKLAATIGGMMMNFIGNRIWVFGDS 113


>gi|291453678|ref|ZP_06593068.1| integral membrane protein [Streptomyces albus J1074]
 gi|291356627|gb|EFE83529.1| integral membrane protein [Streptomyces albus J1074]
          Length = 186

 Score = 75.7 bits (185), Expect = 2e-12,   Method: Composition-based stats.
 Identities = 15/122 (12%), Positives = 36/122 (29%), Gaps = 5/122 (4%)

Query: 6   IFIINIVVVFFIDVMGFFILMKCGADPFY-SRIFSIAVAFLVTWIPSRLFIFLKLRR-KS 63
            F         +++  F ++          + + +  VA +  ++  R F +    +   
Sbjct: 37  KFGAVGGAGVLVNLAVFNLVRHLTELQVVRASVLATVVAIVFNYLGFRYFTYRDRDKGGR 96

Query: 64  FLETVRYGVMYFMLSILNYAFYVKLLLTFQGLQPLLATVL---SAVSSMLFVFLLYIRFM 120
             E   +     +  ++                 L + VL       + LF F  Y  ++
Sbjct: 97  TREMSLFLAFSVIGLVIENGILYTGTYGLGFDGRLESNVLKFAGIGVATLFRFWSYRTWV 156

Query: 121 TR 122
            R
Sbjct: 157 FR 158


>gi|259047634|ref|ZP_05738035.1| glycosyl transferase [Granulicatella adiacens ATCC 49175]
 gi|259035825|gb|EEW37080.1| glycosyl transferase [Granulicatella adiacens ATCC 49175]
          Length = 368

 Score = 75.3 bits (184), Expect = 2e-12,   Method: Composition-based stats.
 Identities = 18/130 (13%), Positives = 52/130 (40%), Gaps = 5/130 (3%)

Query: 2   KQCIIFIINIVVVFFIDVMGFFILMKCGADPFYSRIFSIAVAFLVTWIPSRLFIFLKLRR 61
           K+   F ++  + FF+D   +   +  G     + + +  ++    +  ++ F+F    +
Sbjct: 241 KEIFQFALSSFLSFFLDYTLYAFQIFIGVPLVTANVIARMISAGFNFFVNKKFVF-ASDK 299

Query: 62  KSFLETVRYGVMYFMLSILNYAFYVKLLLTFQGLQPLLATVLSAVSSMLFVFLLYIRFMT 121
               E   Y ++      LN    +  L    G+ P +  +++ +    F + +  + + 
Sbjct: 300 PFLKELGGYILLASFSLTLNTLILM-GLSYGLGIGPFIGKIMTEIGMFFFNWFVQKKLIF 358

Query: 122 ---RRVYFIK 128
              + V+++K
Sbjct: 359 GQEKGVHYVK 368


>gi|229492463|ref|ZP_04386266.1| GtrA family protein [Rhodococcus erythropolis SK121]
 gi|229320449|gb|EEN86267.1| GtrA family protein [Rhodococcus erythropolis SK121]
          Length = 157

 Score = 75.3 bits (184), Expect = 2e-12,   Method: Composition-based stats.
 Identities = 13/120 (10%), Positives = 40/120 (33%)

Query: 3   QCIIFIINIVVVFFIDVMGFFILMKCGADPFYSRIFSIAVAFLVTWIPSRLFIFLKLRRK 62
           Q + F+    +   +D   + +L   G     ++  S        ++ +R + F     +
Sbjct: 36  QIVRFVATGGLSAVVDYGLYVLLFALGLPRVAAKSLSFVAGTTTAYLINRRWTFKAEPSR 95

Query: 63  SFLETVRYGVMYFMLSILNYAFYVKLLLTFQGLQPLLATVLSAVSSMLFVFLLYIRFMTR 122
           +    V           +     +  +      +  LA V++  ++ +  F++    + +
Sbjct: 96  ARFIAVVALYAVTFAVQVGLNELMVHVFDEHWWRTPLAFVIAQGTATVINFIVQRAVIFK 155


>gi|326777968|ref|ZP_08237233.1| glycosyl transferase family 2 [Streptomyces cf. griseus XylebKG-1]
 gi|326658301|gb|EGE43147.1| glycosyl transferase family 2 [Streptomyces cf. griseus XylebKG-1]
          Length = 448

 Score = 75.3 bits (184), Expect = 2e-12,   Method: Composition-based stats.
 Identities = 14/124 (11%), Positives = 43/124 (34%), Gaps = 5/124 (4%)

Query: 2   KQCIIFIINIVVVFFIDVMGFFILMKCGADPFYSRIFSIAVAFLVTWIPSRLFIFLKLRR 61
           +Q + F +   +     +   + L + G  P  +   ++ ++ +     +R   F    R
Sbjct: 314 RQLVGFCVVGALSTLFYLA-LYSLFRLGVGPQLANGGALLLSAVANTAANRRLTFGVRGR 372

Query: 62  KSFL----ETVRYGVMYFMLSILNYAFYVKLLLTFQGLQPLLATVLSAVSSMLFVFLLYI 117
              +    + +    +   L+  + A       +      L   + + +++ +  FLL  
Sbjct: 373 SGAVRHQAQGLVVFAIGLALTSGSLAALGAASGSASHGTELAVLITANLAATVLRFLLLR 432

Query: 118 RFMT 121
            ++ 
Sbjct: 433 AWVF 436


>gi|320010413|gb|ADW05263.1| GtrA family protein [Streptomyces flavogriseus ATCC 33331]
          Length = 172

 Score = 75.3 bits (184), Expect = 3e-12,   Method: Composition-based stats.
 Identities = 15/126 (11%), Positives = 43/126 (34%), Gaps = 5/126 (3%)

Query: 2   KQCIIFIINIVVVFFIDVMGFFILMKCGADPFY-SRIFSIAVAFLVTWIPSRLFIFLKLR 60
           ++   F     +   +++    ++ +    P   + +    VA L  ++  R + +    
Sbjct: 16  REVAKFGAVGALGLVVNIAVSNLIWRTTEIPVVRAGLMGTVVAILFNYVGFRYWTYRDRD 75

Query: 61  R-KSFLETVRYGVMYFMLSILNYAFYVKLLLTFQGLQPLLA---TVLSAVSSMLFVFLLY 116
           +     E   + +   + +++           F    P+ +    +L    + LF F  Y
Sbjct: 76  KTGRTRELTLFLLFSAVGAVIETGVLYVATYGFGWNSPVQSNVFKILGIGIATLFRFWSY 135

Query: 117 IRFMTR 122
             ++ R
Sbjct: 136 RTWVFR 141


>gi|229542563|ref|ZP_04431623.1| GtrA family protein [Bacillus coagulans 36D1]
 gi|229326983|gb|EEN92658.1| GtrA family protein [Bacillus coagulans 36D1]
          Length = 129

 Score = 75.3 bits (184), Expect = 3e-12,   Method: Composition-based stats.
 Identities = 20/119 (16%), Positives = 48/119 (40%), Gaps = 1/119 (0%)

Query: 4   CIIFIINIVVVFFIDVMGFFILMKCGADPFYSRIFSIAVAFLVTWIPSRLFIFLKLRRKS 63
            + F I       +D + FF+L         ++  S       +++ +R + F   ++ +
Sbjct: 8   FLKFCIVGAGNTLVDFLVFFLLTSVHVPYLVAQACSYTAGMANSYLLNRFWTFQVRKKAT 67

Query: 64  FLETVRYGVMYFMLSILNYAFYVKLLLTFQGLQPLLATVLSAVSSMLFVFLLYIRFMTR 122
           + E  R+  +  ++  L  +  + L     G   L A +++ ++ M   FL    ++ R
Sbjct: 68  WAEASRFIAVNLIVYALT-SLLLFLFHEQWGWPLLYAKIIATLAGMAVNFLGTRLWVFR 125


>gi|120405379|ref|YP_955208.1| glycosyl transferase family protein [Mycobacterium vanbaalenii
           PYR-1]
 gi|119958197|gb|ABM15202.1| glycosyl transferase, family 2 [Mycobacterium vanbaalenii PYR-1]
          Length = 437

 Score = 75.3 bits (184), Expect = 3e-12,   Method: Composition-based stats.
 Identities = 17/131 (12%), Positives = 45/131 (34%), Gaps = 7/131 (5%)

Query: 1   MKQCIIFIINIVVVFFIDVMGFFILMKCGADPFYSRIFSIAVAFLVTWIPSRLFIFLKLR 60
           ++Q + F    +      ++ F +L    A    + + ++ +  +     +R F F    
Sbjct: 302 LRQAVRFGTVGIASTLAYILLFMLLQGW-AGAQLANLIALLLTAIGNTAANRRFTFGIGG 360

Query: 61  RKS----FLETVRYGVMYFMLSILNYAFYVKLLLTFQGLQPLLATVLSAVSSMLFVFLLY 116
           R       +E +    +   ++            +   L  L   V + + + +  F+L 
Sbjct: 361 RPHLARNHVEGLIVFGIALAITSGALGLLHAATASPHHLVELGVLVTANLLATVVRFVLL 420

Query: 117 IRFMT--RRVY 125
             ++   RR +
Sbjct: 421 RGWVFHPRRTH 431


>gi|289704923|ref|ZP_06501340.1| GtrA-like protein [Micrococcus luteus SK58]
 gi|289558419|gb|EFD51693.1| GtrA-like protein [Micrococcus luteus SK58]
          Length = 186

 Score = 75.3 bits (184), Expect = 3e-12,   Method: Composition-based stats.
 Identities = 20/128 (15%), Positives = 43/128 (33%), Gaps = 7/128 (5%)

Query: 2   KQCIIFIINIVVVFFIDVMGFFILMK--CGADPFYSRIFSIAVAFLVTWIPSRLFIFLKL 59
           ++   F       F +D + F+ +M          ++I    VA L +W+ +R + F   
Sbjct: 18  REVAKFGTVGAAAFVVDSLVFWWMMTGPLEGSNVKAKIVGGVVATLFSWVANRYWTFRDK 77

Query: 60  RRK-SFLETVRYGVMYFMLSILNYAFYVKLLLTFQGLQP----LLATVLSAVSSMLFVFL 114
           R      E V + +M  +   +                P    +   V+      +F + 
Sbjct: 78  RSSNKTRELVMFLIMNAIGLGIQAGCVAIAQYLLGVTDPTGLFIAGNVIGLFFGTVFRYF 137

Query: 115 LYIRFMTR 122
            Y  ++ +
Sbjct: 138 AYRFWVFK 145



 Score = 38.3 bits (88), Expect = 0.34,   Method: Composition-based stats.
 Identities = 7/60 (11%), Positives = 24/60 (40%)

Query: 63  SFLETVRYGVMYFMLSILNYAFYVKLLLTFQGLQPLLATVLSAVSSMLFVFLLYIRFMTR 122
            + E  ++G +     +++   +  ++        + A ++  V + LF ++    +  R
Sbjct: 16  LWREVAKFGTVGAAAFVVDSLVFWWMMTGPLEGSNVKAKIVGGVVATLFSWVANRYWTFR 75


>gi|304319904|ref|YP_003853547.1| putative dolichol-phosphate mannosyltransferase [Parvularcula
           bermudensis HTCC2503]
 gi|303298807|gb|ADM08406.1| putative dolichol-phosphate mannosyltransferase [Parvularcula
           bermudensis HTCC2503]
          Length = 390

 Score = 75.3 bits (184), Expect = 3e-12,   Method: Composition-based stats.
 Identities = 12/125 (9%), Positives = 36/125 (28%), Gaps = 5/125 (4%)

Query: 4   CIIFIINIVVVFFIDVMGFFILMKC-GADPFYSRIFSIAVAFLVTWIPSRLFIFLKLRRK 62
            ++F     +     +     L    G     +++ +   A    ++ +    +   R +
Sbjct: 267 FVMFCAVGSIGILAHLAVLSALYMLAGVSFLTAQLIATVAAMTSNFVLNNELTYRDRRLR 326

Query: 63  SFL---ETVRYGVMYFMLSILNYAFYVKLLLTFQGLQPLLATVLSAVSSMLFVFLLYIRF 119
            +        + +   + +  N       +    G    L+ V      ++F ++     
Sbjct: 327 GWRLVPGWASFCLASSIGATANVGVASW-IHNGGGTAWWLSAVAGIAVGVVFNYVATAMA 385

Query: 120 MTRRV 124
             RR 
Sbjct: 386 TWRRP 390


>gi|311112185|ref|YP_003983407.1| GtrA family protein [Rothia dentocariosa ATCC 17931]
 gi|310943679|gb|ADP39973.1| GtrA family protein [Rothia dentocariosa ATCC 17931]
          Length = 371

 Score = 74.9 bits (183), Expect = 3e-12,   Method: Composition-based stats.
 Identities = 21/119 (17%), Positives = 51/119 (42%), Gaps = 3/119 (2%)

Query: 4   CIIFIINIVVVFFIDVMGFFILMKCGADPFYSRIFSIAVAFLVTWIPSR-LFIFLKLRRK 62
            + F+++    F +D +  F L+  G     + + +  ++ L  +  +R L      R  
Sbjct: 232 LLGFLVSSCTGFIVDALALFALVGVGFALLPAIVLARIISALTNFSINRILMNDGADRPS 291

Query: 63  SFLETVRYGVMYFMLSILNYAFYVKLLLTFQGLQPLLATVLSAVSSMLFVFLLYIRFMT 121
             +   RY ++   + + N A      LT  G+  ++A +L+ ++ +   F +  R++ 
Sbjct: 292 RAVSLGRYAILAVGILLANAALMEV--LTAFGVVLIVAKILTELTLIPLSFAVQRRWVF 348


>gi|75676380|ref|YP_318801.1| glycosyl transferase family protein [Nitrobacter winogradskyi
           Nb-255]
 gi|74421250|gb|ABA05449.1| glycosyl transferase, family 2 [Nitrobacter winogradskyi Nb-255]
          Length = 376

 Score = 74.9 bits (183), Expect = 3e-12,   Method: Composition-based stats.
 Identities = 16/125 (12%), Positives = 42/125 (33%), Gaps = 6/125 (4%)

Query: 3   QCIIFIINIVVVFFIDV-MGFFILMKCGADPFYSRIFSIAVAFLVTWIPSRLFIFLKLRR 61
           + ++F +   V   +     F  L        +S+ F   +A    ++ +    +   R 
Sbjct: 253 RFLLFALVGSVGVVVHFVGLFVALEVLAWPFPHSQAFGAILAMTSNFLLNNFLTYRDQRL 312

Query: 62  KSF---LETVRYGVMYFMLSILNYAFYVKLLLTFQGLQPLLATVLSAVSSMLFVFLLYIR 118
           K        + + ++  +  + N      +          LA    A+  +++ + +   
Sbjct: 313 KGLGIVRGLLIFYLVCSVGLLANVGVAFSVYDQKPIW--WLAGAAGALMGVVWNYAVSSL 370

Query: 119 FMTRR 123
           F+ RR
Sbjct: 371 FVWRR 375


>gi|119488429|ref|ZP_01621602.1| hypothetical protein L8106_23665 [Lyngbya sp. PCC 8106]
 gi|119455240|gb|EAW36380.1| hypothetical protein L8106_23665 [Lyngbya sp. PCC 8106]
          Length = 623

 Score = 74.9 bits (183), Expect = 3e-12,   Method: Composition-based stats.
 Identities = 20/129 (15%), Positives = 44/129 (34%), Gaps = 1/129 (0%)

Query: 1   MKQCIIFIINIVVVFFIDVMGFFILMKCGADPFYSRIFSIAVAFLVTWIPSRLFIFLKLR 60
           ++Q   ++        +DV+ F IL + G    Y+   S        +  SR F+F    
Sbjct: 490 LQQFGAYLFTGGTATVVDVLVFSILTQAGLWYVYALGISWFFGLSTNFWLSRRFVFGIYW 549

Query: 61  RKSFLETVRYGVMYFMLSILNYAFYVKLLLTFQGLQPLLATVLSAVSSMLFVFLLYIRFM 120
              +++   +  +     + N      L+       P  A ++S+    +  F  +  + 
Sbjct: 550 NNWWIQYAVFASVALNSLLANLGLLQLLINEV-DWNPTFARLVSSACVAMISFTGHKLYS 608

Query: 121 TRRVYFIKK 129
             +     K
Sbjct: 609 FSQPQSASK 617


>gi|312140717|ref|YP_004008053.1| gtra-like protein [Rhodococcus equi 103S]
 gi|325675644|ref|ZP_08155328.1| GtrA family protein [Rhodococcus equi ATCC 33707]
 gi|311890056|emb|CBH49374.1| putative GtrA-like protein [Rhodococcus equi 103S]
 gi|325553615|gb|EGD23293.1| GtrA family protein [Rhodococcus equi ATCC 33707]
          Length = 182

 Score = 74.9 bits (183), Expect = 3e-12,   Method: Composition-based stats.
 Identities = 25/133 (18%), Positives = 52/133 (39%), Gaps = 14/133 (10%)

Query: 3   QCIIFIINIVVVFFIDVMGFFIL--MKCGADPFYSRIFSIAVAFLVTWIPSRLFIFLKL- 59
           + I F I       +D+  F+ L        P  ++IFS  VA ++++I +R + F    
Sbjct: 24  ELIKFAIVGGTTMVVDLAIFYSLSLTILEQKPVVAKIFSGVVATILSYILNREWSFKHRG 83

Query: 60  RRKSFLETVRYGVMYFMLSILNYAFYV-----------KLLLTFQGLQPLLATVLSAVSS 108
            R+   E + +  +  +  I+  A                  T   +  +L  ++  +  
Sbjct: 84  GRERHHEALLFFTISGIGVIIAAAPLWIANNVFDIRASASFTTVVIVDFILNYIIGNLLQ 143

Query: 109 MLFVFLLYIRFMT 121
           M+F F  + R++ 
Sbjct: 144 MIFRFWSFRRWVF 156



 Score = 38.3 bits (88), Expect = 0.35,   Method: Composition-based stats.
 Identities = 10/60 (16%), Positives = 29/60 (48%)

Query: 63  SFLETVRYGVMYFMLSILNYAFYVKLLLTFQGLQPLLATVLSAVSSMLFVFLLYIRFMTR 122
              E +++ ++     +++ A +  L LT    +P++A + S V + +  ++L   +  +
Sbjct: 21  RHHELIKFAIVGGTTMVVDLAIFYSLSLTILEQKPVVAKIFSGVVATILSYILNREWSFK 80


>gi|261420250|ref|YP_003253932.1| GtrA family protein [Geobacillus sp. Y412MC61]
 gi|319767060|ref|YP_004132561.1| GtrA family protein [Geobacillus sp. Y412MC52]
 gi|261376707|gb|ACX79450.1| GtrA family protein [Geobacillus sp. Y412MC61]
 gi|317111926|gb|ADU94418.1| GtrA family protein [Geobacillus sp. Y412MC52]
          Length = 135

 Score = 74.9 bits (183), Expect = 3e-12,   Method: Composition-based stats.
 Identities = 23/118 (19%), Positives = 48/118 (40%), Gaps = 3/118 (2%)

Query: 4   CIIFIINIVVVFFIDVMGFFILMKCGADPFYSRIFSIAVAFLVTWIPSRLFIFLKLRRKS 63
              F I  V    +D   FF+L   GA    +++ S       ++I +RL+ F   R+ +
Sbjct: 15  VWRFAIVGVSNTAVDFAVFFLLTAAGAPAAAAQVVSYGAGMANSYIWNRLWTFQVKRKAN 74

Query: 64  FLETVRYGVMYFMLSILNYAFYVKLLLTFQGLQPLLATVLSAVSSMLFVFLLYIRFMT 121
             E +R+ V+  +   ++    +   L        LA + + ++ M   F+    ++ 
Sbjct: 75  IGELLRFLVVNGLSLGVSLGVLLAGELFTPL---WLAKMAATIAGMAVNFIGSRYWVF 129



 Score = 34.1 bits (77), Expect = 6.7,   Method: Composition-based stats.
 Identities = 7/62 (11%), Positives = 27/62 (43%), Gaps = 1/62 (1%)

Query: 1   MKQCIIFIINIVVVFFIDVMGFFILMKCGADPFYSRIFSIAVAFLVTWIPSRLFIFLKLR 60
           + + + F++   +   + +    +  +     + +++ +      V +I SR ++F++  
Sbjct: 75  IGELLRFLVVNGLSLGVSLGVL-LAGELFTPLWLAKMAATIAGMAVNFIGSRYWVFVEKN 133

Query: 61  RK 62
            K
Sbjct: 134 EK 135


>gi|258654061|ref|YP_003203217.1| GtrA family protein [Nakamurella multipartita DSM 44233]
 gi|258557286|gb|ACV80228.1| GtrA family protein [Nakamurella multipartita DSM 44233]
          Length = 163

 Score = 74.9 bits (183), Expect = 3e-12,   Method: Composition-based stats.
 Identities = 29/127 (22%), Positives = 50/127 (39%), Gaps = 11/127 (8%)

Query: 6   IFIINIVVVFFIDVMGFFILMKCGADPFYS------RIFSIAVAFLVTWIPSRLFIFLKL 59
            F +     + +DV  F +L   G+ P  +      +I S  VA +V W+ +R + F   
Sbjct: 28  KFGVVGATAYVVDVGLFNLLSYVGSPPLLAGQPLLAKIISTVVATVVAWLGNRYWTFRHH 87

Query: 60  RRK-SFLETVRYGVMYFMLSILNYAFYVKLLL----TFQGLQPLLATVLSAVSSMLFVFL 114
           RR  +  E V Y +M  +  ++  +           T      + A V+  V    F F 
Sbjct: 88  RRPDAGREFVLYLIMCTVGLLIALSCLWISHYVLGFTSALADNISANVVGLVLGTTFRFW 147

Query: 115 LYIRFMT 121
            Y +F+ 
Sbjct: 148 AYKKFVF 154


>gi|218291142|ref|ZP_03495157.1| glycosyl transferase family 2 [Alicyclobacillus acidocaldarius
           LAA1]
 gi|218238953|gb|EED06161.1| glycosyl transferase family 2 [Alicyclobacillus acidocaldarius
           LAA1]
          Length = 384

 Score = 74.9 bits (183), Expect = 3e-12,   Method: Composition-based stats.
 Identities = 12/126 (9%), Positives = 38/126 (30%), Gaps = 5/126 (3%)

Query: 2   KQCIIFIINIVVVFFIDVMGFFILMK-CGADPFYSRIFSIAVAFLVTWIPSRLFIFLK-- 58
           ++  +F +  +    ++     +L          + + +  VA L  +  +    +    
Sbjct: 234 RRFFLFCLIGLSGVIVNEAVLSLLWYGFHLRDTVASVVASFVAMLNNYFWNDRVTWKSEF 293

Query: 59  LRRKSFLETVRYGVMYFMLSILNYAFYVKLLLTFQGLQPLLATVLSAVSSMLFVFLLYIR 118
             R    +   +  + F+   +             G+   +   +  V S  + + +  R
Sbjct: 294 SGRGWGWKLPVFVGISFVGIAITTLVMRVC--EGFGVPVPVGQAIGIVVSTGWSYWMNSR 351

Query: 119 FMTRRV 124
              R +
Sbjct: 352 VTWRNI 357



 Score = 37.2 bits (85), Expect = 0.70,   Method: Composition-based stats.
 Identities = 12/77 (15%), Positives = 28/77 (36%), Gaps = 3/77 (3%)

Query: 46  VTWIPSRLFIFLKLRRKSFLETVRYGVMYFMLSILNYAFYVKLLLTFQGLQPLLATVLSA 105
             +   R  + L  +         + ++     I+N A     L     L+  +A+V+++
Sbjct: 217 WNYF--RHLVRLVSQSPPDRRFFLFCLIGLSGVIVNEAVLSL-LWYGFHLRDTVASVVAS 273

Query: 106 VSSMLFVFLLYIRFMTR 122
             +ML  +    R   +
Sbjct: 274 FVAMLNNYFWNDRVTWK 290



 Score = 36.0 bits (82), Expect = 1.7,   Method: Composition-based stats.
 Identities = 8/62 (12%), Positives = 20/62 (32%)

Query: 7   FIINIVVVFFIDVMGFFILMKCGADPFYSRIFSIAVAFLVTWIPSRLFIFLKLRRKSFLE 66
           F+    V   I  +   +    G      +   I V+   ++  +    +  + R+S   
Sbjct: 305 FVGISFVGIAITTLVMRVCEGFGVPVPVGQAIGIVVSTGWSYWMNSRVTWRNIERESRGN 364

Query: 67  TV 68
            +
Sbjct: 365 AI 366


>gi|239981819|ref|ZP_04704343.1| integral membrane protein [Streptomyces albus J1074]
          Length = 182

 Score = 74.9 bits (183), Expect = 3e-12,   Method: Composition-based stats.
 Identities = 15/122 (12%), Positives = 36/122 (29%), Gaps = 5/122 (4%)

Query: 6   IFIINIVVVFFIDVMGFFILMKCGADPFY-SRIFSIAVAFLVTWIPSRLFIFLKLRR-KS 63
            F         +++  F ++          + + +  VA +  ++  R F +    +   
Sbjct: 33  KFGAVGGAGVLVNLAVFNLVRHLTELQVVRASVLATVVAIVFNYLGFRYFTYRDRDKGGR 92

Query: 64  FLETVRYGVMYFMLSILNYAFYVKLLLTFQGLQPLLATVL---SAVSSMLFVFLLYIRFM 120
             E   +     +  ++                 L + VL       + LF F  Y  ++
Sbjct: 93  TREMSLFLAFSVIGLVIENGILYTGTYGLGFDGRLESNVLKFAGIGVATLFRFWSYRTWV 152

Query: 121 TR 122
            R
Sbjct: 153 FR 154


>gi|78213877|ref|YP_382656.1| putative glycosyl transferase [Synechococcus sp. CC9605]
 gi|78198336|gb|ABB36101.1| putative glycosyl transferase [Synechococcus sp. CC9605]
          Length = 376

 Score = 74.9 bits (183), Expect = 4e-12,   Method: Composition-based stats.
 Identities = 15/124 (12%), Positives = 42/124 (33%), Gaps = 5/124 (4%)

Query: 2   KQCIIFIINIVVVFFIDVMGFFILMKCGA-DPFYSRIFSIAVAFLVTWIPSRLFIFLKLR 60
           ++ I F +       + ++   +LM         +   ++  A    ++ +    F   R
Sbjct: 251 RRAISFGLVGASGVVVQLLSTALLMGLFNLAFQQALPVAVITAASSNYLVNNALTFRDRR 310

Query: 61  ---RKSFLETVRYGVMYFMLSILNYAFYVKLLLTFQGLQPLLATVLSAVSSMLFVFLLYI 117
              R+     +++ ++  + ++ N         T      L A +   V   ++ +    
Sbjct: 311 QSGRQLIRGLLKFLLVASLPALANVGL-ATSFYTLIQAHALWAQLAGIVVVYVWNYAASS 369

Query: 118 RFMT 121
           RF+ 
Sbjct: 370 RFVW 373


>gi|85715609|ref|ZP_01046589.1| glycosyl transferase, family 2 [Nitrobacter sp. Nb-311A]
 gi|85697548|gb|EAQ35425.1| glycosyl transferase, family 2 [Nitrobacter sp. Nb-311A]
          Length = 376

 Score = 74.9 bits (183), Expect = 4e-12,   Method: Composition-based stats.
 Identities = 17/125 (13%), Positives = 43/125 (34%), Gaps = 6/125 (4%)

Query: 3   QCIIFIINIVVVFFIDV-MGFFILMKCGADPFYSRIFSIAVAFLVTWIPSRLFIFLKLRR 61
           + ++F +   V   +     F  L        +S+ F   +A    ++ + L  +   R 
Sbjct: 253 RFLLFALVGSVGVVVHFAGLFVALEVLRWPFPHSQAFGAILAMTSNFLLNNLLTYRDQRL 312

Query: 62  KS---FLETVRYGVMYFMLSILNYAFYVKLLLTFQGLQPLLATVLSAVSSMLFVFLLYIR 118
           K        + + ++  +  + N      +          LA    A+  +++ + +   
Sbjct: 313 KGLGILRGLLVFYIVCSVGLLANVGVAFSVYDQKPIW--WLAGAAGALMGVVWNYAVSSL 370

Query: 119 FMTRR 123
           F+ RR
Sbjct: 371 FVWRR 375


>gi|159036462|ref|YP_001535715.1| GtrA family protein [Salinispora arenicola CNS-205]
 gi|157915297|gb|ABV96724.1| GtrA family protein [Salinispora arenicola CNS-205]
          Length = 231

 Score = 74.5 bits (182), Expect = 4e-12,   Method: Composition-based stats.
 Identities = 18/128 (14%), Positives = 40/128 (31%), Gaps = 6/128 (4%)

Query: 1   MKQCIIFIINIVVVFFIDVMGFFIL--MKCGADPFYSRIFSIAVAFLVTWIPSRLFIFLK 58
           + +   F I   V   I+   F  L           +   +   A + +++ +R + +  
Sbjct: 15  VHEAFKFGIVGGVNTVINYAVFNALALTVFQDGQLKATAVATITATITSYLMNRHWTYRD 74

Query: 59  LRRKS-FLETVRYGVMYFMLSILNYAFYVKLLLTFQGLQPL---LATVLSAVSSMLFVFL 114
             + +   E   + +      ++                 L   LA  L  + + LF F 
Sbjct: 75  RPKTAIRREYTLFFLFNGAGLLIELGVLAAAKYGLGVTSLLALNLAKTLGVLLATLFRFW 134

Query: 115 LYIRFMTR 122
            Y  F+ +
Sbjct: 135 SYRTFVFQ 142


>gi|111220680|ref|YP_711474.1| hypothetical protein FRAAL1220 [Frankia alni ACN14a]
 gi|111148212|emb|CAJ59881.1| hypothetical protein; putative membrane protein [Frankia alni
           ACN14a]
          Length = 160

 Score = 74.5 bits (182), Expect = 4e-12,   Method: Composition-based stats.
 Identities = 21/127 (16%), Positives = 44/127 (34%), Gaps = 6/127 (4%)

Query: 1   MKQCIIFIINIVVVFFIDVMGFFIL-MKCGADPFYSRIFSIAVAFLVTWIPSRLFIFLKL 59
           + +   F +   V + ID +   +     G  P  ++  S  VA   ++I +R + F   
Sbjct: 5   IHEMGKFGLVGGVCYAIDFLVSNLCHTLLGMGPLSAKTVSTVVAATFSYIGNRQWSFNHR 64

Query: 60  -RRKSFLETVRYGVMYFMLSILNYAFY----VKLLLTFQGLQPLLATVLSAVSSMLFVFL 114
            R     E   + ++  +  ++           L L       L   V+      +F F 
Sbjct: 65  ARTGLRREYTLFVILNTVGLLIALGCLGFARYVLDLRGVLAFNLFGNVIGTGLGTVFRFW 124

Query: 115 LYIRFMT 121
            Y +++ 
Sbjct: 125 AYKKWVF 131


>gi|316932931|ref|YP_004107913.1| Dolichyl-phosphate beta-D-mannosyltransferase [Rhodopseudomonas
           palustris DX-1]
 gi|315600645|gb|ADU43180.1| Dolichyl-phosphate beta-D-mannosyltransferase [Rhodopseudomonas
           palustris DX-1]
          Length = 378

 Score = 74.5 bits (182), Expect = 4e-12,   Method: Composition-based stats.
 Identities = 16/125 (12%), Positives = 48/125 (38%), Gaps = 6/125 (4%)

Query: 3   QCIIFIINIVVVFFIDVMGFFILMKCGADPFY-SRIFSIAVAFLVTWIPSRLFIFLKLRR 61
           + I+F +       +  +  ++++K    PF  ++  +  VA    +I +    +   R 
Sbjct: 255 RFILFALVGSTGVVVHFVTLYVVLKLFEQPFAEAQGIAALVAMTSNFILNNFLTYRDQRL 314

Query: 62  KS---FLETVRYGVMYFMLSILNYAFYVKLLLTFQGLQPLLATVLSAVSSMLFVFLLYIR 118
           K        + + ++  +  + N        +  + +   LA    A+  +++ + +   
Sbjct: 315 KGFAILRGLLLFYLVCSVGLLANVGV--AFAVYNEHITWWLAGAAGALMGVVWNYAMSGL 372

Query: 119 FMTRR 123
           F+ R+
Sbjct: 373 FVWRK 377



 Score = 34.9 bits (79), Expect = 3.6,   Method: Composition-based stats.
 Identities = 8/59 (13%), Positives = 22/59 (37%)

Query: 1   MKQCIIFIINIVVVFFIDVMGFFILMKCGADPFYSRIFSIAVAFLVTWIPSRLFIFLKL 59
           ++  ++F +   V    +V   F +       + +      +  +  +  S LF++ K 
Sbjct: 320 LRGLLLFYLVCSVGLLANVGVAFAVYNEHITWWLAGAAGALMGVVWNYAMSGLFVWRKR 378


>gi|300742268|ref|ZP_07072289.1| GtrA family protein [Rothia dentocariosa M567]
 gi|300381453|gb|EFJ78015.1| GtrA family protein [Rothia dentocariosa M567]
          Length = 371

 Score = 74.5 bits (182), Expect = 4e-12,   Method: Composition-based stats.
 Identities = 21/119 (17%), Positives = 51/119 (42%), Gaps = 3/119 (2%)

Query: 4   CIIFIINIVVVFFIDVMGFFILMKCGADPFYSRIFSIAVAFLVTWIPSR-LFIFLKLRRK 62
            + F+++    F +D +  F L+  G     + + +  ++ L  +  +R L      R  
Sbjct: 232 LLGFLVSSCTGFIVDALALFALVGVGFALLPAIVLARIISALTNFSINRILMNDGADRPS 291

Query: 63  SFLETVRYGVMYFMLSILNYAFYVKLLLTFQGLQPLLATVLSAVSSMLFVFLLYIRFMT 121
             +   RY ++   + + N A      LT  G+  ++A +L+ ++ +   F +  R++ 
Sbjct: 292 RAVSLGRYAILAVGILLANAALMEV--LTAFGVVLIVAKILTELTLIPLSFAVQRRWVF 348


>gi|90423156|ref|YP_531526.1| dolichyl-phosphate beta-D-mannosyltransferase [Rhodopseudomonas
           palustris BisB18]
 gi|90105170|gb|ABD87207.1| Dolichyl-phosphate beta-D-mannosyltransferase [Rhodopseudomonas
           palustris BisB18]
          Length = 377

 Score = 74.5 bits (182), Expect = 4e-12,   Method: Composition-based stats.
 Identities = 13/125 (10%), Positives = 47/125 (37%), Gaps = 6/125 (4%)

Query: 3   QCIIFIINIVVVFFIDVMGFFILMKCGADPFY-SRIFSIAVAFLVTWIPSRLFIFLKLRR 61
           + ++F +   +   +   G +++++    PF  ++  +  +A    ++ +    +   R 
Sbjct: 254 RFLLFAMVGSIGLLVHFAGLYVVLELLDVPFAEAQGIAALLAMTSNFLLNNFLTYRDQRL 313

Query: 62  KSF---LETVRYGVMYFMLSILNYAFYVKLLLTFQGLQPLLATVLSAVSSMLFVFLLYIR 118
           K        + + ++  +  + N      +          LA    A+  +++ + +   
Sbjct: 314 KGARILRGLLLFYLVCSVGLLANVGVAFSVYNQQPIW--WLAGAAGALMGVVWNYAMSGL 371

Query: 119 FMTRR 123
           F+ R+
Sbjct: 372 FVWRK 376



 Score = 34.5 bits (78), Expect = 4.4,   Method: Composition-based stats.
 Identities = 8/59 (13%), Positives = 22/59 (37%)

Query: 1   MKQCIIFIINIVVVFFIDVMGFFILMKCGADPFYSRIFSIAVAFLVTWIPSRLFIFLKL 59
           ++  ++F +   V    +V   F +       + +      +  +  +  S LF++ K 
Sbjct: 319 LRGLLLFYLVCSVGLLANVGVAFSVYNQQPIWWLAGAAGALMGVVWNYAMSGLFVWRKR 377


>gi|302347995|ref|YP_003815633.1| Dolichol-phosphate mannosyltransferase [Acidilobus saccharovorans
           345-15]
 gi|302328407|gb|ADL18602.1| Dolichol-phosphate mannosyltransferase [Acidilobus saccharovorans
           345-15]
          Length = 363

 Score = 74.5 bits (182), Expect = 4e-12,   Method: Composition-based stats.
 Identities = 19/119 (15%), Positives = 46/119 (38%), Gaps = 1/119 (0%)

Query: 5   IIFIINIVVVFFIDVMGFFILMKCGADPFYSRIFSIAVAFLVTWIPSRLFIFLKLRRKSF 64
           I F +   +   ++      L+    +  +S +  I V+ L  ++ + L+ F   R   +
Sbjct: 245 IKFAVVGAIGTGVNEGVAAALL-LVTNYTFSYVGGIEVSILSNFMLNDLWTFRDRRPGRW 303

Query: 65  LETVRYGVMYFMLSILNYAFYVKLLLTFQGLQPLLATVLSAVSSMLFVFLLYIRFMTRR 123
              +    +    + L   F  +L+     + PLL   +  ++  +  + L  R + +R
Sbjct: 304 YSRLVRYHLMVAPAGLTIFFVAELVTRLTHVNPLLGLFVGILAGFVVNYTLSSRKVWKR 362


>gi|282866272|ref|ZP_06275318.1| GtrA family protein [Streptomyces sp. ACTE]
 gi|282558858|gb|EFB64414.1| GtrA family protein [Streptomyces sp. ACTE]
          Length = 173

 Score = 74.5 bits (182), Expect = 4e-12,   Method: Composition-based stats.
 Identities = 16/126 (12%), Positives = 42/126 (33%), Gaps = 5/126 (3%)

Query: 2   KQCIIFIINIVVVFFIDVMGFFILMKCGADPFY-SRIFSIAVAFLVTWIPSRLFIFLKLR 60
           ++   F     +   +++    ++ +    P   + +    VA L  +I  R + +    
Sbjct: 16  REVAKFGAVGALGLVVNIAVSNLIWRTTDIPVVRAGLMGTVVAILFNYIGFRYWTYRDRD 75

Query: 61  RK-SFLETVRYGVMYFMLSILNYAFYVKLLLTFQGLQPLLA---TVLSAVSSMLFVFLLY 116
           +     E   + +     +++           F    P+ +    V+    + LF F  Y
Sbjct: 76  KSGRTRELTLFLLFSAAGAVIETGVLYLATYGFGWNSPVQSNVFKVVGISIATLFRFWSY 135

Query: 117 IRFMTR 122
             ++ R
Sbjct: 136 RTWVFR 141


>gi|30249616|ref|NP_841686.1| dolichol monophosphate mannose synthase [Nitrosomonas europaea ATCC
           19718]
 gi|30138979|emb|CAD85563.1| possible dolichol monophosphate mannose synthase [Nitrosomonas
           europaea ATCC 19718]
          Length = 892

 Score = 74.5 bits (182), Expect = 4e-12,   Method: Composition-based stats.
 Identities = 20/120 (16%), Positives = 44/120 (36%), Gaps = 3/120 (2%)

Query: 6   IFIINIVVVFFIDVMGFFILMKCGADPFYSRIFSIAVAFLVTWIPSRLFIFL--KLRRKS 63
            F I   +  F+DV+ F  +   GA    + I S   A    +  +  + F         
Sbjct: 235 RFAIVGFLGVFVDVLIFQWMTGHGASLASAHISSFIAAASFNYTINSKWSFRLHHAGHLH 294

Query: 64  FLETVRYGVMYFMLSILNYAFYVKLLLTFQGLQPLLATVLSAVSSMLFVFLLYIRFMTRR 123
           + + +R+  +     +L  A     L+   G+    A   + +++ +  +L    ++  R
Sbjct: 295 WQQFIRFLTVGVFALLLRGAIL-AWLVYTWGISAEWAIFPAILTTAMVNYLGSAFYVFPR 353



 Score = 33.7 bits (76), Expect = 8.4,   Method: Composition-based stats.
 Identities = 10/62 (16%), Positives = 23/62 (37%), Gaps = 1/62 (1%)

Query: 2   KQCIIFIINIVVVFFIDVMGFFILMK-CGADPFYSRIFSIAVAFLVTWIPSRLFIFLKLR 60
           +Q I F+   V    +       L+   G    ++   +I    +V ++ S  ++F +  
Sbjct: 296 QQFIRFLTVGVFALLLRGAILAWLVYTWGISAEWAIFPAILTTAMVNYLGSAFYVFPRTE 355

Query: 61  RK 62
             
Sbjct: 356 PP 357


>gi|92118111|ref|YP_577840.1| dolichyl-phosphate beta-D-mannosyltransferase [Nitrobacter
           hamburgensis X14]
 gi|91801005|gb|ABE63380.1| Dolichyl-phosphate beta-D-mannosyltransferase [Nitrobacter
           hamburgensis X14]
          Length = 376

 Score = 74.5 bits (182), Expect = 5e-12,   Method: Composition-based stats.
 Identities = 16/125 (12%), Positives = 42/125 (33%), Gaps = 6/125 (4%)

Query: 3   QCIIFIINIVVVFFIDV-MGFFILMKCGADPFYSRIFSIAVAFLVTWIPSRLFIFLKLRR 61
           + ++F +   V   +     F  L        +S+ F   +A    ++ +    +   R 
Sbjct: 253 RFLLFALVGSVGVVVHFAGLFVALDALRWPFPHSQAFGAVLAMTSNFLLNNFLTYRDQRL 312

Query: 62  KS---FLETVRYGVMYFMLSILNYAFYVKLLLTFQGLQPLLATVLSAVSSMLFVFLLYIR 118
           K        + + ++  +  + N      +          LA    A+  +++ + +   
Sbjct: 313 KGIGILRGLLVFYLVCSVGLLANVGVAFSVYNQEPIW--WLAGAAGALMGVVWNYAVSSL 370

Query: 119 FMTRR 123
           F+ RR
Sbjct: 371 FVWRR 375


>gi|289641180|ref|ZP_06473347.1| glycosyl transferase family 2 [Frankia symbiont of Datisca
           glomerata]
 gi|289508942|gb|EFD29874.1| glycosyl transferase family 2 [Frankia symbiont of Datisca
           glomerata]
          Length = 518

 Score = 74.5 bits (182), Expect = 5e-12,   Method: Composition-based stats.
 Identities = 20/124 (16%), Positives = 44/124 (35%), Gaps = 4/124 (3%)

Query: 2   KQCIIFIINIVVVFFIDVMGFFILMKCGADPFYSRIFSIAVAFLVTWIPSRLFIFLKLRR 61
           +Q   F    V      V+ + +L + GA  F +   ++    +     +R   F ++  
Sbjct: 375 RQLGTFAAIGVCSTLAYVVAYALLREGGASSFAANFIALLGTAVGNTWANRRLTFGQVGS 434

Query: 62  KSFLETV----RYGVMYFMLSILNYAFYVKLLLTFQGLQPLLATVLSAVSSMLFVFLLYI 117
           +  L          V+   +S         L  +   L  ++  +LS V + +  F+L  
Sbjct: 435 EEALRQFAESGVVFVLGLAVSSAGLGLLHALWSSSGVLVEIVTVLLSGVLATVVRFVLMR 494

Query: 118 RFMT 121
            ++ 
Sbjct: 495 AWVF 498



 Score = 34.1 bits (77), Expect = 6.7,   Method: Composition-based stats.
 Identities = 10/70 (14%), Positives = 25/70 (35%), Gaps = 5/70 (7%)

Query: 1   MKQCIIFIINIVVVFFIDVMGFFILMKCGAD-----PFYSRIFSIAVAFLVTWIPSRLFI 55
           ++Q     +  V+   +   G  +L    +         + + S  +A +V ++  R ++
Sbjct: 438 LRQFAESGVVFVLGLAVSSAGLGLLHALWSSSGVLVEIVTVLLSGVLATVVRFVLMRAWV 497

Query: 56  FLKLRRKSFL 65
           F   R     
Sbjct: 498 FHPARSPRPR 507


>gi|257054224|ref|YP_003132056.1| hypothetical protein Svir_01410 [Saccharomonospora viridis DSM
           43017]
 gi|256584096|gb|ACU95229.1| predicted membrane protein [Saccharomonospora viridis DSM 43017]
          Length = 150

 Score = 74.5 bits (182), Expect = 5e-12,   Method: Composition-based stats.
 Identities = 18/124 (14%), Positives = 49/124 (39%), Gaps = 2/124 (1%)

Query: 1   MKQCIIFIINIVVVFFIDVMGFFILMKCGADPFYSRIFSIAVAFLVTWIPSRLFIFLKLR 60
           + Q + F++       +D   +++L++ GA    ++  S        +  +R F F   +
Sbjct: 23  LAQILRFVLIGGFCALVDSGLYWLLLQAGAWVHLAKAISFIAGTTTAYFLNRRFTFTAAQ 82

Query: 61  RKSFLETVRYGVMYFMLSILNYAFYVKLLLTFQ--GLQPLLATVLSAVSSMLFVFLLYIR 118
           +    +   + ++Y +   +N       L      G +  LA +++  ++    F++   
Sbjct: 83  KGGAGQLGGFMLLYTVTFFVNVGTNALALHLLPELGWRIALAWIIAQGTATTINFIMLKW 142

Query: 119 FMTR 122
            + R
Sbjct: 143 VVFR 146


>gi|284929747|ref|YP_003422269.1| hypothetical protein UCYN_12200 [cyanobacterium UCYN-A]
 gi|284810191|gb|ADB95888.1| predicted membrane protein [cyanobacterium UCYN-A]
          Length = 398

 Score = 74.5 bits (182), Expect = 5e-12,   Method: Composition-based stats.
 Identities = 19/129 (14%), Positives = 44/129 (34%), Gaps = 10/129 (7%)

Query: 3   QCIIFIINIVVVFFIDVMGFFILM---KCGADPFYSRIFSIAVAFLVTWIPSRLFIFLK- 58
           +   F +  +    +D+   ++L      G     S+I +  +A +  +I +  + F   
Sbjct: 265 RFFQFCLVGLGGMIVDMGILYMLSDNNTLGLPLTRSKIVAAELAIINNFIWNDFWTFRDI 324

Query: 59  -----LRRKSFLETVRYGVMYFMLSILNYAFYVKLLLTFQGLQPLLATVLSAVSSMLFVF 113
                 +R      V++ ++      LN         TF   +   A   + +   L+ F
Sbjct: 325 TYLQPGKRLRIRRFVKFNIICLTGLTLNIFLLNLFFNTFNFNRYF-ANFFAIIGVTLWNF 383

Query: 114 LLYIRFMTR 122
              ++   R
Sbjct: 384 WFNLKLSWR 392



 Score = 38.3 bits (88), Expect = 0.36,   Method: Composition-based stats.
 Identities = 9/75 (12%), Positives = 31/75 (41%), Gaps = 1/75 (1%)

Query: 55  IFLKLRRKSFLETVRYGVMYFMLSILNYA-FYVKLLLTFQGLQPLLATVLSAVSSMLFVF 113
             ++LR        ++ ++     I++    Y+       GL    + +++A  +++  F
Sbjct: 254 HLVRLRLSLSTRFFQFCLVGLGGMIVDMGILYMLSDNNTLGLPLTRSKIVAAELAIINNF 313

Query: 114 LLYIRFMTRRVYFIK 128
           +    +  R + +++
Sbjct: 314 IWNDFWTFRDITYLQ 328


>gi|14590004|ref|NP_142068.1| dolichol-phosphate mannosyltransferase [Pyrococcus horikoshii OT3]
 gi|3256436|dbj|BAA29119.1| 353aa long hypothetical dolichol-phosphate mannosyltransferase
           [Pyrococcus horikoshii OT3]
          Length = 353

 Score = 74.2 bits (181), Expect = 5e-12,   Method: Composition-based stats.
 Identities = 20/123 (16%), Positives = 51/123 (41%), Gaps = 4/123 (3%)

Query: 1   MKQCIIFIINIVVVFFIDVMGFFILMKCGA-DPFYSRIFSIAVAFLVTWIPSRLFIFLKL 59
           + + + F I  +    ++    ++ +           I S  ++ L  ++ + L+ F  +
Sbjct: 231 VDRILKFSIVGLSGVGVNEGFLWLFVNFFHISKELGVIPSTELSILNNFLWNDLWTFKDI 290

Query: 60  RRKSFLE-TVRYGVMYFMLSILNYAFYVKLLLTFQGLQPLLATVLSAVSSMLFVFLLYIR 118
           ++ S +E   ++ V  F+ ++    F V  +L F G+  LLA +    +S +  ++    
Sbjct: 291 KKGSVIERLAKFHVAAFVGAVAQ--FLVYWILLFLGIHYLLANLFGIGASFVVRYIFNRH 348

Query: 119 FMT 121
              
Sbjct: 349 ITW 351


>gi|114330484|ref|YP_746706.1| dolichyl-phosphate beta-D-mannosyltransferase [Nitrosomonas
           eutropha C91]
 gi|114307498|gb|ABI58741.1| Dolichyl-phosphate beta-D-mannosyltransferase [Nitrosomonas
           eutropha C91]
          Length = 871

 Score = 74.2 bits (181), Expect = 5e-12,   Method: Composition-based stats.
 Identities = 17/122 (13%), Positives = 42/122 (34%), Gaps = 3/122 (2%)

Query: 6   IFIINIVVVFFIDVMGFFILMKCGADPFYSRIFSIAVAFLVTWIPSRLFIFL--KLRRKS 63
            F +   +  F+DV+ F  +   G     + I S   A    +  +  + F         
Sbjct: 235 RFAMVGFLGVFVDVLIFQWMTGQGISLATAHISSFIAAASFNYALNTKWSFRLQHSGHLH 294

Query: 64  FLETVRYGVMYFMLSILNYAFYVKLLLTFQGLQPLLATVLSAVSSMLFVFLLYIRFMTRR 123
           + +  R+ ++     +L  A     L+    +    A   + +++ +  +L    ++  R
Sbjct: 295 WSQFSRFLIVGIFAMLLRGAVL-AWLVYTWNISTEWAIFPAIIATAIVNYLGSAFYVFPR 353

Query: 124 VY 125
             
Sbjct: 354 TK 355



 Score = 34.1 bits (77), Expect = 6.1,   Method: Composition-based stats.
 Identities = 13/104 (12%), Positives = 35/104 (33%), Gaps = 5/104 (4%)

Query: 3   QCIIFIINIVVVFFIDVMGFFILMK-CGADPFYSRIFSIAVAFLVTWIPSRLFIFLKLRR 61
           Q   F+I  +    +       L+        ++   +I    +V ++ S  ++F + + 
Sbjct: 297 QFSRFLIVGIFAMLLRGAVLAWLVYTWNISTEWAIFPAIIATAIVNYLGSAFYVFPRTKP 356

Query: 62  K----SFLETVRYGVMYFMLSILNYAFYVKLLLTFQGLQPLLAT 101
                +       G++ F++ +      V  L+  +      A 
Sbjct: 357 AVSTDTRWRIAAVGIVCFVILLRLVYMSVAQLIPDEAYYWQYAQ 400


>gi|115523692|ref|YP_780603.1| dolichyl-phosphate beta-D-mannosyltransferase [Rhodopseudomonas
           palustris BisA53]
 gi|115517639|gb|ABJ05623.1| Dolichyl-phosphate beta-D-mannosyltransferase [Rhodopseudomonas
           palustris BisA53]
          Length = 377

 Score = 74.2 bits (181), Expect = 5e-12,   Method: Composition-based stats.
 Identities = 12/125 (9%), Positives = 40/125 (32%), Gaps = 6/125 (4%)

Query: 3   QCIIFIINIVVVFFIDV-MGFFILMKCGADPFYSRIFSIAVAFLVTWIPSRLFIFLKLRR 61
           + ++F +  ++   +     F  L         ++  +   A    ++ +    +   R 
Sbjct: 254 RFLLFAMVGLLGLVVHFVALFGALNVVALPFAEAQTIAAICAMTSNFLLNNFLTYRDQRL 313

Query: 62  KSF---LETVRYGVMYFMLSILNYAFYVKLLLTFQGLQPLLATVLSAVSSMLFVFLLYIR 118
           K        + + ++  +    N      +          LA    A+  +++ + +   
Sbjct: 314 KGAGILRGLLLFYLVCSVGLFANVGVAFSVYDQAPNW--WLAGAAGALMGVVWNYAMSGL 371

Query: 119 FMTRR 123
           F+ R+
Sbjct: 372 FVWRK 376



 Score = 34.5 bits (78), Expect = 5.6,   Method: Composition-based stats.
 Identities = 9/59 (15%), Positives = 24/59 (40%)

Query: 1   MKQCIIFIINIVVVFFIDVMGFFILMKCGADPFYSRIFSIAVAFLVTWIPSRLFIFLKL 59
           ++  ++F +   V  F +V   F +     + + +      +  +  +  S LF++ K 
Sbjct: 319 LRGLLLFYLVCSVGLFANVGVAFSVYDQAPNWWLAGAAGALMGVVWNYAMSGLFVWRKR 377


>gi|296129591|ref|YP_003636841.1| glycosyl transferase family 2 [Cellulomonas flavigena DSM 20109]
 gi|296021406|gb|ADG74642.1| glycosyl transferase family 2 [Cellulomonas flavigena DSM 20109]
          Length = 391

 Score = 74.2 bits (181), Expect = 6e-12,   Method: Composition-based stats.
 Identities = 20/122 (16%), Positives = 49/122 (40%), Gaps = 2/122 (1%)

Query: 3   QCIIFIINIVVVFFIDVMGFFILMKCGADPFYSRIFSIAVAFLVTWIPSRLFIFLKLRRK 62
           +   F I   +    ++   ++L + GA    + I +  +  +  ++    F+F  LR +
Sbjct: 241 RMSRFAIIGGMGAVANIAIVWLLTRLGAPWLLAAIVAAELTIVGNFLLQERFVFRDLRHE 300

Query: 63  SFLETVRYGVMYFMLSILNYAFY--VKLLLTFQGLQPLLATVLSAVSSMLFVFLLYIRFM 120
                 R+G  +   ++        + LL+    +  +LAT ++   + +  F  + R +
Sbjct: 301 GKGVWARFGQSFTFNNVETLVRMPVMALLVETMHVAAVLATAITIAIAFVVRFTFHSRIV 360

Query: 121 TR 122
            R
Sbjct: 361 YR 362


>gi|86739034|ref|YP_479434.1| glycosyl transferase family protein [Frankia sp. CcI3]
 gi|86565896|gb|ABD09705.1| glycosyl transferase, family 2 [Frankia sp. CcI3]
          Length = 460

 Score = 74.2 bits (181), Expect = 6e-12,   Method: Composition-based stats.
 Identities = 19/124 (15%), Positives = 43/124 (34%), Gaps = 5/124 (4%)

Query: 3   QCIIFIINIVVVFFIDVMGFFILMKCGADPFYSRIFSIAVAFLVTWIPSRLFIFL----K 58
           Q + F    V       +  F+L++       + + S+ +  +     +R   F     +
Sbjct: 307 QLLRFAAIGVASTL-SYLVLFVLLRTVTGAQIANLLSLLLTAVANTAANRRLTFGLTGPR 365

Query: 59  LRRKSFLETVRYGVMYFMLSILNYAFYVKLLLTFQGLQPLLATVLSAVSSMLFVFLLYIR 118
              +  L+ +    +   L+  + A              L   VL+ ++S +  FLL   
Sbjct: 366 RAGRHHLQGLVVFAVGLGLTSGSLALLHAASTNPGRGLELSVLVLANLASTVIRFLLLRA 425

Query: 119 FMTR 122
           ++ R
Sbjct: 426 WVFR 429


>gi|256856005|emb|CBB12350.1| hypothetical protein [Rhodococcus aetherivorans]
          Length = 161

 Score = 74.2 bits (181), Expect = 6e-12,   Method: Composition-based stats.
 Identities = 16/122 (13%), Positives = 45/122 (36%), Gaps = 4/122 (3%)

Query: 3   QCIIFIINIVVVFFIDVMGFFILMKCGADPFYSRIFSIAVAFLVTWIPSRLFIFLKLRRK 62
           Q + F++   +   +D   + +L+  G     ++  S        ++ +R + F     +
Sbjct: 40  QIVRFVLTGGLSAIVDFGLYVLLLAVGLHVNVAKSLSFVAGTTTAYLINRRWTFRAEPSR 99

Query: 63  SFLETVRYGVMYFMLSILNYAFYVKLLLTFQ--GLQPLLATVLSAVSSMLFVFLLYIRFM 120
           +    V   ++Y +   +       L         +  LA V++  ++ +  F++    +
Sbjct: 100 A--RFVAVVILYAVTYAVQVGINYVLYDALPAEWWRVPLAFVVAQGTATVINFVVQRAVI 157

Query: 121 TR 122
            R
Sbjct: 158 FR 159


>gi|56459812|ref|YP_155093.1| glycosyltransferase [Idiomarina loihiensis L2TR]
 gi|56178822|gb|AAV81544.1| Glycosyltransferase [Idiomarina loihiensis L2TR]
          Length = 347

 Score = 74.2 bits (181), Expect = 6e-12,   Method: Composition-based stats.
 Identities = 15/124 (12%), Positives = 44/124 (35%), Gaps = 3/124 (2%)

Query: 2   KQCIIFIINIVVVFFIDVMGFFILMKCGADPFYSRIFSIAVAFLVTWIPSRLFIFLKLRR 61
           ++ + F    ++   +D   F            S + +  ++ +  +  +R ++F +   
Sbjct: 227 QKFLKFASIGILSAGLDYSIFATAYFFSGQVLESIVLARIISGVFNFSLNRQWVFKQGAH 286

Query: 62  KSFLETVRYGVMYFMLSILNYAFYVKLLLTFQGLQPLLATVLSAVSSMLFVFLLYIRFMT 121
            ++    +Y  +  +L   NY         + G+ P +   L+     L  +    R + 
Sbjct: 287 VAWD-ATKYSCLAIVLVAANYGLTEA--FRYLGVTPFIGKPLAEGLVFLLSYGGQKRLVF 343

Query: 122 RRVY 125
           ++  
Sbjct: 344 KKAT 347


>gi|146339875|ref|YP_001204923.1| putative dolichol-phosphate mannosyltransferase membrane protein
           [Bradyrhizobium sp. ORS278]
 gi|146192681|emb|CAL76686.1| putative dolichol-phosphate mannosyltransferase; putative membrane
           protein [Bradyrhizobium sp. ORS278]
          Length = 377

 Score = 74.2 bits (181), Expect = 6e-12,   Method: Composition-based stats.
 Identities = 16/125 (12%), Positives = 44/125 (35%), Gaps = 6/125 (4%)

Query: 3   QCIIFIINIVVVFFIDVMGFFILMKCGADPFY-SRIFSIAVAFLVTWIPSRLFIFLKLRR 61
           + ++F +      F+ +   F+ +     PF  ++     VA    +I +    +   R 
Sbjct: 254 RFLLFAMVGGTGLFVHLATLFLGLNLFDMPFAEAQALGAFVAMTSNFILNNFLTYRDQRL 313

Query: 62  KS---FLETVRYGVMYFMLSILNYAFYVKLLLTFQGLQPLLATVLSAVSSMLFVFLLYIR 118
           K        + + ++  +  + N      +          LA    A+  +++ + +   
Sbjct: 314 KGFGILRGLLAFYLVCSVGLLANVGVAFSVYDQEPIW--WLAGAAGALMGVVWNYAISGL 371

Query: 119 FMTRR 123
           F+ R+
Sbjct: 372 FVWRK 376


>gi|229819504|ref|YP_002881030.1| glycosyl transferase family 2 [Beutenbergia cavernae DSM 12333]
 gi|229565417|gb|ACQ79268.1| glycosyl transferase family 2 [Beutenbergia cavernae DSM 12333]
          Length = 407

 Score = 74.2 bits (181), Expect = 6e-12,   Method: Composition-based stats.
 Identities = 17/122 (13%), Positives = 47/122 (38%), Gaps = 2/122 (1%)

Query: 3   QCIIFIINIVVVFFIDVMGFFILMKCGADPFYSRIFSIAVAFLVTWIPSRLFIFLKLRRK 62
           +   F +   +   +++    ++   GA    + I +     +  ++    F+F  LR +
Sbjct: 243 RMSRFAVIGGIGAVVNIAIVALMTWLGAGYLLAAIVAAETTIVGNFLLQERFVFADLRHE 302

Query: 63  SFLETVRYGVMYFMLSILNYAFY--VKLLLTFQGLQPLLATVLSAVSSMLFVFLLYIRFM 120
                 R+   +   ++        + LL+    +  +LAT ++ + + +  F  + R +
Sbjct: 303 GKRGWQRFAQSFTFNNVETALRLPVMALLVETMHVAAVLATAITLLVAFVVRFTFHSRVV 362

Query: 121 TR 122
            R
Sbjct: 363 YR 364


>gi|325981372|ref|YP_004293774.1| Dolichyl-phosphate beta-D-mannosyltransferase [Nitrosomonas sp.
           AL212]
 gi|325530891|gb|ADZ25612.1| Dolichyl-phosphate beta-D-mannosyltransferase [Nitrosomonas sp.
           AL212]
          Length = 860

 Score = 73.8 bits (180), Expect = 7e-12,   Method: Composition-based stats.
 Identities = 19/118 (16%), Positives = 42/118 (35%), Gaps = 3/118 (2%)

Query: 6   IFIINIVVVFFIDVMGFFILMKCGADPFYSRIFSIAVAFLVTWIPSRLFIFLKLRRK--S 63
            F    ++   ID   F  ++   A    S   S  +A  V +  +  + F +       
Sbjct: 236 RFAAVGLLGVLIDAFVFHWMISREAGLALSHFVSFFIAATVNYTFNSKWSFREHHEGYLR 295

Query: 64  FLETVRYGVMYFMLSILNYAFYVKLLLTFQGLQPLLATVLSAVSSMLFVFLLYIRFMT 121
           + +  R+  +  +  +L        L+    + PLLA   + V++    +L    ++ 
Sbjct: 296 WHQFGRFLTVGALALLLRGGVL-AFLVYVWHMPPLLAIFPAIVTTAAVNYLGSAFYVF 352



 Score = 35.6 bits (81), Expect = 2.4,   Method: Composition-based stats.
 Identities = 12/92 (13%), Positives = 27/92 (29%), Gaps = 2/92 (2%)

Query: 3   QCIIFIINIVVVFFIDVMGFFILMK-CGADPFYSRIFSIAVAFLVTWIPSRLFIFLKLRR 61
           Q   F+    +   +       L+      P  +   +I     V ++ S  ++F   + 
Sbjct: 298 QFGRFLTVGALALLLRGGVLAFLVYVWHMPPLLAIFPAIVTTAAVNYLGSAFYVFPNKKA 357

Query: 62  KSFLET-VRYGVMYFMLSILNYAFYVKLLLTF 92
              L+   R   +  +L  +        L   
Sbjct: 358 PPSLDIRWRTAAIGIVLFAILLRLVYFGLAQL 389


>gi|160871796|ref|ZP_02061928.1| GtrA family protein [Rickettsiella grylli]
 gi|159120595|gb|EDP45933.1| GtrA family protein [Rickettsiella grylli]
          Length = 353

 Score = 73.8 bits (180), Expect = 7e-12,   Method: Composition-based stats.
 Identities = 14/125 (11%), Positives = 45/125 (36%), Gaps = 3/125 (2%)

Query: 4   CIIFIINIVVVFFIDVMGFFILMKCGADPFYSRIFSIAVAFLVTWIPSRLFIFLKLRRKS 63
            I F    ++   ID   F +      + F + +    ++    +  ++   F   +   
Sbjct: 229 FIRFAAISLISAAIDFALFSLTYWLKKNIFLAVLLGRILSATFNFKLNQHLTFK-SKNPG 287

Query: 64  FLETVRYGVMYFMLSILNYAFYVKLLLTFQGLQPLLATVLSAVSSMLFVFLLYIRFMTRR 123
               ++Y  +   L  + Y+      +   G+    + +++ ++  +  F L   F+  +
Sbjct: 288 LSAALKYTALASFLGFIAYSLIQ--FIHGLGINVYSSKIIAEIALFILSFTLQRFFIFNK 345

Query: 124 VYFIK 128
           +  ++
Sbjct: 346 IPLLE 350


>gi|327310259|ref|YP_004337156.1| Dolichyl-phosphate beta-D-mannosyltransferase [Thermoproteus
           uzoniensis 768-20]
 gi|326946738|gb|AEA11844.1| Dolichyl-phosphate beta-D-mannosyltransferase [Thermoproteus
           uzoniensis 768-20]
          Length = 344

 Score = 73.8 bits (180), Expect = 7e-12,   Method: Composition-based stats.
 Identities = 18/119 (15%), Positives = 34/119 (28%), Gaps = 4/119 (3%)

Query: 5   IIFIINIVVVFFIDVMGFFILMKCGADPFYSRIFSIAVAFLVTWIPSRLFIFLKLRRKSF 64
             F         +     + L                V+    +  ++ + F        
Sbjct: 229 FKFAAVGASGIGVAEAVLYALRDVAYPAAALAAI--EVSLTSNYALNKTWTFRDREMPWL 286

Query: 65  LETVRYGVMYFMLSILNYAFYVKLLLTFQGLQPLLATVLSAVSSMLFVFLLYIRFMTRR 123
              ++Y +  F     NYA      L   G    LA +L  ++     +LL   ++ RR
Sbjct: 287 KGWLKYHLANFAGIAANYALSNA--LVLAGTSRYLAYLLGVLAGFAANYLLSELYVFRR 343



 Score = 34.9 bits (79), Expect = 3.8,   Method: Composition-based stats.
 Identities = 7/59 (11%), Positives = 22/59 (37%)

Query: 1   MKQCIIFIINIVVVFFIDVMGFFILMKCGADPFYSRIFSIAVAFLVTWIPSRLFIFLKL 59
           +K  + + +        +      L+  G   + + +  +   F   ++ S L++F + 
Sbjct: 286 LKGWLKYHLANFAGIAANYALSNALVLAGTSRYLAYLLGVLAGFAANYLLSELYVFRRH 344


>gi|158318235|ref|YP_001510743.1| glycosyl transferase family protein [Frankia sp. EAN1pec]
 gi|158113640|gb|ABW15837.1| glycosyl transferase family 2 [Frankia sp. EAN1pec]
          Length = 496

 Score = 73.8 bits (180), Expect = 7e-12,   Method: Composition-based stats.
 Identities = 17/123 (13%), Positives = 44/123 (35%), Gaps = 5/123 (4%)

Query: 3   QCIIFIINIVVVFFIDVMGFFILMKCGADPFYSRIFSIAVAFLVTWIPSRLFIFLKLRR- 61
           Q + F    +       +  F+L++       + + ++ V  +     +R   F    R 
Sbjct: 338 QLLRFAGVGIASTLA-YLVLFVLLRTATGAQAANLIALLVTAVANTAANRRLTFGVTGRG 396

Query: 62  ---KSFLETVRYGVMYFMLSILNYAFYVKLLLTFQGLQPLLATVLSAVSSMLFVFLLYIR 118
              +  L+ +    +  +L+  + A       +      +   VL+ ++S +  FLL   
Sbjct: 397 DAGRHHLQGLFVFAIGLLLTSGSLAALHAASDSPGRFPEVSVLVLANLASTVVRFLLMRA 456

Query: 119 FMT 121
           ++ 
Sbjct: 457 WVF 459


>gi|218508679|ref|ZP_03506557.1| hypothetical conserved membrane protein [Rhizobium etli Brasil 5]
          Length = 131

 Score = 73.8 bits (180), Expect = 8e-12,   Method: Composition-based stats.
 Identities = 42/123 (34%), Positives = 67/123 (54%), Gaps = 1/123 (0%)

Query: 1   MKQCIIFIINIVVVFFIDVMGFFILMKCGA-DPFYSRIFSIAVAFLVTWIPSRLFIFLKL 59
           +K+ I F I   + F +D      ++      PF +R+ +IA+A   TW  +R F F + 
Sbjct: 8   VKKFIRFAIAGGIGFLVDAAVLSAVLALTPLGPFVARLIAIALAMATTWAFNRNFTFDRS 67

Query: 60  RRKSFLETVRYGVMYFMLSILNYAFYVKLLLTFQGLQPLLATVLSAVSSMLFVFLLYIRF 119
            R    E  RYG +    +++NY  Y  LLL+  GLQPL A V++++++M+F F  Y RF
Sbjct: 68  GRSLAAEGFRYGSVGVTAALVNYGLYSALLLSLPGLQPLAAMVVASIAAMVFSFFGYSRF 127

Query: 120 MTR 122
           + R
Sbjct: 128 VFR 130


>gi|331698990|ref|YP_004335229.1| GtrA family protein [Pseudonocardia dioxanivorans CB1190]
 gi|326953679|gb|AEA27376.1| GtrA family protein [Pseudonocardia dioxanivorans CB1190]
          Length = 171

 Score = 73.8 bits (180), Expect = 8e-12,   Method: Composition-based stats.
 Identities = 18/135 (13%), Positives = 52/135 (38%), Gaps = 15/135 (11%)

Query: 2   KQCIIFIINIVVVFFIDVMGFFILMK--CGADPFYSRIFSIAVAFLVTWIPSRLFIFLKL 59
           ++ + F +     + ID + F +L        P  +++ ++ VA +V+++ +R + F   
Sbjct: 21  RELVKFAVVGGTTWVIDTVVFLVLKAGVLEPKPITAKVIAVLVATIVSYVLNREWSFRTR 80

Query: 60  -RRKSFLETVRYGVMYFMLSILNYAFYV------------KLLLTFQGLQPLLATVLSAV 106
             R+   E   + ++  +   +  A                 +   +    +   ++  +
Sbjct: 81  GGRERHHEAALFFLISGIGVAVYTAPLAISRYLLDLRVPDISMFGQEVSDFVAGQIIGTI 140

Query: 107 SSMLFVFLLYIRFMT 121
             M+F +  + RF+ 
Sbjct: 141 VGMIFRWWAFRRFVF 155



 Score = 38.0 bits (87), Expect = 0.45,   Method: Composition-based stats.
 Identities = 9/59 (15%), Positives = 27/59 (45%)

Query: 64  FLETVRYGVMYFMLSILNYAFYVKLLLTFQGLQPLLATVLSAVSSMLFVFLLYIRFMTR 122
             E V++ V+     +++   ++ L       +P+ A V++ + + +  ++L   +  R
Sbjct: 20  HRELVKFAVVGGTTWVIDTVVFLVLKAGVLEPKPITAKVIAVLVATIVSYVLNREWSFR 78


>gi|319951483|ref|ZP_08025290.1| hypothetical protein ES5_17463 [Dietzia cinnamea P4]
 gi|319434852|gb|EFV90165.1| hypothetical protein ES5_17463 [Dietzia cinnamea P4]
          Length = 182

 Score = 73.8 bits (180), Expect = 8e-12,   Method: Composition-based stats.
 Identities = 20/126 (15%), Positives = 47/126 (37%), Gaps = 8/126 (6%)

Query: 3   QCIIFIINIVVVFFIDVMGFFILMKCGADPFYSRIFSIAVAFLVTWIPSRLFIFLKLRRK 62
           Q + F +  V+   +D     +LM  G     ++  S     L  +  +R + F      
Sbjct: 57  QIVRFFLTGVLSAVVDYGLLQLLMLAGVGYGPAKALSFVAGTLTAYGINRRWTF--RAEP 114

Query: 63  SFLETVRYGVMYFMLSILNYAFYVKLLLTFQGLQP------LLATVLSAVSSMLFVFLLY 116
           S    +    +Y ++  + +  ++ L+  F GL         +  V++   + +  F++ 
Sbjct: 115 SRARFIATMCLYALMFGVQWGLFMVLVPFFHGLDWRTFWATTIGYVIAQGVATVTNFIVQ 174

Query: 117 IRFMTR 122
              + R
Sbjct: 175 RTVIFR 180


>gi|329114637|ref|ZP_08243396.1| Dolichyl-Phosphate Beta-D-Mannosyltransferase [Acetobacter pomorum
           DM001]
 gi|326696117|gb|EGE47799.1| Dolichyl-Phosphate Beta-D-Mannosyltransferase [Acetobacter pomorum
           DM001]
          Length = 373

 Score = 73.8 bits (180), Expect = 8e-12,   Method: Composition-based stats.
 Identities = 12/123 (9%), Positives = 45/123 (36%), Gaps = 5/123 (4%)

Query: 3   QCIIFIINIVVVFFIDVMGFFILMKCGADPFYSRIFSIAVAFLVTWIPSRLFIFLKLRRK 62
           + + F +  +     ++         GA    ++      A ++ +     F +   R +
Sbjct: 252 RFVAFCMVGLAGVGTNLAVMQCARLVGAHFSMAQAIGTVAAMILNFFLDNNFTYRDRRLR 311

Query: 63  SF---LETVRYGVMYFMLSILNYAFYVKLLLTFQGLQPLLATVLSAVSSMLFVFLLYIRF 119
            +      V + ++  + ++ +       ++  Q   P  A++  A+ ++++ + +    
Sbjct: 312 GWACMRGLVLFMLVCSVGALADVGI--ARMIYGQNHMPNEASLAGAILAVVWNYAMSSTV 369

Query: 120 MTR 122
           + R
Sbjct: 370 VWR 372


>gi|304404192|ref|ZP_07385854.1| glycosyl transferase family 2 [Paenibacillus curdlanolyticus YK9]
 gi|304347170|gb|EFM13002.1| glycosyl transferase family 2 [Paenibacillus curdlanolyticus YK9]
          Length = 336

 Score = 73.8 bits (180), Expect = 8e-12,   Method: Composition-based stats.
 Identities = 18/119 (15%), Positives = 44/119 (36%), Gaps = 2/119 (1%)

Query: 4   CIIFIINIVVVFFIDVMGFFILMKCGADPFYSRIFSIAVAFLVTWIPSRLFIF-LKLRRK 62
            + F  + +    +D +  F++    +    S + +   + ++ +  +R F+F      K
Sbjct: 219 IVKFSCSSLFAALVDYLLLFLVHVLTSSLLLSVVAARVSSSIINYSMNRKFVFASGSESK 278

Query: 63  SFLETVRYGVMYFMLSILNYAFYVKLLLTFQGLQPLLATVLSAVSSMLFVFLLYIRFMT 121
                 RY  +  ++  LNY      L     +  L A +L+     +  +    +F+ 
Sbjct: 279 VQRSLPRYFSLVLLILALNYGLL-YTLHDRLSIALLPAKLLTEGVLFVLSYWAQRKFVY 336


>gi|258542764|ref|YP_003188197.1| dolichol-phosphate mannosyltransferase [Acetobacter pasteurianus
           IFO 3283-01]
 gi|256633842|dbj|BAH99817.1| dolichol-phosphate mannosyltransferase [Acetobacter pasteurianus
           IFO 3283-01]
 gi|256636901|dbj|BAI02870.1| dolichol-phosphate mannosyltransferase [Acetobacter pasteurianus
           IFO 3283-03]
 gi|256639954|dbj|BAI05916.1| dolichol-phosphate mannosyltransferase [Acetobacter pasteurianus
           IFO 3283-07]
 gi|256643010|dbj|BAI08965.1| dolichol-phosphate mannosyltransferase [Acetobacter pasteurianus
           IFO 3283-22]
 gi|256646065|dbj|BAI12013.1| dolichol-phosphate mannosyltransferase [Acetobacter pasteurianus
           IFO 3283-26]
 gi|256649118|dbj|BAI15059.1| dolichol-phosphate mannosyltransferase [Acetobacter pasteurianus
           IFO 3283-32]
 gi|256652105|dbj|BAI18039.1| dolichol-phosphate mannosyltransferase [Acetobacter pasteurianus
           IFO 3283-01-42C]
 gi|256655162|dbj|BAI21089.1| dolichol-phosphate mannosyltransferase [Acetobacter pasteurianus
           IFO 3283-12]
          Length = 372

 Score = 73.8 bits (180), Expect = 8e-12,   Method: Composition-based stats.
 Identities = 11/123 (8%), Positives = 44/123 (35%), Gaps = 5/123 (4%)

Query: 3   QCIIFIINIVVVFFIDVMGFFILMKCGADPFYSRIFSIAVAFLVTWIPSRLFIFLKLRRK 62
           + + F +  +     +++        GA    ++      A ++ +     F +   R +
Sbjct: 251 RFVAFCMVGLAGVGTNLVVMQCARLAGAHFSLAQAIGTVAAMILNFFLDNNFTYRDRRLR 310

Query: 63  SF---LETVRYGVMYFMLSILNYAFYVKLLLTFQGLQPLLATVLSAVSSMLFVFLLYIRF 119
            +      V + ++  + ++ +      +      L    A++  A+ ++++ + +    
Sbjct: 311 GWACMRGLVLFMLVCSVGALADVGIARMIYGQNHMLNE--ASLAGAILAVVWNYAMSSTV 368

Query: 120 MTR 122
           + R
Sbjct: 369 VWR 371


>gi|119873112|ref|YP_931119.1| dolichyl-phosphate beta-D-mannosyltransferase [Pyrobaculum
           islandicum DSM 4184]
 gi|119674520|gb|ABL88776.1| Dolichyl-phosphate beta-D-mannosyltransferase [Pyrobaculum
           islandicum DSM 4184]
          Length = 345

 Score = 73.4 bits (179), Expect = 8e-12,   Method: Composition-based stats.
 Identities = 18/117 (15%), Positives = 45/117 (38%), Gaps = 4/117 (3%)

Query: 5   IIFIINIVVVFFIDVMGFFILMKCGADPFYSRIFSIAVAFLVTWIPSRLFIFLKLRRKSF 64
           + F        F+     ++L      P+ S   +I  +    ++ +RL+ F + +  + 
Sbjct: 226 LKFAAVGASGVFVAWAVLYLLSPL--PPYLSVAAAIETSLTSNYLLNRLWTFAERKTPAL 283

Query: 65  LETVRYGVMYFMLSILNYAFYVKLLLTFQGLQPLLATVLSAVSSMLFVFLLYIRFMT 121
           +  +RY V     +  NY   +   L   G+   +A ++  ++     ++L    + 
Sbjct: 284 IGWLRYHVATAAGNATNYITTLA--LNILGVWVYIAYLIGVIAGYAVNYILSELTVF 338


>gi|270290062|ref|ZP_06196288.1| glycosyltransferase [Pediococcus acidilactici 7_4]
 gi|270281599|gb|EFA27431.1| glycosyltransferase [Pediococcus acidilactici 7_4]
          Length = 359

 Score = 73.4 bits (179), Expect = 9e-12,   Method: Composition-based stats.
 Identities = 18/127 (14%), Positives = 52/127 (40%), Gaps = 7/127 (5%)

Query: 3   QCIIFIINIVVVFFIDVMGFFILM------KCGADPFYSRIFSIAVAFLVTWIPSRLFIF 56
           + + F ++ ++ F +DV  F +++        G     + I S  ++ +V +  +   +F
Sbjct: 227 RFLKFAMSGLISFLVDVGLFELMIVLMGKELLGERIIVATIVSRLLSAMVNYTLNHRVVF 286

Query: 57  LKLRRKSFLETV-RYGVMYFMLSILNYAFYVKLLLTFQGLQPLLATVLSAVSSMLFVFLL 115
            K  R++ ++    + +  F    L       L  +   + PL+A ++   +  +  + +
Sbjct: 287 GKQGRQTVIKYGGLFIIQMFASGYLTDLVTGWLPHSQGSIAPLIAKIVVDFTLFIISYQI 346

Query: 116 YIRFMTR 122
               + +
Sbjct: 347 QRDLIFK 353



 Score = 34.5 bits (78), Expect = 4.4,   Method: Composition-based stats.
 Identities = 9/80 (11%), Positives = 34/80 (42%), Gaps = 6/80 (7%)

Query: 50  PSRLFIFLKLRRKSF--LETVRYGVMYFMLSILNYAFYVKLLL----TFQGLQPLLATVL 103
            ++   F  +R         +++ +   +  +++   +  +++       G + ++AT++
Sbjct: 209 GNKSSHFRMVRDSVAIYARFLKFAMSGLISFLVDVGLFELMIVLMGKELLGERIIVATIV 268

Query: 104 SAVSSMLFVFLLYIRFMTRR 123
           S + S +  + L  R +  +
Sbjct: 269 SRLLSAMVNYTLNHRVVFGK 288


>gi|325677626|ref|ZP_08157278.1| glycosyltransferase, group 2 family protein [Ruminococcus albus 8]
 gi|324110594|gb|EGC04758.1| glycosyltransferase, group 2 family protein [Ruminococcus albus 8]
          Length = 347

 Score = 73.4 bits (179), Expect = 9e-12,   Method: Composition-based stats.
 Identities = 15/127 (11%), Positives = 48/127 (37%), Gaps = 2/127 (1%)

Query: 2   KQCIIFIINIVVVFFIDVMGFFILMKCGADPFYSRIFSIAVAFLVTWIPSRLFIFLKLRR 61
           +  I F  + ++ F +D + F ++         S + +   + +  ++ ++  +F     
Sbjct: 220 RDIIKFSCSSLLSFLVDYLLFSVIFSLSGSKTVSNLTARVFSSIFNFMLNKKLVFGNKEN 279

Query: 62  KSFLETVRYGVMYFMLSILNYAFYVKLLLTFQGLQPLLATVLSAVSSMLFVFLLYIRFMT 121
                 ++Y  +  ++  +N       L  +      +A ++  V   +F + +   F+ 
Sbjct: 280 -LAKSALKYFSLAAVILAVNTLLLEL-LARYAVKNAYIAKIIVEVLLFMFSWTMQRCFVF 337

Query: 122 RRVYFIK 128
           ++    K
Sbjct: 338 KKKGLTK 344


>gi|159041198|ref|YP_001540450.1| glycosyl transferase family protein [Caldivirga maquilingensis
           IC-167]
 gi|157920033|gb|ABW01460.1| glycosyl transferase family 2 [Caldivirga maquilingensis IC-167]
          Length = 370

 Score = 73.4 bits (179), Expect = 1e-11,   Method: Composition-based stats.
 Identities = 17/119 (14%), Positives = 44/119 (36%), Gaps = 2/119 (1%)

Query: 5   IIFIINIVVVFFIDVMGFFILMK-CGADPFYSRIFSIAVAFLVTWIPSRLFIFLKLRRKS 63
           I F I   +   +  +   +  +  G   F S I +I       +  ++++ F       
Sbjct: 243 IKFAIVGAIGLVVSELVLHVFWRILGLAYFISLIPAIEAGIANNFTLNKVWTFKDRSVGY 302

Query: 64  FLETVRYGVMYFMLSILNYAFYVKLLLTFQGLQPLLATVLSAVSSMLFVFLLYIRFMTR 122
           ++   +Y V     + + YA     L    G+   +A V+  +   +  +++   ++ +
Sbjct: 303 WVGLGKYHVASLTGTAVTYAVTNL-LHYGLGVNGYVAYVIGVIFGFIANYIMAEVYVFK 360



 Score = 37.2 bits (85), Expect = 0.68,   Method: Composition-based stats.
 Identities = 6/61 (9%), Positives = 23/61 (37%), Gaps = 1/61 (1%)

Query: 4   CIIFIINIVVVFFIDVMGFFILMK-CGADPFYSRIFSIAVAFLVTWIPSRLFIFLKLRRK 62
              + +  +    +      +L    G + + + +  +   F+  +I + +++F   R  
Sbjct: 306 LGKYHVASLTGTAVTYAVTNLLHYGLGVNGYVAYVIGVIFGFIANYIMAEVYVFKYRRTG 365

Query: 63  S 63
           +
Sbjct: 366 T 366


>gi|29831563|ref|NP_826197.1| hypothetical protein SAV_5020 [Streptomyces avermitilis MA-4680]
 gi|29608679|dbj|BAC72732.1| hypothetical protein [Streptomyces avermitilis MA-4680]
          Length = 181

 Score = 73.4 bits (179), Expect = 1e-11,   Method: Composition-based stats.
 Identities = 17/126 (13%), Positives = 43/126 (34%), Gaps = 5/126 (3%)

Query: 2   KQCIIFIINIVVVFFIDVMGFFILMKCGADPFY-SRIFSIAVAFLVTWIPSRLFIFLKLR 60
           ++   F         ++++ F ++          + + +  VA +  +I  R F +    
Sbjct: 25  REIAKFGAVGGAGLLVNLLVFNLVRSVTGLQVVRASVIATIVAIICNYIGFRYFTYRDRD 84

Query: 61  RK-SFLETVRYGVMYFMLSILNYAFYVKLLLTFQGLQPLLATV---LSAVSSMLFVFLLY 116
           +     E   + +   +  ++          +F    PL + +   L    + LF F  Y
Sbjct: 85  KSGRTKELTLFLLFSAVGLVIENGVLYVATYSFGWDSPLQSNIFKFLGIGLATLFRFWSY 144

Query: 117 IRFMTR 122
             ++ R
Sbjct: 145 RTWVFR 150


>gi|86750768|ref|YP_487264.1| dolichyl-phosphate beta-D-mannosyltransferase [Rhodopseudomonas
           palustris HaA2]
 gi|86573796|gb|ABD08353.1| Dolichyl-phosphate beta-D-mannosyltransferase [Rhodopseudomonas
           palustris HaA2]
          Length = 377

 Score = 73.4 bits (179), Expect = 1e-11,   Method: Composition-based stats.
 Identities = 17/125 (13%), Positives = 48/125 (38%), Gaps = 6/125 (4%)

Query: 3   QCIIFIINIVVVFFIDVMGFFILMKCGADPFY-SRIFSIAVAFLVTWIPSRLFIFLKLRR 61
           + I+F +       +  +  ++++K    PF  ++  +  VA    +I +    +   R 
Sbjct: 254 RFILFALVGSTGVIVHFLTLYLVLKVFEQPFAEAQGAAAVVAMTSNFILNNFLTYRDQRL 313

Query: 62  KS---FLETVRYGVMYFMLSILNYAFYVKLLLTFQGLQPLLATVLSAVSSMLFVFLLYIR 118
           K        + + ++  +  + N        +  + +   LA    AV  +++ + +   
Sbjct: 314 KGFAILRGLLLFYLVCGVGLLANVGV--AFAVYNEHITWWLAGAAGAVMGVVWNYAMSGL 371

Query: 119 FMTRR 123
           F+ R+
Sbjct: 372 FVWRK 376



 Score = 36.4 bits (83), Expect = 1.2,   Method: Composition-based stats.
 Identities = 8/59 (13%), Positives = 22/59 (37%)

Query: 1   MKQCIIFIINIVVVFFIDVMGFFILMKCGADPFYSRIFSIAVAFLVTWIPSRLFIFLKL 59
           ++  ++F +   V    +V   F +       + +      +  +  +  S LF++ K 
Sbjct: 319 LRGLLLFYLVCGVGLLANVGVAFAVYNEHITWWLAGAAGAVMGVVWNYAMSGLFVWRKR 377


>gi|116669751|ref|YP_830684.1| GtrA family protein [Arthrobacter sp. FB24]
 gi|116609860|gb|ABK02584.1| GtrA family protein [Arthrobacter sp. FB24]
          Length = 194

 Score = 73.4 bits (179), Expect = 1e-11,   Method: Composition-based stats.
 Identities = 22/128 (17%), Positives = 44/128 (34%), Gaps = 6/128 (4%)

Query: 2   KQCIIFIINIVVVFFIDVMGFFILMK--CGADPFYSRIFSIAVAFLVTWIPSRLFIFLKL 59
           ++   F     V F ID    + LM          +R     +A + +WI +R + F   
Sbjct: 18  REVAKFGAVGGVAFVIDNGLTYYLMHGPMTDSEAKARFVGATIATIFSWIANRFWTFRHR 77

Query: 60  RR-KSFLETVRYGVMYFMLSILNYAFYVKLLLTFQGLQ---PLLATVLSAVSSMLFVFLL 115
           R+     E   + ++  +   ++  F      +F         LA V   + + +  F  
Sbjct: 78  RQDNVIREFFMFILINGIGIGISTGFTALAKYSFGITDKNMLFLAGVAGILVATVVRFFA 137

Query: 116 YIRFMTRR 123
           Y   +  +
Sbjct: 138 YRFLVFNK 145



 Score = 40.3 bits (93), Expect = 0.079,   Method: Composition-based stats.
 Identities = 7/59 (11%), Positives = 22/59 (37%)

Query: 64  FLETVRYGVMYFMLSILNYAFYVKLLLTFQGLQPLLATVLSAVSSMLFVFLLYIRFMTR 122
           + E  ++G +  +  +++      L+          A  + A  + +F ++    +  R
Sbjct: 17  WREVAKFGAVGGVAFVIDNGLTYYLMHGPMTDSEAKARFVGATIATIFSWIANRFWTFR 75


>gi|283457366|ref|YP_003361942.1| cell wall biogenesis glycosyltransferase [Rothia mucilaginosa
           DY-18]
 gi|283133357|dbj|BAI64122.1| glycosyltransferase involved in cell wall biogenesis [Rothia
           mucilaginosa DY-18]
          Length = 397

 Score = 73.4 bits (179), Expect = 1e-11,   Method: Composition-based stats.
 Identities = 24/111 (21%), Positives = 47/111 (42%), Gaps = 3/111 (2%)

Query: 12  VVVFFIDVMGFFILMKCGADPFYSRIFSIAVAFLVTWIPSR-LFIFLKLRRKSFLETVRY 70
           +  F +D +  F+L+  GA    + + +  ++ L  +  +R L      R  +    VRY
Sbjct: 241 LTGFLVDAIALFVLVGMGAPLLVAVVGARIISALTNFTVNRMLMHDGGARPSASSSLVRY 300

Query: 71  GVMYFMLSILNYAFYVKLLLTFQGLQPLLATVLSAVSSMLFVFLLYIRFMT 121
            V+   +   N A      LT  G   L+A +L+ +  +   F +  R++ 
Sbjct: 301 TVLAVGILAANAALMEA--LTGLGASLLVAKILTELILIPISFAVQRRWVF 349


>gi|192292671|ref|YP_001993276.1| glycosyl transferase family 2 [Rhodopseudomonas palustris TIE-1]
 gi|192286420|gb|ACF02801.1| glycosyl transferase family 2 [Rhodopseudomonas palustris TIE-1]
          Length = 386

 Score = 73.4 bits (179), Expect = 1e-11,   Method: Composition-based stats.
 Identities = 18/125 (14%), Positives = 49/125 (39%), Gaps = 6/125 (4%)

Query: 3   QCIIFIINIVVVFFIDVMGFFILMKCGADPFY-SRIFSIAVAFLVTWIPSRLFIFLKLRR 61
           + I+F +       +  +  F+++K    PF  ++  +  VA    +I +    +   R 
Sbjct: 263 RFILFALVGSTGVVVHFVTLFVVLKLFEQPFAEAQGVAALVAMTSNFILNNFLTYRDQRL 322

Query: 62  KSF---LETVRYGVMYFMLSILNYAFYVKLLLTFQGLQPLLATVLSAVSSMLFVFLLYIR 118
           K F      + + ++  +  + N        +  + +   LA    A+  +++ + +   
Sbjct: 323 KGFAIVRGLLLFYLVCGVGLLANVGV--AFAVYNEHITWWLAGAAGALMGVVWNYAMSGL 380

Query: 119 FMTRR 123
           F+ R+
Sbjct: 381 FVWRK 385



 Score = 35.6 bits (81), Expect = 2.1,   Method: Composition-based stats.
 Identities = 8/59 (13%), Positives = 22/59 (37%)

Query: 1   MKQCIIFIINIVVVFFIDVMGFFILMKCGADPFYSRIFSIAVAFLVTWIPSRLFIFLKL 59
           ++  ++F +   V    +V   F +       + +      +  +  +  S LF++ K 
Sbjct: 328 VRGLLLFYLVCGVGLLANVGVAFAVYNEHITWWLAGAAGALMGVVWNYAMSGLFVWRKR 386


>gi|134102534|ref|YP_001108195.1| putative glycosyl transferase [Saccharopolyspora erythraea NRRL
           2338]
 gi|291007099|ref|ZP_06565072.1| putative glycosyl transferase [Saccharopolyspora erythraea NRRL
           2338]
 gi|133915157|emb|CAM05270.1| putative glycosyl transferase [Saccharopolyspora erythraea NRRL
           2338]
          Length = 402

 Score = 73.0 bits (178), Expect = 1e-11,   Method: Composition-based stats.
 Identities = 14/123 (11%), Positives = 37/123 (30%), Gaps = 4/123 (3%)

Query: 3   QCIIFIINIVVVFFIDVMGFFILMKCGADPFYSRIFSIAVAFLVTWIPSRLFIFLKLRRK 62
           Q + F +       +  + + +L      P  + + ++    +     +R   FL     
Sbjct: 273 QLVSFGLIGAASTAVTTVLYAVLRTW-WPPLPANLVALVATTMWNTEANRRLTFLGRTGS 331

Query: 63  SFL---ETVRYGVMYFMLSILNYAFYVKLLLTFQGLQPLLATVLSAVSSMLFVFLLYIRF 119
                 + +    +Y++++               G   +   V S+       F L   +
Sbjct: 332 HRRIQLQGLLVFAVYYLITSGALLALHAGWPDPPGWVEIAVLVASSAVGTALRFALLRSW 391

Query: 120 MTR 122
           + R
Sbjct: 392 VFR 394


>gi|54022966|ref|YP_117208.1| hypothetical protein nfa9990 [Nocardia farcinica IFM 10152]
 gi|54014474|dbj|BAD55844.1| hypothetical protein [Nocardia farcinica IFM 10152]
          Length = 180

 Score = 73.0 bits (178), Expect = 1e-11,   Method: Composition-based stats.
 Identities = 25/134 (18%), Positives = 47/134 (35%), Gaps = 15/134 (11%)

Query: 3   QCIIFIINIVVVFFIDVMGFFILMK--CGADPFYSRIFSIAVAFLVTWIPSRLFIFLKL- 59
           + I F I     F ID   F+ L        P  ++I S  VA + +++ +R + F    
Sbjct: 24  ELIKFAIVGATTFVIDSGIFYALKWTVLTEKPVTAKIISGVVAVIASYVLNREWSFKNRG 83

Query: 60  RRKSFLETVRYGVMYFMLSILNYAFYVKLLLTF------------QGLQPLLATVLSAVS 107
            R+   E + + V+  +   L+          F                 + A ++  + 
Sbjct: 84  GRERHHEALLFFVVSGIGVALSNIPLWISSYVFDLRQPAVSFTVENIADFVSAFIIGNLL 143

Query: 108 SMLFVFLLYIRFMT 121
            M F F    R++ 
Sbjct: 144 QMAFRFWAMRRWVF 157



 Score = 34.9 bits (79), Expect = 3.3,   Method: Composition-based stats.
 Identities = 8/60 (13%), Positives = 28/60 (46%)

Query: 63  SFLETVRYGVMYFMLSILNYAFYVKLLLTFQGLQPLLATVLSAVSSMLFVFLLYIRFMTR 122
              E +++ ++     +++   +  L  T    +P+ A ++S V +++  ++L   +  +
Sbjct: 21  RHHELIKFAIVGATTFVIDSGIFYALKWTVLTEKPVTAKIISGVVAVIASYVLNREWSFK 80


>gi|288922499|ref|ZP_06416683.1| glycosyl transferase family 2 [Frankia sp. EUN1f]
 gi|288346163|gb|EFC80508.1| glycosyl transferase family 2 [Frankia sp. EUN1f]
          Length = 472

 Score = 73.0 bits (178), Expect = 1e-11,   Method: Composition-based stats.
 Identities = 17/123 (13%), Positives = 44/123 (35%), Gaps = 3/123 (2%)

Query: 1   MKQCIIFIINIVVVFFIDVMGFFILMKCGADPFYSRIFSIAVAFLVTWIPSRLFIFLKL- 59
           ++Q + F+   V      ++ F +L      P  + +F++ +  +     +R   F    
Sbjct: 290 VRQLVRFVAIGVASTVTYLIVFVLLRGW-LGPQVANLFALLLTAVANTAANRRLTFGVRG 348

Query: 60  -RRKSFLETVRYGVMYFMLSILNYAFYVKLLLTFQGLQPLLATVLSAVSSMLFVFLLYIR 118
              +S +E +    +   L+    A    L         L   V++ +   +  F+ +  
Sbjct: 349 VGARSHVEGLVIFAVGLALTSGALAGLHALADEPGRGVELAVLVIANLVVTVLRFVAFRA 408

Query: 119 FMT 121
           ++ 
Sbjct: 409 WVF 411


>gi|154247238|ref|YP_001418196.1| dolichyl-phosphate beta-D-mannosyltransferase [Xanthobacter
           autotrophicus Py2]
 gi|154161323|gb|ABS68539.1| Dolichyl-phosphate beta-D-mannosyltransferase [Xanthobacter
           autotrophicus Py2]
          Length = 394

 Score = 73.0 bits (178), Expect = 1e-11,   Method: Composition-based stats.
 Identities = 12/129 (9%), Positives = 37/129 (28%), Gaps = 9/129 (6%)

Query: 3   QCIIFIINIVVVFFIDVMGFFILMKCGADPFYSRIFSIAVAFLVTWIPSRLFIFLKLRRK 62
           + ++FI+   +  F+ +     L         ++  +  VA    +  +    +   R K
Sbjct: 266 RFLMFIVVGGLGVFVHMAVLAAL-HAQLSFLAAQGLAAVVAMTFNFFVNNTLTYRDRRLK 324

Query: 63  S----FLETVRYGVMYFMLSILNYAFYVKLLLTFQGL----QPLLATVLSAVSSMLFVFL 114
                      +  +  + ++ N      L              ++     +   ++ + 
Sbjct: 325 GVWALTRGLFAFYAVCAVGAVANVGIANFLFQAENHALTAGNWFVSGAAGILVGAVWNYA 384

Query: 115 LYIRFMTRR 123
               F  R+
Sbjct: 385 ASSVFTWRK 393


>gi|39936845|ref|NP_949121.1| dolichyl-phosphate beta-D-mannosyltransferase [Rhodopseudomonas
           palustris CGA009]
 gi|39650702|emb|CAE29225.1| putative dolichol-phosphate mannosyltransferase [Rhodopseudomonas
           palustris CGA009]
          Length = 378

 Score = 73.0 bits (178), Expect = 1e-11,   Method: Composition-based stats.
 Identities = 18/125 (14%), Positives = 49/125 (39%), Gaps = 6/125 (4%)

Query: 3   QCIIFIINIVVVFFIDVMGFFILMKCGADPFY-SRIFSIAVAFLVTWIPSRLFIFLKLRR 61
           + I+F +       +  +  F+++K    PF  ++  +  VA    +I +    +   R 
Sbjct: 255 RFILFALVGSTGVVVHFVTLFVVLKLFEQPFAEAQGVAALVAMTSNFILNNFLTYRDQRL 314

Query: 62  KSF---LETVRYGVMYFMLSILNYAFYVKLLLTFQGLQPLLATVLSAVSSMLFVFLLYIR 118
           K F      + + ++  +  + N        +  + +   LA    A+  +++ + +   
Sbjct: 315 KGFAIVRGLLLFYLVCGVGLLANVGV--AFAVYNEHITWWLAGAAGALMGVVWNYAMSGL 372

Query: 119 FMTRR 123
           F+ R+
Sbjct: 373 FVWRK 377



 Score = 35.6 bits (81), Expect = 2.2,   Method: Composition-based stats.
 Identities = 8/59 (13%), Positives = 22/59 (37%)

Query: 1   MKQCIIFIINIVVVFFIDVMGFFILMKCGADPFYSRIFSIAVAFLVTWIPSRLFIFLKL 59
           ++  ++F +   V    +V   F +       + +      +  +  +  S LF++ K 
Sbjct: 320 VRGLLLFYLVCGVGLLANVGVAFAVYNEHITWWLAGAAGALMGVVWNYAMSGLFVWRKR 378


>gi|255326682|ref|ZP_05367758.1| dolichyl-phosphate beta-D-mannosyltransferase [Rothia mucilaginosa
           ATCC 25296]
 gi|255295899|gb|EET75240.1| dolichyl-phosphate beta-D-mannosyltransferase [Rothia mucilaginosa
           ATCC 25296]
          Length = 397

 Score = 73.0 bits (178), Expect = 1e-11,   Method: Composition-based stats.
 Identities = 25/111 (22%), Positives = 47/111 (42%), Gaps = 3/111 (2%)

Query: 12  VVVFFIDVMGFFILMKCGADPFYSRIFSIAVAFLVTWIPSR-LFIFLKLRRKSFLETVRY 70
           +  F +D +  F+L+  GA    + I +  ++ L  +  +R L      R  +    VRY
Sbjct: 241 LTGFLVDAIALFVLVGMGAPLLAAVIGARVISALTNFTVNRMLMHDGGARPSASSSLVRY 300

Query: 71  GVMYFMLSILNYAFYVKLLLTFQGLQPLLATVLSAVSSMLFVFLLYIRFMT 121
            V+   +   N A      LT  G   L+A +L+ +  +   F +  R++ 
Sbjct: 301 TVLAVGILAANAALMEA--LTGLGASLLVAKILTELILIPISFAVQRRWVF 349


>gi|16331022|ref|NP_441750.1| dolichyl-phosphate-mannose synthase [Synechocystis sp. PCC 6803]
 gi|1653517|dbj|BAA18430.1| dolichyl-phosphate-mannose synthase [Synechocystis sp. PCC 6803]
          Length = 390

 Score = 73.0 bits (178), Expect = 1e-11,   Method: Composition-based stats.
 Identities = 17/129 (13%), Positives = 42/129 (32%), Gaps = 10/129 (7%)

Query: 3   QCIIFIINIVVVFFIDVMGFFILMKCGADPFY---SRIFSIAVAFLVTWIPSRLFIFLK- 58
           + + F    +    +D+   FIL +          S+I +  +A L  +  +  + F   
Sbjct: 259 RFLQFCAVGLTGVAVDMAILFILTEPSLGDLPLSRSKIIAAQLAILNNFFWNDRWTFQDL 318

Query: 59  -----LRRKSFLETVRYGVMYFMLSILNYAFYVKLLLTFQGLQPLLATVLSAVSSMLFVF 113
                   +     +++ ++ +    +N              +  LA  L+     L+ F
Sbjct: 319 TQGQNSPSQVSKRLLKFNLICWAGLGINLGLLNFFFNFSHFNRY-LANALAIALVTLWNF 377

Query: 114 LLYIRFMTR 122
              ++   R
Sbjct: 378 WFNLKLSWR 386


>gi|91976278|ref|YP_568937.1| dolichyl-phosphate beta-D-mannosyltransferase [Rhodopseudomonas
           palustris BisB5]
 gi|91682734|gb|ABE39036.1| Dolichyl-phosphate beta-D-mannosyltransferase [Rhodopseudomonas
           palustris BisB5]
          Length = 377

 Score = 73.0 bits (178), Expect = 1e-11,   Method: Composition-based stats.
 Identities = 18/125 (14%), Positives = 48/125 (38%), Gaps = 6/125 (4%)

Query: 3   QCIIFIINIVVVFFIDVMGFFILMKCGADPFY-SRIFSIAVAFLVTWIPSRLFIFLKLRR 61
           + I+F +       +  +  ++++K    PF  ++  +  VA    +I +    +   R 
Sbjct: 254 RFILFALVGSTGVVVHFLTLYLVLKVFEQPFAEAQGAAAVVAMTSNFILNNFLTYRDQRL 313

Query: 62  KS---FLETVRYGVMYFMLSILNYAFYVKLLLTFQGLQPLLATVLSAVSSMLFVFLLYIR 118
           K        + + ++  +  I N        +  + +   LA    AV  +++ + +   
Sbjct: 314 KGFAILRGLLLFYLVCGVGLIANVGV--AFAVYNEHITWWLAGAAGAVMGVVWNYAMSGL 371

Query: 119 FMTRR 123
           F+ R+
Sbjct: 372 FVWRK 376



 Score = 36.0 bits (82), Expect = 1.7,   Method: Composition-based stats.
 Identities = 8/59 (13%), Positives = 22/59 (37%)

Query: 1   MKQCIIFIINIVVVFFIDVMGFFILMKCGADPFYSRIFSIAVAFLVTWIPSRLFIFLKL 59
           ++  ++F +   V    +V   F +       + +      +  +  +  S LF++ K 
Sbjct: 319 LRGLLLFYLVCGVGLIANVGVAFAVYNEHITWWLAGAAGAVMGVVWNYAMSGLFVWRKR 377


>gi|67920126|ref|ZP_00513646.1| Dolichyl-phosphate beta-D-mannosyltransferase [Crocosphaera
           watsonii WH 8501]
 gi|67857610|gb|EAM52849.1| Dolichyl-phosphate beta-D-mannosyltransferase [Crocosphaera
           watsonii WH 8501]
          Length = 417

 Score = 73.0 bits (178), Expect = 1e-11,   Method: Composition-based stats.
 Identities = 28/147 (19%), Positives = 49/147 (33%), Gaps = 27/147 (18%)

Query: 3   QCIIFIINIVVVFFIDVMGFFILMK-CGADPFYSRIFSIAVAFLVTWIPSRLFIFLK--- 58
           + I F +      F+D+  F +L K        S I S  VA +  ++ + L+ F     
Sbjct: 265 RFIQFCLVGFSGLFVDLTVFSLLRKGLELGLTRSTILSAEVAIINNFLWNDLWTFRDISS 324

Query: 59  ---LRRKSFLETVRYGVMYFMLSILNYAFYVKLLLTFQGLQP------------------ 97
               +R+     +++  +     IL           FQ LQ                   
Sbjct: 325 RQPGKRQRLKRFIKFNFVCLAGVILQTLLVNTFFAIFQKLQLDTTIANITTNGFLRGVLT 384

Query: 98  --LLATVLSAVSSMLFVFLLYIRFMTR 122
             LLA +++ V    + F L  +   R
Sbjct: 385 SDLLAKLMAIVIVTFWNFWLNTKLSWR 411


>gi|229824350|ref|ZP_04450419.1| hypothetical protein GCWU000282_01671 [Catonella morbi ATCC 51271]
 gi|229786150|gb|EEP22264.1| hypothetical protein GCWU000282_01671 [Catonella morbi ATCC 51271]
          Length = 346

 Score = 73.0 bits (178), Expect = 1e-11,   Method: Composition-based stats.
 Identities = 21/130 (16%), Positives = 56/130 (43%), Gaps = 5/130 (3%)

Query: 2   KQCIIFIINIVVVFFIDVMGFFILMKCGADPFYSRIFSIAVAFLVTWIPSRLFIFLKLRR 61
           K+ + F ++ ++ FF+D   + + +  G     + + +  ++    +  ++  +F     
Sbjct: 219 KEILRFGLSSLLSFFLDYSLYALQVFAGLPLVTANVIARLISAGFNFFINKKLVF-ASDH 277

Query: 62  KSFLETVRYGVMYFMLSILNYAFYVKLLLTFQGLQPLLATVLSAVSSMLFVFLLYIRFMT 121
               E   Y ++  +   LN    +  L    G+ PL+  +L+ +    F +L+  + + 
Sbjct: 278 PVLKELGAYALLAGLSLGLNTLVLM-GLSYGIGIGPLIGKILTEIGMFFFNWLVQKKLIF 336

Query: 122 RR---VYFIK 128
            R   V+++K
Sbjct: 337 GRKKGVHYVK 346


>gi|291459019|ref|ZP_06598409.1| GtrA family protein [Oribacterium sp. oral taxon 078 str. F0262]
 gi|291418273|gb|EFE91992.1| GtrA family protein [Oribacterium sp. oral taxon 078 str. F0262]
          Length = 389

 Score = 73.0 bits (178), Expect = 1e-11,   Method: Composition-based stats.
 Identities = 22/120 (18%), Positives = 47/120 (39%), Gaps = 3/120 (2%)

Query: 3   QCIIFIINIVVVFFIDVMGFFILMKC-GADPFYSRIFSIAVAFLVTWIPSRLFIFLKLRR 61
           Q   F ++ +  F +D   + +L+   G     +   +  V+  V +  +R  +F    +
Sbjct: 221 QIFRFGMSSLFSFLLDFSLYNLLLGLFGLPAVLANGLARLVSAGVNFCINRRLVF-HSEK 279

Query: 62  KSFLETVRYGVMYFMLSILNYAFYVKLLLTFQGLQPLLATVLSAVSSMLFVFLLYIRFMT 121
                  RY ++   + +LN       LL    + P  A +L+ +    F +L+  R + 
Sbjct: 280 GLLRSAARYALLAAGILLLNSIILSA-LLMGLHMHPFPAKLLTELLLFSFSYLVQQRLIF 338


>gi|304385687|ref|ZP_07368031.1| GtrA family protein [Pediococcus acidilactici DSM 20284]
 gi|304328191|gb|EFL95413.1| GtrA family protein [Pediococcus acidilactici DSM 20284]
          Length = 359

 Score = 72.6 bits (177), Expect = 2e-11,   Method: Composition-based stats.
 Identities = 18/127 (14%), Positives = 52/127 (40%), Gaps = 7/127 (5%)

Query: 3   QCIIFIINIVVVFFIDVMGFFILM------KCGADPFYSRIFSIAVAFLVTWIPSRLFIF 56
           + + F ++ ++ F +DV  F +++        G     + I S  ++ +V +  +   +F
Sbjct: 227 RFLKFAMSGLISFLVDVGLFELMIVLMGKELLGERIIVATIVSRLLSAMVNYTLNHRVVF 286

Query: 57  LKLRRKSFLET-VRYGVMYFMLSILNYAFYVKLLLTFQGLQPLLATVLSAVSSMLFVFLL 115
            K  R++ ++    + +  F    L       L  +   + PL+A ++   +  +  + +
Sbjct: 287 GKQGRQTVIKYGGVFIIQMFASGYLTDLVTGWLPHSQGSIAPLIAKIVVDFTLFIISYQI 346

Query: 116 YIRFMTR 122
               + +
Sbjct: 347 QRDLIFK 353



 Score = 34.5 bits (78), Expect = 4.4,   Method: Composition-based stats.
 Identities = 9/80 (11%), Positives = 34/80 (42%), Gaps = 6/80 (7%)

Query: 50  PSRLFIFLKLRRKSF--LETVRYGVMYFMLSILNYAFYVKLLL----TFQGLQPLLATVL 103
            ++   F  +R         +++ +   +  +++   +  +++       G + ++AT++
Sbjct: 209 GNKSSHFRVVRDSVAIYARFLKFAMSGLISFLVDVGLFELMIVLMGKELLGERIIVATIV 268

Query: 104 SAVSSMLFVFLLYIRFMTRR 123
           S + S +  + L  R +  +
Sbjct: 269 SRLLSAMVNYTLNHRVVFGK 288


>gi|302551902|ref|ZP_07304244.1| integral membrane protein [Streptomyces viridochromogenes DSM
           40736]
 gi|302469520|gb|EFL32613.1| integral membrane protein [Streptomyces viridochromogenes DSM
           40736]
          Length = 168

 Score = 72.6 bits (177), Expect = 2e-11,   Method: Composition-based stats.
 Identities = 16/125 (12%), Positives = 41/125 (32%), Gaps = 5/125 (4%)

Query: 3   QCIIFIINIVVVFFIDVMGFFILMKCGADPFY-SRIFSIAVAFLVTWIPSRLFIFLKLRR 61
           +   F         ++++ F ++          + + +  VA +  ++  R F +    +
Sbjct: 14  EVAKFGAVGGAGVLVNLLVFNLVRHVTDLQVVRASVIATVVAIVFNYVGFRYFAYRDRDK 73

Query: 62  K-SFLETVRYGVMYFMLSILNYAFYVKLLLTFQGLQPL---LATVLSAVSSMLFVFLLYI 117
                E V + +   +  ++           F    PL   +   +    + LF F  Y 
Sbjct: 74  SGRTRELVLFLLFSAVGLVIENGVLYVATYGFDWNSPLQNNVFKFVGIGVATLFRFWSYR 133

Query: 118 RFMTR 122
            ++ R
Sbjct: 134 TWVFR 138


>gi|119960964|ref|YP_947090.1| GtrA-like family protein [Arthrobacter aurescens TC1]
 gi|119947823|gb|ABM06734.1| putative membrane protein, GtrA-like family [Arthrobacter aurescens
           TC1]
          Length = 189

 Score = 72.6 bits (177), Expect = 2e-11,   Method: Composition-based stats.
 Identities = 22/127 (17%), Positives = 46/127 (36%), Gaps = 7/127 (5%)

Query: 2   KQCIIFIINIVVVFFIDVMGFFILMK--CGADPFYSRIFSIAVAFLVTWIPSRLFIFLKL 59
           ++   F     V F ID   F  L          +++  +  VA + +W+ +R + F   
Sbjct: 18  REVAKFGAVGGVAFVIDSAVFIWLFSGPMHGSEVWAKAIATIVASVFSWVANRFWTFRHR 77

Query: 60  RR-KSFLETVRYGVMYFMLSILNYAFYVKLLLTFQGLQ----PLLATVLSAVSSMLFVFL 114
           ++     E V +GVM  +  ++            +        +  +V+  V   +F F 
Sbjct: 78  KQANVVREAVLFGVMNVIGLLIASGCVWFAKYILELNDKPSLFIAGSVVGLVLGTIFRFF 137

Query: 115 LYIRFMT 121
            Y  ++ 
Sbjct: 138 AYRFWVF 144



 Score = 39.9 bits (92), Expect = 0.13,   Method: Composition-based stats.
 Identities = 7/59 (11%), Positives = 26/59 (44%)

Query: 64  FLETVRYGVMYFMLSILNYAFYVKLLLTFQGLQPLLATVLSAVSSMLFVFLLYIRFMTR 122
           + E  ++G +  +  +++ A ++ L         + A  ++ + + +F ++    +  R
Sbjct: 17  WREVAKFGAVGGVAFVIDSAVFIWLFSGPMHGSEVWAKAIATIVASVFSWVANRFWTFR 75


>gi|145590897|ref|YP_001152899.1| dolichyl-phosphate beta-D-mannosyltransferase [Pyrobaculum
           arsenaticum DSM 13514]
 gi|145282665|gb|ABP50247.1| Dolichyl-phosphate beta-D-mannosyltransferase [Pyrobaculum
           arsenaticum DSM 13514]
          Length = 339

 Score = 72.6 bits (177), Expect = 2e-11,   Method: Composition-based stats.
 Identities = 15/118 (12%), Positives = 37/118 (31%), Gaps = 4/118 (3%)

Query: 5   IIFIINIVVVFFIDVMGFFILMKCGADPFYSRIFSIAVAFLVTWIPSRLFIFLKLRRKSF 64
           + F         + +     L         S   +I V+    +I +R + F +      
Sbjct: 226 VKFAAVGATGIGVALAVLHFLSWL--PALVSTAIAIEVSLTSNYILNRAWTFAERHTPLL 283

Query: 65  LETVRYGVMYFMLSILNYAFYVKLLLTFQGLQPLLATVLSAVSSMLFVFLLYIRFMTR 122
               +Y +   + +  NY       L F G+   +A ++   +     ++     + +
Sbjct: 284 GGWAKYHLATAIGNSTNYLVTNA--LAFLGVWIYVAYLIGVAAGYAANYVFSELEVFK 339


>gi|118590658|ref|ZP_01548059.1| Dolichyl-phosphate beta-D-mannosyltransferase [Stappia aggregata
           IAM 12614]
 gi|118436634|gb|EAV43274.1| Dolichyl-phosphate beta-D-mannosyltransferase [Stappia aggregata
           IAM 12614]
          Length = 390

 Score = 72.6 bits (177), Expect = 2e-11,   Method: Composition-based stats.
 Identities = 10/124 (8%), Positives = 36/124 (29%), Gaps = 5/124 (4%)

Query: 3   QCIIFIINIVVVFFIDVMGFFILMKCGADPFYSRIFSIAVAFLVTWIPSRLFIFLKLRRK 62
           + ++F +      F+ +    + +    +   ++  +  VA    +  +    +   R  
Sbjct: 268 RFLMFGLVGASGLFVHLAALRVFLLSDMEFNLAQTAASFVAMTSNFFLNNQLTYRDRRLT 327

Query: 63  SFL---ETVRYGVMYFMLSILNYAFYVKLLLTFQGLQPLLATVLSAVSSMLFVFLLYIRF 119
                   + +  +  +  + N       L+         A    A+   ++ +      
Sbjct: 328 GMRVLIGLLTFYAVCSVGVLANVGV--ANLIYADPSYWWFAGTAGAIMGAVWNYAASSAL 385

Query: 120 MTRR 123
             R+
Sbjct: 386 TWRK 389


>gi|315443321|ref|YP_004076200.1| glycosyl transferase [Mycobacterium sp. Spyr1]
 gi|315261624|gb|ADT98365.1| glycosyl transferase [Mycobacterium sp. Spyr1]
          Length = 411

 Score = 72.6 bits (177), Expect = 2e-11,   Method: Composition-based stats.
 Identities = 22/125 (17%), Positives = 47/125 (37%), Gaps = 5/125 (4%)

Query: 1   MKQCIIFIINIVVVFFIDVMGFFILMKCGADPFYSRIFSIAVAFLVTWIPSRLFIFLKLR 60
           ++Q + F    VV   +     F+LM+  A P  + + ++ +  L     +R F F    
Sbjct: 276 LRQAVRFGAVGVVST-VAYTVLFLLMQGWAGPQPANVIALLLTALGNTAANRRFTFGVGG 334

Query: 61  RKSFL----ETVRYGVMYFMLSILNYAFYVKLLLTFQGLQPLLATVLSAVSSMLFVFLLY 116
           R        E +    +   L+    A    +  +   L  L   V++ + + +  F+L 
Sbjct: 335 RHRRGRHHVEGLIVFAIALALTSGALALLHAVAESPHHLVELAVLVVANLLATVVRFVLL 394

Query: 117 IRFMT 121
             ++ 
Sbjct: 395 RGWVF 399


>gi|288916467|ref|ZP_06410844.1| GtrA family protein [Frankia sp. EUN1f]
 gi|288352067|gb|EFC86267.1| GtrA family protein [Frankia sp. EUN1f]
          Length = 161

 Score = 72.6 bits (177), Expect = 2e-11,   Method: Composition-based stats.
 Identities = 23/127 (18%), Positives = 42/127 (33%), Gaps = 6/127 (4%)

Query: 1   MKQCIIFIINIVVVFFIDVMGFFIL-MKCGADPFYSRIFSIAVAFLVTWIPSRLFIFLKL 59
           + +   F I   + + ID     +     G  P  ++  S  +A    +I +R + F   
Sbjct: 10  IHEVGKFGIVGAICYAIDFAVSNLCHTLLGMGPLSAKTVSTVIAATCAYIGNRQWSFSHR 69

Query: 60  -RRKSFLETVRYGVMYFMLSILNYAFY----VKLLLTFQGLQPLLATVLSAVSSMLFVFL 114
            R     E   + V+  +   +  A        L L       L   VL      +F F 
Sbjct: 70  ARTGVRREYSLFVVLNAIGLAIALACLGFARYVLGLEGVVAFNLFGNVLGTGLGTIFRFW 129

Query: 115 LYIRFMT 121
            Y +++ 
Sbjct: 130 AYKKYVF 136


>gi|239944010|ref|ZP_04695947.1| putative sugar transferase [Streptomyces roseosporus NRRL 15998]
 gi|239990465|ref|ZP_04711129.1| putative sugar transferase [Streptomyces roseosporus NRRL 11379]
          Length = 519

 Score = 72.6 bits (177), Expect = 2e-11,   Method: Composition-based stats.
 Identities = 17/118 (14%), Positives = 44/118 (37%), Gaps = 4/118 (3%)

Query: 1   MKQCIIFIINIVVVFFIDVMGFFILMKCGADPFYSRIFSIAVAFLVTWIPSRLFIFLKLR 60
           ++Q   F++   V   + +  +  L +       + +    V+ + +++ +         
Sbjct: 370 VRQFGSFVLIGCVNTAVYLGVYASLNRW-IPYLTAHVIGYVVSIVCSFLLNSYVT--CRT 426

Query: 61  RKSFLETVRYGVMYFMLSILNYAFYVKLLLTFQGLQPLLATVLSAVSSMLFVFLLYIR 118
           R ++   VRY +   +  + + A      ++  G+   LA + + V      FLL   
Sbjct: 427 RPTWHAFVRYPLSSLVNLVASGALLYGA-VSGLGMDKNLAALAAGVIVTPVSFLLARW 483


>gi|149175284|ref|ZP_01853906.1| glycosyltransferase involved in cell wall biogenesis [Planctomyces
           maris DSM 8797]
 gi|148845893|gb|EDL60234.1| glycosyltransferase involved in cell wall biogenesis [Planctomyces
           maris DSM 8797]
          Length = 379

 Score = 72.6 bits (177), Expect = 2e-11,   Method: Composition-based stats.
 Identities = 20/123 (16%), Positives = 45/123 (36%), Gaps = 4/123 (3%)

Query: 4   CIIFIINIVVVFFIDVMGFFILMKCGADPFYSRIFSIAVAFLVTWIPSRLFIFL-KLRRK 62
              F +  +   F+++    +L      P  +   +I  +    ++ +R   F     + 
Sbjct: 238 FTQFALIGLTGVFVNLQMLALLSNWMISP-IAVALAIWTSMSTNFLLNRNITFSYARHKP 296

Query: 63  SFLETVRYGVMYFMLSILNYAFYVKLLLTFQGLQ--PLLATVLSAVSSMLFVFLLYIRFM 120
              + + Y       ++ N+   + L  +FQ  +   LLA  +  +  M F FLL    +
Sbjct: 297 FLKQYLSYCGSCLTGAVFNWLTTMVLSRSFQFFEKRILLAAFIGILVGMGFNFLLCRYLV 356

Query: 121 TRR 123
             +
Sbjct: 357 FSK 359



 Score = 36.8 bits (84), Expect = 0.89,   Method: Composition-based stats.
 Identities = 8/67 (11%), Positives = 23/67 (34%), Gaps = 4/67 (5%)

Query: 1   MKQCIIFIINIVVVFFIDVMGFFILM----KCGADPFYSRIFSIAVAFLVTWIPSRLFIF 56
           +KQ + +  + +     + +   +L             +    I V     ++  R  +F
Sbjct: 298 LKQYLSYCGSCLTGAVFNWLTTMVLSRSFQFFEKRILLAAFIGILVGMGFNFLLCRYLVF 357

Query: 57  LKLRRKS 63
            K + ++
Sbjct: 358 SKHKPEA 364


>gi|291447478|ref|ZP_06586868.1| sugar transferase [Streptomyces roseosporus NRRL 15998]
 gi|291350425|gb|EFE77329.1| sugar transferase [Streptomyces roseosporus NRRL 15998]
          Length = 514

 Score = 72.2 bits (176), Expect = 2e-11,   Method: Composition-based stats.
 Identities = 17/118 (14%), Positives = 44/118 (37%), Gaps = 4/118 (3%)

Query: 1   MKQCIIFIINIVVVFFIDVMGFFILMKCGADPFYSRIFSIAVAFLVTWIPSRLFIFLKLR 60
           ++Q   F++   V   + +  +  L +       + +    V+ + +++ +         
Sbjct: 365 VRQFGSFVLIGCVNTAVYLGVYASLNRW-IPYLTAHVIGYVVSIVCSFLLNSYVT--CRT 421

Query: 61  RKSFLETVRYGVMYFMLSILNYAFYVKLLLTFQGLQPLLATVLSAVSSMLFVFLLYIR 118
           R ++   VRY +   +  + + A      ++  G+   LA + + V      FLL   
Sbjct: 422 RPTWHAFVRYPLSSLVNLVASGALLYGA-VSGLGMDKNLAALAAGVIVTPVSFLLARW 478


>gi|118474028|ref|YP_889238.1| glycosyl transferase [Mycobacterium smegmatis str. MC2 155]
 gi|118175315|gb|ABK76211.1| glycosyl transferase [Mycobacterium smegmatis str. MC2 155]
          Length = 432

 Score = 72.2 bits (176), Expect = 2e-11,   Method: Composition-based stats.
 Identities = 17/125 (13%), Positives = 43/125 (34%), Gaps = 5/125 (4%)

Query: 1   MKQCIIFIINIVVVFFIDVMGFFILMKCGADPFYSRIFSIAVAFLVTWIPSRLFIFLKLR 60
           ++Q + F    VV      +  F LM+ G     + + ++ +  +     +R F F    
Sbjct: 292 LRQVVRFGAIGVVSTLA-YLLLFSLMRAGLGAQAANLIALLLTAIGNTAANRRFTFGIAG 350

Query: 61  R----KSFLETVRYGVMYFMLSILNYAFYVKLLLTFQGLQPLLATVLSAVSSMLFVFLLY 116
                +  LE +    +   ++  +      +         L   V + + + +  F+L 
Sbjct: 351 TGNVARHHLEGLTVFGIALTITSGSLYLLHVMTPQPHRAVELGVLVAANLIATVVRFVLL 410

Query: 117 IRFMT 121
             ++ 
Sbjct: 411 RGWVF 415


>gi|190889939|ref|YP_001976481.1| hypothetical protein [Rhizobium etli CIAT 652]
 gi|190695218|gb|ACE89303.1| hypothetical conserved membrane protein [Rhizobium etli CIAT 652]
          Length = 124

 Score = 72.2 bits (176), Expect = 2e-11,   Method: Composition-based stats.
 Identities = 43/123 (34%), Positives = 67/123 (54%), Gaps = 1/123 (0%)

Query: 1   MKQCIIFIINIVVVFFIDVMGFFILMKCGA-DPFYSRIFSIAVAFLVTWIPSRLFIFLKL 59
           MK+ I F I   + F +D      L+      PF +R+ +IA+A   TW+ +R F F + 
Sbjct: 1   MKKLIRFAIAGGIGFLVDAGVLSALLSLTPLGPFVARLIAIALAMASTWVFNRNFTFDRS 60

Query: 60  RRKSFLETVRYGVMYFMLSILNYAFYVKLLLTFQGLQPLLATVLSAVSSMLFVFLLYIRF 119
            R    E  RYG +    +++NY  Y  LLL+  GLQPL A V++++++M+F F  Y R 
Sbjct: 61  GRSLAAEGFRYGSVGITAALVNYGLYSALLLSLPGLQPLAAMVVASIAAMVFSFFGYSRL 120

Query: 120 MTR 122
           + R
Sbjct: 121 VFR 123


>gi|302036825|ref|YP_003797147.1| glycosyl transferase family 2 protein [Candidatus Nitrospira
           defluvii]
 gi|190343239|gb|ACE75627.1| dolichyl-phosphate beta-D-mannosyltransferase [Candidatus
           Nitrospira defluvii]
 gi|300604889|emb|CBK41222.1| Glycosyl transferase, family 2, with GtrA domain [Candidatus
           Nitrospira defluvii]
          Length = 364

 Score = 72.2 bits (176), Expect = 2e-11,   Method: Composition-based stats.
 Identities = 9/123 (7%), Positives = 39/123 (31%), Gaps = 6/123 (4%)

Query: 3   QCIIFIINIVVVFFIDVMGFFILM-KCGADPFYSRIFSIAVAFLVTWIPSRLFIFLKLRR 61
           + + F +       I     ++L         + +  +  +A    +I + +  +   R 
Sbjct: 239 RLVTFCLVGGSGVLIHFSVLWVLYRWLAMPFAWGQGVATVLAMTSNFILNNVITYRDQRL 298

Query: 62  KSF---LETVRYGVMYFMLSILNYAFYVKLLLTFQGLQPLLATVLSAVSSMLFVFLLYIR 118
           + +      + + ++  + ++ N      L          L+ +   +   ++ + +   
Sbjct: 299 RGWQWLRGWLSFVLVCSLGAVGNVGVASYLFTQQFHWG--LSALAGILVGTVWNYAVTSS 356

Query: 119 FMT 121
           +  
Sbjct: 357 YTW 359


>gi|325110030|ref|YP_004271098.1| Dolichyl-phosphate beta-D-mannosyltransferase [Planctomyces
           brasiliensis DSM 5305]
 gi|324970298|gb|ADY61076.1| Dolichyl-phosphate beta-D-mannosyltransferase [Planctomyces
           brasiliensis DSM 5305]
          Length = 957

 Score = 72.2 bits (176), Expect = 2e-11,   Method: Composition-based stats.
 Identities = 18/121 (14%), Positives = 47/121 (38%), Gaps = 4/121 (3%)

Query: 7   FIINIVVVFFIDVMGFFILMKCGADPFYSRIFSIAVAFLVTWIPSRLFIFLKLRR-KSFL 65
           F    +    +D++ F  L+       ++R  +I  A    ++ +R   F + RR    +
Sbjct: 266 FAAVGLSGAVVDLVLFTALLTVANFG-WARGIAIFGAMTWNFVGNRHTTFAERRRESVLM 324

Query: 66  ETVRYGVMYFMLSILNYAFYVKLLLTFQGL--QPLLATVLSAVSSMLFVFLLYIRFMTRR 123
           +  ++     +   +++     +   F      P  A  +  ++  ++ +LL   F+ R+
Sbjct: 325 QYAKFVGSCLVGGAVSWGVSSLMWKQFGATLQAPQFAAAIGILAGAVWNYLLSAHFVFRK 384

Query: 124 V 124
            
Sbjct: 385 P 385


>gi|148241361|ref|YP_001226518.1| glycosyltransferase [Synechococcus sp. RCC307]
 gi|147849671|emb|CAK27165.1| Possible glycosyltransferase [Synechococcus sp. RCC307]
          Length = 392

 Score = 72.2 bits (176), Expect = 2e-11,   Method: Composition-based stats.
 Identities = 16/128 (12%), Positives = 47/128 (36%), Gaps = 4/128 (3%)

Query: 2   KQCIIFIINIVVVFFIDVMGFFILMKCGADPFYSRIFSIAVAFLVTWIPSRLFIFLKLRR 61
           ++ + F +  V    + V  + +L   G   F +++ ++  A    ++ +    F   R 
Sbjct: 265 RRAVSFGMVGVSGMVVHVGLYALLRSAGVGFFGTQVVAVITAACSNYLINNSLTFRSRRL 324

Query: 62  KSFL---ETVRYGVMYFMLSILNYAFYVKLLLTFQGLQP-LLATVLSAVSSMLFVFLLYI 117
           +        +++ ++  +    N      +  + QG    ++A     +   ++ +    
Sbjct: 325 RGRSLVIGLLKFLLVSSLGMAANVGVSTVVFASLQGGPIAMIAVASGILVDFIWKYAASS 384

Query: 118 RFMTRRVY 125
           RF+    Y
Sbjct: 385 RFVWNVPY 392


>gi|308071067|ref|YP_003872672.1| membrane protein [Paenibacillus polymyxa E681]
 gi|305860346|gb|ADM72134.1| Predicted membrane protein [Paenibacillus polymyxa E681]
          Length = 139

 Score = 72.2 bits (176), Expect = 2e-11,   Method: Composition-based stats.
 Identities = 19/119 (15%), Positives = 46/119 (38%), Gaps = 2/119 (1%)

Query: 4   CIIFIINIVVVFFIDVMGFFILMK-CGADPFYSRIFSIAVAFLVTWIPSRLFIFLKLRRK 62
            I + I  ++   I V    +L++        +      V  LV+++ +R + F      
Sbjct: 11  IIKYGIVGLLGTGIHVGVLVLLVEMFTVPAVTATTIGFVVTLLVSYVLNRNWTFEPTGEG 70

Query: 63  SFLETVRYGVMYFMLSILNYAFYVKLLLTFQGLQPLLATVLSAVSSMLFVFLLYIRFMT 121
           S  + ++Y ++     +LN A     +    G   L+  VL+ +   +  ++    ++ 
Sbjct: 71  SRTQFLKYLLVCTCGLLLNAALMYVTIHWI-GWSYLIGEVLTTIIVPVHNYIWNRYWIF 128



 Score = 33.7 bits (76), Expect = 8.0,   Method: Composition-based stats.
 Identities = 6/61 (9%), Positives = 25/61 (40%), Gaps = 1/61 (1%)

Query: 3   QCIIFIINIVVVFFIDVMGFFI-LMKCGADPFYSRIFSIAVAFLVTWIPSRLFIFLKLRR 61
           Q + +++       ++    ++ +   G       + +  +  +  +I +R +IF   ++
Sbjct: 74  QFLKYLLVCTCGLLLNAALMYVTIHWIGWSYLIGEVLTTIIVPVHNYIWNRYWIFSVPQQ 133

Query: 62  K 62
           +
Sbjct: 134 R 134


>gi|269977893|ref|ZP_06184847.1| GtrA family protein [Mobiluncus mulieris 28-1]
 gi|307700135|ref|ZP_07637181.1| GtrA-like protein [Mobiluncus mulieris FB024-16]
 gi|269933859|gb|EEZ90439.1| GtrA family protein [Mobiluncus mulieris 28-1]
 gi|307614684|gb|EFN93907.1| GtrA-like protein [Mobiluncus mulieris FB024-16]
          Length = 165

 Score = 72.2 bits (176), Expect = 2e-11,   Method: Composition-based stats.
 Identities = 17/126 (13%), Positives = 47/126 (37%), Gaps = 7/126 (5%)

Query: 3   QCIIFIINIVVVFFIDVMGFFILMKCG--ADPFYSRIFSIAVAFLVTWIPSRLFIFLKL- 59
           +   F++     + +D+  F + +       P + +  ++AVA   +WI +R + F +  
Sbjct: 32  EIAKFLMVGGANYVVDLAVFNLFLLWLTPQWPLFDKCVAVAVATTFSWIANRSWTFRERG 91

Query: 60  RRKSFLETVRYGVMYFMLSILNYAFYVKLLL----TFQGLQPLLATVLSAVSSMLFVFLL 115
                 E + + ++  + ++   A           T      + A ++  +      ++L
Sbjct: 92  GHGVAKEALLFVLVNVIGALPPLACLWVSHYLLSFTSPLADNISANIIGLIIGTALRYVL 151

Query: 116 YIRFMT 121
           Y   + 
Sbjct: 152 YKLVVF 157



 Score = 36.4 bits (83), Expect = 1.5,   Method: Composition-based stats.
 Identities = 9/62 (14%), Positives = 25/62 (40%)

Query: 61  RKSFLETVRYGVMYFMLSILNYAFYVKLLLTFQGLQPLLATVLSAVSSMLFVFLLYIRFM 120
           R ++ E  ++ ++     +++ A +   LL      PL    ++   +  F ++    + 
Sbjct: 27  RNNWSEIAKFLMVGGANYVVDLAVFNLFLLWLTPQWPLFDKCVAVAVATTFSWIANRSWT 86

Query: 121 TR 122
            R
Sbjct: 87  FR 88


>gi|186477046|ref|YP_001858516.1| glycosyl transferase family protein [Burkholderia phymatum STM815]
 gi|184193505|gb|ACC71470.1| glycosyl transferase family 2 [Burkholderia phymatum STM815]
          Length = 376

 Score = 72.2 bits (176), Expect = 2e-11,   Method: Composition-based stats.
 Identities = 14/125 (11%), Positives = 40/125 (32%), Gaps = 6/125 (4%)

Query: 3   QCIIFIINIVVVFFIDVMGF-FILMKCGADPFYSRIFSIAVAFLVTWIPSRLFIFLKLRR 61
           + ++F+I       + +      L   G     +++ +  VA    ++ +    +   R 
Sbjct: 254 RFLMFLIVGATGIAVHLAVLQTALHAFGMAFPSAQLTATLVAMAWNFVLNNQLTYRDRRL 313

Query: 62  KSFL---ETVRYGVMYFMLSILNYAFYVKLLLTFQGLQPLLATVLSAVSSMLFVFLLYIR 118
           K          + ++  + +  N      L+        +LA +  A+   +F +     
Sbjct: 314 KGIKFVIGMATFYLVCSLGTFANVGAASWLVQFEP--NQILAGLAGAILGAVFNYAASSV 371

Query: 119 FMTRR 123
               +
Sbjct: 372 LTWHK 376


>gi|294498879|ref|YP_003562579.1| GtrA-like protein [Bacillus megaterium QM B1551]
 gi|294348816|gb|ADE69145.1| GtrA-like protein [Bacillus megaterium QM B1551]
          Length = 134

 Score = 72.2 bits (176), Expect = 2e-11,   Method: Composition-based stats.
 Identities = 24/118 (20%), Positives = 56/118 (47%), Gaps = 1/118 (0%)

Query: 4   CIIFIINIVVVFFIDVMGFFILMKCGADPFYSRIFSIAVAFLVTWIPSRLFIFLKLRRKS 63
            I F +  VV   ID + + +L   G +   ++  S +V  L +++ +R + F +  + S
Sbjct: 8   FIKFALVGVVNTLIDFVVYALLTTIGVNYILAQWISYSVGILNSYVMNRKWTFERKEKSS 67

Query: 64  FLETVRYGVMYFMLSILNYAFYVKLLLTFQGLQPLLATVLSAVSSMLFVFLLYIRFMT 121
             E + + ++  +   L  +F + +L    G+  L++ +L  ++S+   F+    F+ 
Sbjct: 68  KREVISFVIVNLITLSLT-SFLLTVLYNKWGIPLLISKLLITIASVGINFIGTKLFVF 124


>gi|111021062|ref|YP_704034.1| hypothetical protein RHA1_ro04079 [Rhodococcus jostii RHA1]
 gi|110820592|gb|ABG95876.1| conserved hypothetical protein [Rhodococcus jostii RHA1]
          Length = 178

 Score = 72.2 bits (176), Expect = 2e-11,   Method: Composition-based stats.
 Identities = 16/123 (13%), Positives = 46/123 (37%), Gaps = 5/123 (4%)

Query: 3   QCIIFIINIVVVFFIDVMGFFILMKC-GADPFYSRIFSIAVAFLVTWIPSRLFIFLKLRR 61
           Q I F++   +   +D   + +L +  G     ++  S        ++ +R + F     
Sbjct: 56  QIIRFVLTGGLSAIVDFGLYVLLFEVVGLPVNVAKSISFIAGTTTAYLINRRWTFKAEPS 115

Query: 62  KSFLETVRYGVMYFMLSILNYAFYVKLLLTFQ--GLQPLLATVLSAVSSMLFVFLLYIRF 119
           ++    V   ++Y +   +       +   F     +  LA V++  ++ +  F++    
Sbjct: 116 RA--RFVAVVILYAVTFAVQVGLNWVMYHAFPDEWWRLPLAFVIAQGTATVINFVVQRAV 173

Query: 120 MTR 122
           + +
Sbjct: 174 IFK 176


>gi|262200826|ref|YP_003272034.1| glycosyl transferase family 2 protein [Gordonia bronchialis DSM
           43247]
 gi|262084173|gb|ACY20141.1| glycosyl transferase family 2 [Gordonia bronchialis DSM 43247]
          Length = 422

 Score = 72.2 bits (176), Expect = 2e-11,   Method: Composition-based stats.
 Identities = 20/126 (15%), Positives = 45/126 (35%), Gaps = 6/126 (4%)

Query: 1   MKQCIIFIINIVVVFFIDVMGFFILMKCGADPFYSRIFSIAVAFLVTWIPSRLFIFLKLR 60
           + Q   F +  V    I     ++L+        S   ++AV  ++    +R F F    
Sbjct: 287 VGQLARFCVVGVAST-IAYAVLYLLLHSFLGAQVSNFVALAVTAVLNTAANRRFSFGVRG 345

Query: 61  RKSFLETVRYGV-MYFMLSILNYAFYVKLLLTFQGLQ---PLLATVLSAVSSMLFVFLLY 116
           R+  L    +G+ ++    I+     + L            L   V++ + + +  F+  
Sbjct: 346 REDALRHQMFGLGVFLFGWIVTAGSLLGLHHFVPDATKHVELAVLVIANLVATMTRFVGL 405

Query: 117 IRFMTR 122
             ++ R
Sbjct: 406 R-WVFR 410


>gi|116493432|ref|YP_805167.1| glycosyltransferase-like protein [Pediococcus pentosaceus ATCC
           25745]
 gi|116103582|gb|ABJ68725.1| Glycosyltransferase related enzyme [Pediococcus pentosaceus ATCC
           25745]
          Length = 365

 Score = 72.2 bits (176), Expect = 2e-11,   Method: Composition-based stats.
 Identities = 18/127 (14%), Positives = 51/127 (40%), Gaps = 6/127 (4%)

Query: 3   QCIIFIINIVVVFFIDVMGFFILMKCGADPFY-----SRIFSIAVAFLVTWIPSRLFIFL 57
           +   F  + ++ F +D+  F  ++    +        + + S A++ +V +  +   +F 
Sbjct: 227 RFFKFAGSGIISFIVDIALFEGIILLMGNHVLDSIILATVISRALSAVVNYTLNHRVVFN 286

Query: 58  KLRRKSFLET-VRYGVMYFMLSILNYAFYVKLLLTFQGLQPLLATVLSAVSSMLFVFLLY 116
              R++F++    + V   +   L       L      + P+LA +L   +  +  + + 
Sbjct: 287 GGGRQTFIKYGALFIVQMILSGYLTDLVTNWLPHNGNSIAPMLAKMLVDFTLFIISYQIQ 346

Query: 117 IRFMTRR 123
             F+ ++
Sbjct: 347 KDFIFKK 353



 Score = 34.5 bits (78), Expect = 5.4,   Method: Composition-based stats.
 Identities = 13/77 (16%), Positives = 29/77 (37%), Gaps = 5/77 (6%)

Query: 50  PSRLFIFLKLRRKSF--LETVRYGVMYFMLSILNYAFYVKLLLTFQGL---QPLLATVLS 104
            ++   F  +R          ++     +  I++ A +  ++L          +LATV+S
Sbjct: 209 GNKSSHFRVVRDSLAIYARFFKFAGSGIISFIVDIALFEGIILLMGNHVLDSIILATVIS 268

Query: 105 AVSSMLFVFLLYIRFMT 121
              S +  + L  R + 
Sbjct: 269 RALSAVVNYTLNHRVVF 285


>gi|86355931|ref|YP_467823.1| hypothetical protein RHE_CH00273 [Rhizobium etli CFN 42]
 gi|86280033|gb|ABC89096.1| hypothetical conserved membrane protein [Rhizobium etli CFN 42]
          Length = 124

 Score = 72.2 bits (176), Expect = 2e-11,   Method: Composition-based stats.
 Identities = 44/123 (35%), Positives = 68/123 (55%), Gaps = 1/123 (0%)

Query: 1   MKQCIIFIINIVVVFFIDVMGFFILMKCGA-DPFYSRIFSIAVAFLVTWIPSRLFIFLKL 59
           MK+ I F I   + F +D      L+      PF +R+ +IA A   TW+ +R F F + 
Sbjct: 1   MKKLIRFAIAGGIGFLVDAGVLSALLDLTPLGPFVARLIAIAFAMASTWVFNRNFTFDRS 60

Query: 60  RRKSFLETVRYGVMYFMLSILNYAFYVKLLLTFQGLQPLLATVLSAVSSMLFVFLLYIRF 119
            R   +E  RYG +    +++NY  Y  LLL+  GLQPL A V++++++M+F F  Y RF
Sbjct: 61  GRSLAVEGFRYGSVGVTAALVNYGLYSALLLSLPGLQPLAAMVVASIAAMVFSFFGYSRF 120

Query: 120 MTR 122
           + R
Sbjct: 121 VFR 123


>gi|307728827|ref|YP_003906051.1| Dolichyl-phosphate beta-D-mannosyltransferase [Burkholderia sp.
           CCGE1003]
 gi|307583362|gb|ADN56760.1| Dolichyl-phosphate beta-D-mannosyltransferase [Burkholderia sp.
           CCGE1003]
          Length = 376

 Score = 71.9 bits (175), Expect = 2e-11,   Method: Composition-based stats.
 Identities = 14/125 (11%), Positives = 40/125 (32%), Gaps = 6/125 (4%)

Query: 3   QCIIFIINIVVVFFIDVMGF-FILMKCGADPFYSRIFSIAVAFLVTWIPSRLFIFLKLRR 61
           + ++F+I       + +      L   G     +++ +  VA    ++ +    +   R 
Sbjct: 254 RFLMFLIVGATGIAVHLAVLQTALHAFGLSFPAAQLTATLVAMAWNFVLNNQLTYRDRRL 313

Query: 62  KSFL---ETVRYGVMYFMLSILNYAFYVKLLLTFQGLQPLLATVLSAVSSMLFVFLLYIR 118
           K          + ++  + +  N      L+        +LA +  A+   +F +     
Sbjct: 314 KGIKFMIGMATFYLVCSLGTFANVGAASWLVQFEP--NQILAGLAGAILGAVFNYAASSV 371

Query: 119 FMTRR 123
               +
Sbjct: 372 LTWHK 376


>gi|28192479|gb|AAM77992.1| glycosyltransferase [Streptomyces carzinostaticus subsp.
           neocarzinostaticus]
          Length = 402

 Score = 71.9 bits (175), Expect = 3e-11,   Method: Composition-based stats.
 Identities = 14/122 (11%), Positives = 37/122 (30%), Gaps = 2/122 (1%)

Query: 2   KQCIIFIINIVVVFFIDVMGFFILMKCGADPFYSRIFSIAVAFLVTWIPSRLFIFLKLRR 61
           ++ + F +       +  + F++L         +    + +A ++    +R   F    R
Sbjct: 270 RRFLRFAMVGTASGLLH-VLFYLLFTTVMPTLAANALGLFLATVLNTAANRRITFGVRGR 328

Query: 62  K-SFLETVRYGVMYFMLSILNYAFYVKLLLTFQGLQPLLATVLSAVSSMLFVFLLYIRFM 120
           +       +  V + +         +           L   +   V + L  F L   ++
Sbjct: 329 QDVLRHQAKGFVAFLLGLACTSTALLAAGPGSGRTVELTVLLAGDVLASLVRFALLRHWV 388

Query: 121 TR 122
            R
Sbjct: 389 FR 390


>gi|306819240|ref|ZP_07452951.1| integral membrane protein [Mobiluncus mulieris ATCC 35239]
 gi|304648022|gb|EFM45336.1| integral membrane protein [Mobiluncus mulieris ATCC 35239]
          Length = 165

 Score = 71.9 bits (175), Expect = 3e-11,   Method: Composition-based stats.
 Identities = 17/126 (13%), Positives = 46/126 (36%), Gaps = 7/126 (5%)

Query: 3   QCIIFIINIVVVFFIDVMGFFILMKCG--ADPFYSRIFSIAVAFLVTWIPSRLFIFLKL- 59
           +   F+      + +D+  F + +       P + +  ++AVA   +WI +R + F +  
Sbjct: 32  EIAKFLTVGGANYVVDLAVFNLFLLWLTPQWPLFDKCVAVAVATTFSWIANRSWTFRERG 91

Query: 60  RRKSFLETVRYGVMYFMLSILNYAFYVKLLL----TFQGLQPLLATVLSAVSSMLFVFLL 115
                 E + + ++  + ++   A           T      + A ++  +      ++L
Sbjct: 92  GHGVAKEALLFVLVNVIGALPPLACLWVSHYLLSFTSPLADNISANIIGLIIGTALRYVL 151

Query: 116 YIRFMT 121
           Y   + 
Sbjct: 152 YKLVVF 157



 Score = 36.0 bits (82), Expect = 1.5,   Method: Composition-based stats.
 Identities = 9/62 (14%), Positives = 24/62 (38%)

Query: 61  RKSFLETVRYGVMYFMLSILNYAFYVKLLLTFQGLQPLLATVLSAVSSMLFVFLLYIRFM 120
           R ++ E  ++  +     +++ A +   LL      PL    ++   +  F ++    + 
Sbjct: 27  RNNWSEIAKFLTVGGANYVVDLAVFNLFLLWLTPQWPLFDKCVAVAVATTFSWIANRSWT 86

Query: 121 TR 122
            R
Sbjct: 87  FR 88


>gi|91773577|ref|YP_566269.1| dolichyl-phosphate beta-D-mannosyltransferase [Methanococcoides
           burtonii DSM 6242]
 gi|91712592|gb|ABE52519.1| Dolichyl-phosphate beta-D-mannosyltransferase like protein with
           GtrA-like C-terminal domain [Methanococcoides burtonii
           DSM 6242]
          Length = 359

 Score = 71.9 bits (175), Expect = 3e-11,   Method: Composition-based stats.
 Identities = 19/127 (14%), Positives = 50/127 (39%), Gaps = 7/127 (5%)

Query: 3   QCIIFIINIVVVFFIDVMGFFILM-KCGADPFYSRIFSIAVAFLVTWIPSRLFIFLKLRR 61
           + I ++I       +      +     G     S   +I VA L  +I + ++ F   R 
Sbjct: 235 EYIKYMIVGSFGALLHFSILTLFYKNIGYTYSISLAIAILVAILFNYIYNNIWTFKDYRL 294

Query: 62  ---KSFLETVRYGVMYFMLSILNYAFYVKLLLTFQGLQPLLATVLSAVSSMLFVFLLYIR 118
                    ++Y ++ F+ ++ NY+  + L+     +  ++A+++ A     + +L    
Sbjct: 295 TDISLITGYLKYNLLCFVGALANYSVSMYLI---DHMSWIIASMVGAFVGANWNYLTNSI 351

Query: 119 FMTRRVY 125
           +  +  +
Sbjct: 352 YTWKTKH 358


>gi|254295219|ref|YP_003061242.1| Dolichyl-phosphate beta-D-mannosyltransferase [Hirschia baltica
           ATCC 49814]
 gi|254043750|gb|ACT60545.1| Dolichyl-phosphate beta-D-mannosyltransferase [Hirschia baltica
           ATCC 49814]
          Length = 374

 Score = 71.9 bits (175), Expect = 3e-11,   Method: Composition-based stats.
 Identities = 10/125 (8%), Positives = 43/125 (34%), Gaps = 6/125 (4%)

Query: 3   QCIIFIINIVVVFFIDVMGFFILMKC-GADPFYSRIFSIAVAFLVTWIPSRLFIFLKLRR 61
           + + F     +   +  +   ++ +      F+ +  ++A++ +  +  +    +   RR
Sbjct: 252 RFVSFAFVGGLGIIVHFLTLTVIYQVVEKSFFWGQAAAMAISMVFNYWLNNKLTYRDKRR 311

Query: 62  ---KSFLETVRYGVMYFMLSILNYAFYVKLLLTFQGLQPLLATVLSAVSSMLFVFLLYIR 118
                F   + +  +  +    N        L  + +  +L+ +   +   ++ +     
Sbjct: 312 TGIHWFTGLLSFMGICSLGGAANVGI--ANFLYAEEMHWVLSALAGIIVGAVWNYAATSL 369

Query: 119 FMTRR 123
           +  R+
Sbjct: 370 YTWRK 374


>gi|307327085|ref|ZP_07606275.1| GtrA family protein [Streptomyces violaceusniger Tu 4113]
 gi|306887383|gb|EFN18379.1| GtrA family protein [Streptomyces violaceusniger Tu 4113]
          Length = 169

 Score = 71.9 bits (175), Expect = 3e-11,   Method: Composition-based stats.
 Identities = 17/120 (14%), Positives = 41/120 (34%), Gaps = 4/120 (3%)

Query: 5   IIFIINIVVVFFIDVMGFFILMKC-GADPFYSRIFSIAVAFLVTWIPSRLFIFLKLRRKS 63
           + F +       ++ +  F+L    G     +   ++ +A +  ++ +  + F      S
Sbjct: 50  LRFAVVGGGGALVNTVVLFVLYHWAGLPLLVASAIAVELAVVHNYLLNDRWTFAV-GTPS 108

Query: 64  FLETVRYGVMYFMLSILNYAFYVKLLLTFQGLQPLLATVLSAVSSMLFVFLLYIRFMTRR 123
               +++ V       +N    +   L   G   LLA  L   ++    F     ++  R
Sbjct: 109 LRRFIKFNVSVLGGLGVN--VLIVWSLVRGGTHLLLANCLGIAAAFAVNFASSTGWVWGR 166



 Score = 38.0 bits (87), Expect = 0.46,   Method: Composition-based stats.
 Identities = 12/61 (19%), Positives = 31/61 (50%)

Query: 1   MKQCIIFIINIVVVFFIDVMGFFILMKCGADPFYSRIFSIAVAFLVTWIPSRLFIFLKLR 60
           +++ I F ++++    ++V+  + L++ G     +    IA AF V +  S  +++ +  
Sbjct: 109 LRRFIKFNVSVLGGLGVNVLIVWSLVRGGTHLLLANCLGIAAAFAVNFASSTGWVWGRRS 168

Query: 61  R 61
           R
Sbjct: 169 R 169


>gi|300023603|ref|YP_003756214.1| dolichyl-phosphate beta-D-mannosyltransferase [Hyphomicrobium
           denitrificans ATCC 51888]
 gi|299525424|gb|ADJ23893.1| Dolichyl-phosphate beta-D-mannosyltransferase [Hyphomicrobium
           denitrificans ATCC 51888]
          Length = 381

 Score = 71.9 bits (175), Expect = 3e-11,   Method: Composition-based stats.
 Identities = 14/125 (11%), Positives = 40/125 (32%), Gaps = 6/125 (4%)

Query: 3   QCIIFIINIVVVFFIDVMGF-FILMKCGADPFYSRIFSIAVAFLVTWIPSRLFIFLKLR- 60
           +  +F +       + +     +L         ++  +  VA    +  +    F   R 
Sbjct: 259 RFFLFALVGATGLVVHLATLRSVLTTTHIPFNAAQFIAALVAMTSNFFLNNALTFRDRRL 318

Query: 61  --RKSFLETVRYGVMYFMLSILNYAFYVKLLLTFQGLQPLLATVLSAVSSMLFVFLLYIR 118
                F   + + ++  + ++ N       L+  +      A +  AV + +F + +   
Sbjct: 319 TGSAVFKGLLTFYLVCSIGTLANVGV--AELIYLRDASWWRAGIAGAVMAAVFNYAVSSM 376

Query: 119 FMTRR 123
              R+
Sbjct: 377 LTWRK 381


>gi|326388981|ref|ZP_08210563.1| hypothetical protein Y88_3726 [Novosphingobium nitrogenifigens DSM
           19370]
 gi|326206581|gb|EGD57416.1| hypothetical protein Y88_3726 [Novosphingobium nitrogenifigens DSM
           19370]
          Length = 666

 Score = 71.9 bits (175), Expect = 3e-11,   Method: Composition-based stats.
 Identities = 17/119 (14%), Positives = 41/119 (34%), Gaps = 1/119 (0%)

Query: 3   QCIIFIINIVVVFFIDVMGFFILMKCGADPFYSRIFSIAVAFLVTWIPSRLFIFLKLRRK 62
           +   F    +V   I      I + CG   + +      +  + ++I +R F F      
Sbjct: 22  RIARFGAVGLVNTAIGAGTIAIGLHCGLGDYAANAAGYGLGLVSSYILNRRFTFRAKGSA 81

Query: 63  SFLETVRYGVMYFMLSILNYAFYVKLLLTFQGLQPLLATVLSAVSSMLFVFLLYIRFMT 121
              E +R+ +   +  ++N    +       G    L  +++  +  +  + L   F+ 
Sbjct: 82  DGREKLRFAMTAGISYLVNLTILLLGRRIGAGGTMAL-QLVAMAAYTMTFYALSRLFVF 139



 Score = 35.6 bits (81), Expect = 2.2,   Method: Composition-based stats.
 Identities = 12/69 (17%), Positives = 31/69 (44%), Gaps = 1/69 (1%)

Query: 2   KQCIIFIINIVVVFFIDVMGFFILMKCGADPFYS-RIFSIAVAFLVTWIPSRLFIFLKLR 60
           ++ + F +   + + +++    +  + GA    + ++ ++A   +  +  SRLF+F    
Sbjct: 84  REKLRFAMTAGISYLVNLTILLLGRRIGAGGTMALQLVAMAAYTMTFYALSRLFVFSANE 143

Query: 61  RKSFLETVR 69
           R S     R
Sbjct: 144 RPSRDRAAR 152



 Score = 33.7 bits (76), Expect = 9.6,   Method: Composition-based stats.
 Identities = 10/61 (16%), Positives = 19/61 (31%), Gaps = 2/61 (3%)

Query: 62  KSFLETVRYGVMYFMLSILNYAFYVKLLLTFQGLQPLLATVLSAVSSMLFVFLLYIRFMT 121
                  R+G +  + + +        L    GL    A        ++  ++L  RF  
Sbjct: 18  SEAGRIARFGAVGLVNTAIGAGTIAIGLH--CGLGDYAANAAGYGLGLVSSYILNRRFTF 75

Query: 122 R 122
           R
Sbjct: 76  R 76


>gi|311896368|dbj|BAJ28776.1| hypothetical protein KSE_29640 [Kitasatospora setae KM-6054]
          Length = 192

 Score = 71.5 bits (174), Expect = 3e-11,   Method: Composition-based stats.
 Identities = 23/132 (17%), Positives = 56/132 (42%), Gaps = 6/132 (4%)

Query: 3   QCIIFIINIVVVFFIDVMGFFILMKC-GADPFYSRIFSIAVAFLVTWIPSRLFIFLKLRR 61
           + + F +   V FF++++ F + ++  G     + + S AVA    ++  R +++     
Sbjct: 21  EAVGFAVIGGVGFFVNLIVFNVCLRADGLINSAAGVISGAVAIGTNYLGYRFWLYKDRDA 80

Query: 62  KSFLE----TVRYGVMYFMLSILNYAFYVKLLLTFQGLQPLLAT-VLSAVSSMLFVFLLY 116
            S        + +  +  ++     AF V +L     L   +A  V+   +  +F FL Y
Sbjct: 81  ASRKREITLFLLFSGIGLLIENGILAFSVHVLGYDSHLSQTIAKNVVGLAAGTVFRFLSY 140

Query: 117 IRFMTRRVYFIK 128
             ++ + +  ++
Sbjct: 141 RTWVFKAMPELE 152


>gi|37523814|ref|NP_927191.1| hypothetical protein glr4245 [Gloeobacter violaceus PCC 7421]
 gi|35214819|dbj|BAC92186.1| glr4245 [Gloeobacter violaceus PCC 7421]
          Length = 687

 Score = 71.5 bits (174), Expect = 3e-11,   Method: Composition-based stats.
 Identities = 22/119 (18%), Positives = 41/119 (34%), Gaps = 1/119 (0%)

Query: 3   QCIIFIINIVVVFFIDVMGFFILMKCGADPFYSRIFSIAVAFLVTWIPSRLFIFLKLRRK 62
           Q   ++I   +   +DV  F  L + G     +   S        ++ SR F+F      
Sbjct: 560 QMGGYLITGGLATVVDVAVFSALTQIGLWYVAALCVSFFGGLTTNFVLSRRFVFGVYWNN 619

Query: 63  SFLETVRYGVMYFMLSILNYAFYVKLLLTFQGLQPLLATVLSAVSSMLFVFLLYIRFMT 121
              + V +  +     + N      L+   Q +   LA ++SA    L  F  +  +  
Sbjct: 620 WRWQFVVFATVALNSLLANLGLLQLLINDVQ-MDATLARLISAACVALLSFTGHKLYSF 677


>gi|302531583|ref|ZP_07283925.1| conserved hypothetical protein [Streptomyces sp. AA4]
 gi|302440478|gb|EFL12294.1| conserved hypothetical protein [Streptomyces sp. AA4]
          Length = 155

 Score = 71.5 bits (174), Expect = 3e-11,   Method: Composition-based stats.
 Identities = 24/128 (18%), Positives = 47/128 (36%), Gaps = 6/128 (4%)

Query: 1   MKQCIIFIINIVVVFFIDVMGFFILMKCGADPF----YSRIFSIAVAFLVTWIPSRLFIF 56
           + Q I F +        D+  + +L   G D       +R  S  V     +  +R F F
Sbjct: 21  LGQLIRFGVIGGFCALFDLGTYSLLRAVGMDAVPWVDVARAISFVVGTTTAFFLNRRFTF 80

Query: 57  LKLRRKSFLETVRYGVMYFMLSILNYAFYVKLLLTFQ--GLQPLLATVLSAVSSMLFVFL 114
              RR    +   + ++Y +   +       +L      G +  LA V+S  ++ +  F+
Sbjct: 81  ADGRRDGNAQVGSFVLLYAVTFFVAVGVNQLMLHVLPESGWKATLAWVVSQATATVINFV 140

Query: 115 LYIRFMTR 122
           +    + R
Sbjct: 141 MLKWVVFR 148


>gi|257054572|ref|YP_003132404.1| hypothetical protein Svir_05020 [Saccharomonospora viridis DSM
           43017]
 gi|256584444|gb|ACU95577.1| predicted membrane protein [Saccharomonospora viridis DSM 43017]
          Length = 171

 Score = 71.5 bits (174), Expect = 3e-11,   Method: Composition-based stats.
 Identities = 21/134 (15%), Positives = 49/134 (36%), Gaps = 15/134 (11%)

Query: 3   QCIIFIINIVVVFFIDVMGFFIL--MKCGADPFYSRIFSIAVAFLVTWIPSRLFIFLKL- 59
           + + F     + F ID   +++L        P  ++   I VA + +++ +R + F    
Sbjct: 24  ELLKFATVGAITFVIDNAVWYLLKLTVLEDHPTTAKGVGILVATIASYVLNREWSFRTRG 83

Query: 60  RRKSFLETVRYGVMYFMLSILNYAFYV------------KLLLTFQGLQPLLATVLSAVS 107
            R+   E   + ++     ++N                   L T +       +VL    
Sbjct: 84  GRERPHEAALFFLVSAAALVVNVTPLYVSRYVLGLHRPHVDLFTQEVADFFSGSVLGVGL 143

Query: 108 SMLFVFLLYIRFMT 121
           +M++ F  + R++ 
Sbjct: 144 AMVWRFWAFRRWVF 157



 Score = 38.0 bits (87), Expect = 0.45,   Method: Composition-based stats.
 Identities = 9/58 (15%), Positives = 25/58 (43%)

Query: 65  LETVRYGVMYFMLSILNYAFYVKLLLTFQGLQPLLATVLSAVSSMLFVFLLYIRFMTR 122
            E +++  +  +  +++ A +  L LT     P  A  +  + + +  ++L   +  R
Sbjct: 23  HELLKFATVGAITFVIDNAVWYLLKLTVLEDHPTTAKGVGILVATIASYVLNREWSFR 80


>gi|159900140|ref|YP_001546387.1| GtrA family protein [Herpetosiphon aurantiacus ATCC 23779]
 gi|159893179|gb|ABX06259.1| GtrA family protein [Herpetosiphon aurantiacus ATCC 23779]
          Length = 141

 Score = 71.5 bits (174), Expect = 4e-11,   Method: Composition-based stats.
 Identities = 17/124 (13%), Positives = 43/124 (34%), Gaps = 4/124 (3%)

Query: 2   KQCIIFIINIVVVFFIDVMGFFILMKCGADPFYSRIFSIAVAFLVTWIPSRLFIFLKLRR 61
           ++   F +  +    +D++   +L   G     + I S +V  +  +  +R + F     
Sbjct: 10  QRWWRFALVGLSGTLVDLILLGMLKMLGWATILANIVSYSVGIINNFWWNRRWTFASNNP 69

Query: 62  KSFLETVRYGVMYFMLSILNYAFYVKLLLTFQGLQ----PLLATVLSAVSSMLFVFLLYI 117
               + +R+G +     ++N             L      +LA  ++ +    + F L  
Sbjct: 70  AWLPQFLRFGAISLSALVINTLIVAVTEAPLNDLWQSHGYVLAKGVATMVGFAWNFGLNR 129

Query: 118 RFMT 121
            +  
Sbjct: 130 IWTF 133


>gi|28379423|ref|NP_786315.1| teichoic acid glycosylation protein (putative) [Lactobacillus
           plantarum WCFS1]
 gi|300768679|ref|ZP_07078576.1| teichoic acid glycosylation protein [Lactobacillus plantarum subsp.
           plantarum ATCC 14917]
 gi|308181641|ref|YP_003925769.1| teichoic acid glycosylation protein (putative) [Lactobacillus
           plantarum subsp. plantarum ST-III]
 gi|28272262|emb|CAD65173.1| teichoic acid glycosylation protein (putative) [Lactobacillus
           plantarum WCFS1]
 gi|300493771|gb|EFK28942.1| teichoic acid glycosylation protein [Lactobacillus plantarum subsp.
           plantarum ATCC 14917]
 gi|308047132|gb|ADN99675.1| teichoic acid glycosylation protein (putative) [Lactobacillus
           plantarum subsp. plantarum ST-III]
          Length = 161

 Score = 71.5 bits (174), Expect = 4e-11,   Method: Composition-based stats.
 Identities = 22/121 (18%), Positives = 52/121 (42%), Gaps = 2/121 (1%)

Query: 3   QCIIFIINIVVVFFIDVMGFFILMKC-GADPFYSRIFSIAVAFLVTWIPSRLFIFLKLRR 61
           Q I +I+  ++   ++   F+ +    G +   + + S  +A  V +   RL +F     
Sbjct: 40  QAIRYILWGLISVAVNFATFYTMYHLIGLEYQVANVISWVIAVQVAFWVDRLKVFDHHSH 99

Query: 62  KSFLETVRYGVMYFMLSILNYAFYVKLLLTFQGLQPLLATVLSAVSSMLFVFLLYIRFMT 121
             + E  ++     +  ++  A  + LL++  G   +LA +L    +++  FL    ++ 
Sbjct: 100 HVYREMGKFYATRIVTYVVE-AIILWLLMSVLGSSAVLAKILGQAGAIIGNFLFSKLYVF 158

Query: 122 R 122
           R
Sbjct: 159 R 159


>gi|329944243|ref|ZP_08292502.1| GtrA-like protein [Actinomyces sp. oral taxon 170 str. F0386]
 gi|328530973|gb|EGF57829.1| GtrA-like protein [Actinomyces sp. oral taxon 170 str. F0386]
          Length = 191

 Score = 71.5 bits (174), Expect = 4e-11,   Method: Composition-based stats.
 Identities = 16/131 (12%), Positives = 45/131 (34%), Gaps = 10/131 (7%)

Query: 1   MKQCIIFIINIVVVFFIDVMGFFILMK-----CGADPFYSRIFSIAVAFLVTWIPSRLFI 55
           +K+ + F +   + + ID   F +            P  +++ + ++A + +W+ +R + 
Sbjct: 20  VKEFMQFGMVGALAYVIDAGLFNLFQHGPVGFLSGHPNSAQLLASSIATVFSWLANRYWT 79

Query: 56  FLKL-RRKSFLETVRYGVMYFMLSILNYAFYVKLLL----TFQGLQPLLATVLSAVSSML 110
           +    ++    E   + +       +     +        T      + A V+       
Sbjct: 80  YRDRTQKNVAREATLFVIANLGGIAITQFCLLFTHHVLGLTSPLADNIAAYVVGFGLGTA 139

Query: 111 FVFLLYIRFMT 121
           F F+ Y   + 
Sbjct: 140 FRFVFYHYIVF 150



 Score = 33.7 bits (76), Expect = 8.0,   Method: Composition-based stats.
 Identities = 9/61 (14%), Positives = 26/61 (42%), Gaps = 3/61 (4%)

Query: 65  LETVRYGVMYFMLSILNYAFYVKLLLTFQGL---QPLLATVLSAVSSMLFVFLLYIRFMT 121
            E +++G++  +  +++   +        G     P  A +L++  + +F +L    +  
Sbjct: 21  KEFMQFGMVGALAYVIDAGLFNLFQHGPVGFLSGHPNSAQLLASSIATVFSWLANRYWTY 80

Query: 122 R 122
           R
Sbjct: 81  R 81


>gi|312110546|ref|YP_003988862.1| GtrA family protein [Geobacillus sp. Y4.1MC1]
 gi|311215647|gb|ADP74251.1| GtrA family protein [Geobacillus sp. Y4.1MC1]
          Length = 140

 Score = 71.5 bits (174), Expect = 4e-11,   Method: Composition-based stats.
 Identities = 13/121 (10%), Positives = 44/121 (36%), Gaps = 1/121 (0%)

Query: 1   MKQCIIFIINIVVVFFIDVMGFFILMKCGADPFYSRIFSIAVAFLVTWIPSRLFIFLKLR 60
           ++    F +      F+D + FF+L   G     +++ S     + +++ +R++ F   +
Sbjct: 14  IRMLWRFCLVGAGNTFVDFVVFFLLASFGVSALLAQVCSYTAGVVNSYVWNRMWTFQVKQ 73

Query: 61  RKSFLETVRYGVMYFMLSILNYAFYVKLLLTFQGLQPLLATVLSAVSSMLFVFLLYIRFM 120
           + +  E +R+ ++  +   +                     + + +  +   F     ++
Sbjct: 74  KANVGEFLRFLIVNVLSLAVTLLLLFLCR-DVGQWPLFAGKLAATLGGIAVNFAGSRFWV 132

Query: 121 T 121
            
Sbjct: 133 F 133


>gi|296531954|ref|ZP_06894744.1| YngA protein [Roseomonas cervicalis ATCC 49957]
 gi|296267719|gb|EFH13554.1| YngA protein [Roseomonas cervicalis ATCC 49957]
          Length = 141

 Score = 71.5 bits (174), Expect = 4e-11,   Method: Composition-based stats.
 Identities = 23/123 (18%), Positives = 44/123 (35%), Gaps = 3/123 (2%)

Query: 3   QCIIFIINIVVVFFIDVMGFFILMKCGADPFYSRIFSIAVAFLVTWIPSRLFIFL-KLRR 61
           Q + F +       +D    ++ +  GA  +  R+ S   A    W  +R + F      
Sbjct: 4   QALRFGLVGASGVVVDTAILYLSLWLGAGLYGGRVLSYLAAASWNWALNRAWTFRQARGA 63

Query: 62  KSFLETVRYGVMYFMLSILNYAFY--VKLLLTFQGLQPLLATVLSAVSSMLFVFLLYIRF 119
            +  +   + ++      LNY  Y  +  L       P++A    A++ M   FL     
Sbjct: 64  PAGRQWALFLLVNLGGFALNYGCYALLVGLWPLAAAHPVIAVAAGALAGMAGNFLASRHL 123

Query: 120 MTR 122
           + R
Sbjct: 124 VFR 126


>gi|317509328|ref|ZP_07966948.1| GtrA protein [Segniliparus rugosus ATCC BAA-974]
 gi|316252384|gb|EFV11834.1| GtrA protein [Segniliparus rugosus ATCC BAA-974]
          Length = 187

 Score = 71.5 bits (174), Expect = 4e-11,   Method: Composition-based stats.
 Identities = 22/132 (16%), Positives = 47/132 (35%), Gaps = 13/132 (9%)

Query: 3   QCIIFIINIVVVFFIDVMGFF--ILMKCGADPFYSRIFSIAVAFLVTWIPSRLFIFLKL- 59
           + I F +     F  D+  ++  I          +++ S  +A ++++I +  + F    
Sbjct: 36  ELIKFAVVGATTFVFDMAIYYGLIFTALDTKHTTAKVVSGILATVLSYILNSEWSFKHRG 95

Query: 60  RRKSFLETVRYGVMYFMLSILNYAFYVKLL----------LTFQGLQPLLATVLSAVSSM 109
            R+   E + + V+  +  +L  A                L    +  +LA V+     M
Sbjct: 96  GRQRHHEALLFFVISGIGVLLAAAPIWVAHNLCGLAQDKSLRIGVIDFMLAYVIGNFLQM 155

Query: 110 LFVFLLYIRFMT 121
            F F    +F  
Sbjct: 156 AFRFWALRKFAY 167



 Score = 36.8 bits (84), Expect = 1.0,   Method: Composition-based stats.
 Identities = 10/60 (16%), Positives = 26/60 (43%)

Query: 63  SFLETVRYGVMYFMLSILNYAFYVKLLLTFQGLQPLLATVLSAVSSMLFVFLLYIRFMTR 122
              E +++ V+     + + A Y  L+ T    +   A V+S + + +  ++L   +  +
Sbjct: 33  RHHELIKFAVVGATTFVFDMAIYYGLIFTALDTKHTTAKVVSGILATVLSYILNSEWSFK 92


>gi|260579497|ref|ZP_05847371.1| membrane protein [Corynebacterium jeikeium ATCC 43734]
 gi|258602383|gb|EEW15686.1| membrane protein [Corynebacterium jeikeium ATCC 43734]
          Length = 212

 Score = 71.5 bits (174), Expect = 4e-11,   Method: Composition-based stats.
 Identities = 15/128 (11%), Positives = 41/128 (32%), Gaps = 9/128 (7%)

Query: 3   QCIIFIINIVVVFFIDVMGFFILMK-CGADPFYSRIFSIAVAFLVTWIPSRLFIFLKLRR 61
           Q + F++       +D     +     G     ++     +  L  +  +R + F     
Sbjct: 87  QLVKFVLVGGFSAIVDFGSTALFTFAFGLSDGVAKALGFVLGTLTAYFINRRWTFQAEPS 146

Query: 62  KSFLETVRYGVMYFMLSILNYAFYVKLLLTFQGLQPL------LATVLSAVSSMLFVFLL 115
                 V     Y +   + +  Y   +   +G          ++ V++  ++ +  FL+
Sbjct: 147 G--RRFVITMATYGLTFAVQWGLYKVSIPWLEGFDLNAFWVRAISFVIAQGTATVLNFLI 204

Query: 116 YIRFMTRR 123
               + +R
Sbjct: 205 QKFLIFKR 212


>gi|167461140|ref|ZP_02326229.1| YngA [Paenibacillus larvae subsp. larvae BRL-230010]
          Length = 149

 Score = 71.5 bits (174), Expect = 4e-11,   Method: Composition-based stats.
 Identities = 17/123 (13%), Positives = 51/123 (41%), Gaps = 2/123 (1%)

Query: 1   MKQCIIFIINIVVVFFIDVMGFFILMKC-GADPFYSRIFSIAVAFLVTWIPSRLFIFLKL 59
           ++  + F +  ++   ID   F+      G     ++  + A   + +++ ++ + F   
Sbjct: 15  LRTFMTFALVGIMNTLIDWGIFWFTYSLAGMHYLVAQTLAYACGMINSYVLNKSWTFKVK 74

Query: 60  RRKSFLETVRYGVMYFMLSILNYAFYVKLLLTFQGLQPLLATVLSAVSSMLFVFLLYIRF 119
            + + +ET ++  +  +   L+Y        +F G   L+   +     M+  +LL  ++
Sbjct: 75  NKANPVETGKFLAVNLICLCLSYLLLYGWN-SFVGEYMLIGKAVVTAVLMVLNYLLNKQW 133

Query: 120 MTR 122
           + +
Sbjct: 134 VFK 136


>gi|82702887|ref|YP_412453.1| dolichyl-phosphate beta-D-mannosyltransferase [Nitrosospira
           multiformis ATCC 25196]
 gi|82410952|gb|ABB75061.1| Dolichyl-phosphate beta-D-mannosyltransferase [Nitrosospira
           multiformis ATCC 25196]
          Length = 864

 Score = 71.5 bits (174), Expect = 4e-11,   Method: Composition-based stats.
 Identities = 19/123 (15%), Positives = 47/123 (38%), Gaps = 3/123 (2%)

Query: 1   MKQCIIFIINIVVVFFIDVMGFFILMKCGADPFYSRIFSIAVAFLVTWIPSRLFIFLKLR 60
           + +   F    +   F+D + F  L+  GA    + I S  VA  V++  +  + F    
Sbjct: 226 VGRAGRFAAAGLFGVFVDALLFQWLLSSGAGLALAHILSFFVAASVSYSLNFKWSFHLNH 285

Query: 61  RK--SFLETVRYGVMYFMLSILNYAFYVKLLLTFQGLQPLLATVLSAVSSMLFVFLLYIR 118
                + +  R+  +     ++        L+    + PLLA   +  ++   +++  + 
Sbjct: 286 EGYLRWPQFGRFLTVGLFALLMRGGVLAL-LVHGWHMPPLLAIFPAIGATAAVIYMGLVF 344

Query: 119 FMT 121
           ++ 
Sbjct: 345 YVF 347


>gi|288941085|ref|YP_003443325.1| Dolichyl-phosphate beta-D-mannosyltransferase [Allochromatium
           vinosum DSM 180]
 gi|288896457|gb|ADC62293.1| Dolichyl-phosphate beta-D-mannosyltransferase [Allochromatium
           vinosum DSM 180]
          Length = 398

 Score = 71.1 bits (173), Expect = 4e-11,   Method: Composition-based stats.
 Identities = 15/127 (11%), Positives = 41/127 (32%), Gaps = 6/127 (4%)

Query: 3   QCIIFIINIVVVFFIDVMGFF-ILMKCGADPFYS-RIFSIAVAFLVTWIPSRLFIFLK-- 58
           + I F +       + +   + IL   G   F + +  +  VA    +  + +  +    
Sbjct: 269 RFIAFSLIGAFGVLVHMSVLWPILHVFGERAFLAGQATATLVAMTSNFFLNNVLTYRDMR 328

Query: 59  -LRRKSFLETVRYGVMYFMLSILNYAFYVKLLLTFQGLQPLLATVLSAVSSMLFVFLLYI 117
              R+       + +   + ++ N      L  T      L A +   +   ++ + +  
Sbjct: 329 LRGRQLLWGWFSFVLACGLGALANVGIADYLFQTGHSGWVLSA-LAGILVGAVWNYAVTA 387

Query: 118 RFMTRRV 124
            +  +R 
Sbjct: 388 VYTWKRP 394


>gi|68537140|ref|YP_251845.1| hypothetical protein jk2045 [Corynebacterium jeikeium K411]
 gi|68264739|emb|CAI38227.1| putative membrane protein [Corynebacterium jeikeium K411]
          Length = 210

 Score = 71.1 bits (173), Expect = 4e-11,   Method: Composition-based stats.
 Identities = 15/128 (11%), Positives = 41/128 (32%), Gaps = 9/128 (7%)

Query: 3   QCIIFIINIVVVFFIDVMGFFILMK-CGADPFYSRIFSIAVAFLVTWIPSRLFIFLKLRR 61
           Q + F++       +D     +     G     ++     +  L  +  +R + F     
Sbjct: 85  QLVKFVLVGGFSAIVDFGSTALFTFAFGLSDGVAKALGFVLGTLTAYFINRRWTFQAEPS 144

Query: 62  KSFLETVRYGVMYFMLSILNYAFYVKLLLTFQGLQPL------LATVLSAVSSMLFVFLL 115
                 V     Y +   + +  Y   +   +G          ++ V++  ++ +  FL+
Sbjct: 145 G--RRFVITMATYGLTFAVQWGLYKVSIPWLEGFDLNAFWVRAISFVIAQGTATVLNFLI 202

Query: 116 YIRFMTRR 123
               + +R
Sbjct: 203 QKFLIFKR 210


>gi|326772085|ref|ZP_08231370.1| hypothetical protein HMPREF0059_00467 [Actinomyces viscosus C505]
 gi|326638218|gb|EGE39119.1| hypothetical protein HMPREF0059_00467 [Actinomyces viscosus C505]
          Length = 155

 Score = 71.1 bits (173), Expect = 4e-11,   Method: Composition-based stats.
 Identities = 22/123 (17%), Positives = 47/123 (38%), Gaps = 2/123 (1%)

Query: 1   MKQCIIFIINIVVVFFIDVMGFFILMKCGADPFYSRIFSIAVAFLVTWIPSRLFIFLKLR 60
           + Q   F++   + F +D   F +L   G     +   S + + ++ +I SR ++F    
Sbjct: 12  LAQFGRFLVVGGISFSVDFGLFTVLYGLGVPHLIASATSFSTSVVLNYILSRRYVFEAQE 71

Query: 61  R-KSFLETVRYGVMYFMLSILNYAFYVKLLLTFQGLQPLLATVLSAVSSMLFVFLLYIRF 119
                 E   Y ++  +   LN            G+ P L  +L+    +++ F+     
Sbjct: 72  NVSVLKEFTLYVLLNVVALGLNTLILYVC-ADLAGMSPFLGKILATAIVLIYNFISRKAL 130

Query: 120 MTR 122
           + R
Sbjct: 131 LER 133



 Score = 33.3 bits (75), Expect = 9.7,   Method: Composition-based stats.
 Identities = 11/67 (16%), Positives = 30/67 (44%), Gaps = 2/67 (2%)

Query: 55  IFLKLRRKSFLETVRYGVMYFMLSILNYAFYVKLLLTFQGLQPLLATVLSAVSSMLFVFL 114
              +  R    +  R+ V+  +   +++  +    L   G+  L+A+  S  +S++  ++
Sbjct: 3   TLQEKLRPLLAQFGRFLVVGGISFSVDFGLFTV--LYGLGVPHLIASATSFSTSVVLNYI 60

Query: 115 LYIRFMT 121
           L  R++ 
Sbjct: 61  LSRRYVF 67


>gi|300789607|ref|YP_003769898.1| GtrA-like protein [Amycolatopsis mediterranei U32]
 gi|299799121|gb|ADJ49496.1| GtrA-like protein [Amycolatopsis mediterranei U32]
          Length = 143

 Score = 71.1 bits (173), Expect = 5e-11,   Method: Composition-based stats.
 Identities = 20/120 (16%), Positives = 48/120 (40%), Gaps = 1/120 (0%)

Query: 5   IIFIINIVVVFFIDVMGFFILMKCGADPFYSRIFSIAVAFLVTWIPSRLFIFLKLRRKSF 64
           + F +  V    +D +G+ +L+  G   F +   S     L+++  +R F F        
Sbjct: 9   LRFGLVGVGNTLVDALGYALLVTLGVPLFVANFISTTTGMLLSFTLNRNFTFRAKDGDVR 68

Query: 65  LETVRYGVMYFML-SILNYAFYVKLLLTFQGLQPLLATVLSAVSSMLFVFLLYIRFMTRR 123
            + + +  +      ++  A    +   F G+  LL         +++ ++LY + + R+
Sbjct: 69  RQALLFFAVTAFGLWVVQAAIIFAVTAAFPGVNLLLPKFAGIAVGLVWNYVLYNKVVFRQ 128


>gi|50954163|ref|YP_061451.1| glycosyl transferase [Leifsonia xyli subsp. xyli str. CTCB07]
 gi|50950645|gb|AAT88346.1| glycosyl transferase [Leifsonia xyli subsp. xyli str. CTCB07]
          Length = 437

 Score = 71.1 bits (173), Expect = 5e-11,   Method: Composition-based stats.
 Identities = 15/124 (12%), Positives = 39/124 (31%), Gaps = 5/124 (4%)

Query: 3   QCIIFIINIVVVFFIDVMGFFILMKCGADPFYSRIFSIAVAFLVTWIPSRLFIFLKLRRK 62
           Q + F +   +         ++L         +   ++ +  +     +R F F    R 
Sbjct: 270 QVVRFAVVGALSTAA-YAVLYLLFSGLVGGQTANFAALLITAVANTGANRRFTFGVRGRP 328

Query: 63  SFL----ETVRYGVMYFMLSILNYAFYVKLLLTFQGLQPLLATVLSAVSSMLFVFLLYIR 118
                  + +    + + L+  + A              LL   ++ +++ L  F L   
Sbjct: 329 GMARHQFQGLIVFGIAWALTGCSLALLHTPAPGASSHVELLVLTVANLAATLLRFALLRL 388

Query: 119 FMTR 122
           ++ R
Sbjct: 389 WVFR 392


>gi|312792582|ref|YP_004025505.1| gtra family protein [Caldicellulosiruptor kristjanssonii 177R1B]
 gi|312878163|ref|ZP_07738093.1| GtrA family protein [Caldicellulosiruptor lactoaceticus 6A]
 gi|311795053|gb|EFR11452.1| GtrA family protein [Caldicellulosiruptor lactoaceticus 6A]
 gi|312179722|gb|ADQ39892.1| GtrA family protein [Caldicellulosiruptor kristjanssonii 177R1B]
          Length = 155

 Score = 71.1 bits (173), Expect = 5e-11,   Method: Composition-based stats.
 Identities = 23/130 (17%), Positives = 54/130 (41%), Gaps = 4/130 (3%)

Query: 3   QCIIFIINIVVVFFIDVMGFFILMK-CGADPFYSRIFSIAVAFLVTWIPSRLFIFLK--L 59
           + + F +  ++   ID   FF+       D  +S+IF      L +++ ++ + F     
Sbjct: 25  EFVKFSVVGIINTAIDFAVFFVCYSILHFDSSFSQIFGYTAGMLNSFLMNKRWTFEDKTK 84

Query: 60  RRKSFLETVRYGVMYFMLSILNYAFYVKLLLTFQGLQPLLATVLSAVSSMLFVFLLYIRF 119
            RK  L+ V++     +  +L+        L       L+A +L+ + +    ++LY  +
Sbjct: 85  GRKVLLKAVKFAFTNVVSLLLSIGVIKLSKLYMSN-SILIAKILATLCAQGVNYILYKFW 143

Query: 120 MTRRVYFIKK 129
           +  +V    +
Sbjct: 144 VFTKVEVNDE 153


>gi|290959133|ref|YP_003490315.1| polysaccharide biosynthesis protein [Streptomyces scabiei 87.22]
 gi|260648659|emb|CBG71772.1| putative polysaccharide biosynthesis protein [Streptomyces scabiei
           87.22]
          Length = 508

 Score = 71.1 bits (173), Expect = 5e-11,   Method: Composition-based stats.
 Identities = 13/124 (10%), Positives = 41/124 (33%), Gaps = 5/124 (4%)

Query: 2   KQCIIFIINIVVVFFIDVMGFFILMKCGADPFYSRIFSIAVAFLVTWIPSRLFIFLKLRR 61
           +Q + F +   +     ++ +       +    +   ++ V+ +     +R   F    R
Sbjct: 290 RQLLGFCVVGGLSTLFYLLLYSGFRTF-SGSQTANALALLVSAVANTAANRRLTFGVRGR 348

Query: 62  ----KSFLETVRYGVMYFMLSILNYAFYVKLLLTFQGLQPLLATVLSAVSSMLFVFLLYI 117
               +   + +    +   L+  + A              L   V + +++ +  FLL+ 
Sbjct: 349 GGVIRHQAQGLVVFGIGLALTSGSLAALNAATSDPAHSTELAVLVAANLAATVLRFLLFR 408

Query: 118 RFMT 121
            ++ 
Sbjct: 409 AWVF 412


>gi|262201787|ref|YP_003272995.1| GtrA family protein [Gordonia bronchialis DSM 43247]
 gi|262085134|gb|ACY21102.1| GtrA family protein [Gordonia bronchialis DSM 43247]
          Length = 186

 Score = 71.1 bits (173), Expect = 5e-11,   Method: Composition-based stats.
 Identities = 24/133 (18%), Positives = 49/133 (36%), Gaps = 14/133 (10%)

Query: 3   QCIIFIINIVVVFFIDVMGFFIL--MKCGADPFYSRIFSIAVAFLVTWIPSRLFIFLKL- 59
           + I F +     F  D+  +F L        P  ++I S  +A ++++I +R + F    
Sbjct: 24  ELIKFALVGGTTFVFDLAIYFALSLTILEPKPVIAKIISGVLATILSYILNREWAFKNRG 83

Query: 60  RRKSFLETVRYGVMYFMLSILNYAFYVKLLLTFQG-----------LQPLLATVLSAVSS 108
            R+   E + + V+  +  +L  A        F             +  +L  ++  +  
Sbjct: 84  GRERHHEAMLFFVISGIGVVLQAAPLYVANNIFDLRSSLSPARLVVVDFILGFLIGNILQ 143

Query: 109 MLFVFLLYIRFMT 121
           M F F    +F  
Sbjct: 144 MTFRFWALRKFAF 156



 Score = 40.3 bits (93), Expect = 0.090,   Method: Composition-based stats.
 Identities = 11/60 (18%), Positives = 29/60 (48%)

Query: 63  SFLETVRYGVMYFMLSILNYAFYVKLLLTFQGLQPLLATVLSAVSSMLFVFLLYIRFMTR 122
              E +++ ++     + + A Y  L LT    +P++A ++S V + +  ++L   +  +
Sbjct: 21  RHHELIKFALVGGTTFVFDLAIYFALSLTILEPKPVIAKIISGVLATILSYILNREWAFK 80


>gi|295400211|ref|ZP_06810191.1| GtrA family protein [Geobacillus thermoglucosidasius C56-YS93]
 gi|294977990|gb|EFG53588.1| GtrA family protein [Geobacillus thermoglucosidasius C56-YS93]
          Length = 140

 Score = 71.1 bits (173), Expect = 5e-11,   Method: Composition-based stats.
 Identities = 13/121 (10%), Positives = 44/121 (36%), Gaps = 1/121 (0%)

Query: 1   MKQCIIFIINIVVVFFIDVMGFFILMKCGADPFYSRIFSIAVAFLVTWIPSRLFIFLKLR 60
           ++    F +      F+D + FF+L   G     +++ S     + +++ +R++ F   +
Sbjct: 14  IRMLWRFCLVGAGNTFVDFVVFFLLASFGVSALLAQVCSYTAGVVNSYVWNRMWTFQVKQ 73

Query: 61  RKSFLETVRYGVMYFMLSILNYAFYVKLLLTFQGLQPLLATVLSAVSSMLFVFLLYIRFM 120
           + +  E +R+ ++  +   +                     + + +  +   F     ++
Sbjct: 74  KANVGEFLRFLIVNVLSLAVTLLLLFLCR-DVGQWPLFAGKLAATLGGIAVNFAGSRFWV 132

Query: 121 T 121
            
Sbjct: 133 F 133


>gi|312128461|ref|YP_003993335.1| gtra family protein [Caldicellulosiruptor hydrothermalis 108]
 gi|311778480|gb|ADQ07966.1| GtrA family protein [Caldicellulosiruptor hydrothermalis 108]
          Length = 155

 Score = 71.1 bits (173), Expect = 5e-11,   Method: Composition-based stats.
 Identities = 22/126 (17%), Positives = 52/126 (41%), Gaps = 4/126 (3%)

Query: 1   MKQCIIFIINIVVVFFIDVMGFFILMK-CGADPFYSRIFSIAVAFLVTWIPSRLFIFLKL 59
           + + I F I   +   ID   FF+       D  +S+IF      + +++ ++ + F   
Sbjct: 23  LFELIKFSIVGAINTAIDFAVFFVCYSILHLDSSFSQIFGYTAGMINSFLMNKRWTFEDR 82

Query: 60  --RRKSFLETVRYGVMYFMLSILNYAFYVKLLLTFQGLQPLLATVLSAVSSMLFVFLLYI 117
              +K  ++  ++G    +  IL+        L       L+A +L+ + +    ++LY 
Sbjct: 83  TKGKKVLIKAFKFGFTNVISLILSIGVIKLSKLYLSS-SILIAKILATLCAQGVNYILYK 141

Query: 118 RFMTRR 123
            ++  +
Sbjct: 142 FWVFTK 147


>gi|171185114|ref|YP_001794033.1| glycosyl transferase family protein [Thermoproteus neutrophilus
           V24Sta]
 gi|170934326|gb|ACB39587.1| glycosyl transferase family 2 [Thermoproteus neutrophilus V24Sta]
          Length = 340

 Score = 71.1 bits (173), Expect = 5e-11,   Method: Composition-based stats.
 Identities = 18/118 (15%), Positives = 37/118 (31%), Gaps = 5/118 (4%)

Query: 5   IIFIINIVVVFFIDVMGFFILMKCGADPFYSRIFSIAVAFLVTWIPSRLFIFLKLRRKSF 64
           + F        F+     + L      P  S   +I  +    +I +RL+ F   +  + 
Sbjct: 226 LKFAAVGASGVFVAWAVLYAL---PLPPHLSVAAAIETSLTSNYILNRLWTFAGRKTPAL 282

Query: 65  LETVRYGVMYFMLSILNYAFYVKLLLTFQGLQPLLATVLSAVSSMLFVFLLYIRFMTR 122
              +RY     + +  NY   +   L   G    +A +          + L    + +
Sbjct: 283 TGWLRYHAATAVGNATNYITTLA--LHMLGAPLYVAYLAGVTLGFAANYALSEVVVFK 338


>gi|54025664|ref|YP_119906.1| hypothetical protein nfa36940 [Nocardia farcinica IFM 10152]
 gi|54017172|dbj|BAD58542.1| hypothetical protein [Nocardia farcinica IFM 10152]
          Length = 171

 Score = 71.1 bits (173), Expect = 5e-11,   Method: Composition-based stats.
 Identities = 21/135 (15%), Positives = 47/135 (34%), Gaps = 15/135 (11%)

Query: 2   KQCIIFIINIVVVFFIDVMGFFI--LMKCGADPFYSRIFSIAVAFLVTWIPSRLFIFLKL 59
           ++ + F     + +FID    +   L   G  P  +R+  + +A + ++I +R + F   
Sbjct: 23  RELLKFATVGAITWFIDTGVVYAVKLTVLGEKPLTARLLGVLIATIASYILNREWSFRTR 82

Query: 60  -RRKSFLETVRYGVMYFMLSILNYA------------FYVKLLLTFQGLQPLLATVLSAV 106
             R+   E   +  +  +   +                     +T      +   +L  +
Sbjct: 83  GGRQRHHEAALFFAVSALAIGVTMIPQAISLYVLDLRVPHVGPVTQAVANFVTGQILGVL 142

Query: 107 SSMLFVFLLYIRFMT 121
            +M F F    RF+ 
Sbjct: 143 LAMGFRFWALRRFVF 157



 Score = 39.5 bits (91), Expect = 0.18,   Method: Composition-based stats.
 Identities = 10/59 (16%), Positives = 26/59 (44%)

Query: 64  FLETVRYGVMYFMLSILNYAFYVKLLLTFQGLQPLLATVLSAVSSMLFVFLLYIRFMTR 122
             E +++  +  +   ++      + LT  G +PL A +L  + + +  ++L   +  R
Sbjct: 22  HRELLKFATVGAITWFIDTGVVYAVKLTVLGEKPLTARLLGVLIATIASYILNREWSFR 80


>gi|269219089|ref|ZP_06162943.1| putative integral membrane protein [Actinomyces sp. oral taxon 848
           str. F0332]
 gi|269211236|gb|EEZ77576.1| putative integral membrane protein [Actinomyces sp. oral taxon 848
           str. F0332]
          Length = 169

 Score = 70.7 bits (172), Expect = 6e-11,   Method: Composition-based stats.
 Identities = 26/138 (18%), Positives = 52/138 (37%), Gaps = 11/138 (7%)

Query: 3   QCIIFIINIVVVFFIDVMGFFILMKC------GADPFYSRIFSIAVAFLVTWIPSRLFIF 56
           + + F    +  + +DV  F +L         G     ++I S+ V+ +  WI +RL+ F
Sbjct: 21  EFLQFCTVGLGAYIVDVGLFNLLAYSLPIDLPGDKSLTAKIVSVTVSVIFAWIANRLWTF 80

Query: 57  LKLRR-KSFLETVRYGVMYFMLSILNYAFY----VKLLLTFQGLQPLLATVLSAVSSMLF 111
            K R      E   + ++     ++           L LT Q    +   ++  V    F
Sbjct: 81  KKRRNENKGREFAMFALVNLGGLLIALGCLGFSRYVLHLTTQFADNVSGNIVGLVLGTAF 140

Query: 112 VFLLYIRFMTRRVYFIKK 129
            +++Y  F+       +K
Sbjct: 141 RYVMYRYFVFSPASRCEK 158


>gi|239827388|ref|YP_002950012.1| GtrA family protein [Geobacillus sp. WCH70]
 gi|239807681|gb|ACS24746.1| GtrA family protein [Geobacillus sp. WCH70]
          Length = 140

 Score = 70.7 bits (172), Expect = 6e-11,   Method: Composition-based stats.
 Identities = 15/121 (12%), Positives = 44/121 (36%), Gaps = 1/121 (0%)

Query: 1   MKQCIIFIINIVVVFFIDVMGFFILMKCGADPFYSRIFSIAVAFLVTWIPSRLFIFLKLR 60
           ++    F +      F+D + FF+L   G     +++ S     + +++ +R++ F   R
Sbjct: 14  IQTLWRFCLVGAGNTFVDFIVFFLLASFGVSALLAQVCSYTAGVVNSYVWNRMWTFRVKR 73

Query: 61  RKSFLETVRYGVMYFMLSILNYAFYVKLLLTFQGLQPLLATVLSAVSSMLFVFLLYIRFM 120
           + +  E +R+ V+  +   +                     + + +  +   F     ++
Sbjct: 74  KANIGEFLRFIVVNVLSLAVTLLLLFLCR-DVGHWPLFAGKLAATLGGIAVNFAGSRFWV 132

Query: 121 T 121
            
Sbjct: 133 F 133


>gi|289643366|ref|ZP_06475488.1| Dolichyl-phosphate beta-D-mannosyltransferase [Frankia symbiont of
           Datisca glomerata]
 gi|289506818|gb|EFD27795.1| Dolichyl-phosphate beta-D-mannosyltransferase [Frankia symbiont of
           Datisca glomerata]
          Length = 432

 Score = 70.7 bits (172), Expect = 6e-11,   Method: Composition-based stats.
 Identities = 14/119 (11%), Positives = 43/119 (36%), Gaps = 1/119 (0%)

Query: 3   QCIIFIINIVVVFFIDVMGFFILMKCGADPFYSRIFSIAVAFLVTWIPSRLFIFLKLRRK 62
           +   F +  V     ++ G  +L   G     + + +  +A L  +I   L ++ +  + 
Sbjct: 278 RAARFALVGVSGTLPNIAGTALLHHAGMHYMAAAVLATQLAILWNFIGCDLLVWERGNQS 337

Query: 63  SFLETVRYGVMYFMLSILNYAFYVKLLLTFQGLQPLLATVLSAVSSMLFVFLLYIRFMT 121
                + + V+  +  ++         +        +AT ++   ++   ++L  R + 
Sbjct: 338 RARRYLPFAVLNNLDLVIRLPLLGL-FVDRWHTSVPVATFVTLAVAVSVRYVLVDRMIY 395



 Score = 36.8 bits (84), Expect = 0.93,   Method: Composition-based stats.
 Identities = 12/61 (19%), Positives = 25/61 (40%), Gaps = 2/61 (3%)

Query: 63  SFLETVRYGVMYFMLSILNYAFYVKLLLTFQGLQPLLATVLSAVSSMLFVFLLYIRFMTR 122
                 R+ ++    ++ N A     LL   G+  + A VL+   ++L+ F+     +  
Sbjct: 275 RVPRAARFALVGVSGTLPNIAGTA--LLHHAGMHYMAAAVLATQLAILWNFIGCDLLVWE 332

Query: 123 R 123
           R
Sbjct: 333 R 333


>gi|302871035|ref|YP_003839671.1| GtrA family protein [Caldicellulosiruptor obsidiansis OB47]
 gi|302573894|gb|ADL41685.1| GtrA family protein [Caldicellulosiruptor obsidiansis OB47]
          Length = 155

 Score = 70.7 bits (172), Expect = 6e-11,   Method: Composition-based stats.
 Identities = 26/126 (20%), Positives = 54/126 (42%), Gaps = 4/126 (3%)

Query: 1   MKQCIIFIINIVVVFFIDVMGFFILMK-CGADPFYSRIFSIAVAFLVTWIPSRLFIF--L 57
           + + I F I  V+   ID   FF+       D  +S+IF      L +++ ++ + F   
Sbjct: 23  LFELIKFSIVGVINTAIDFAVFFVCYSILHFDSSFSQIFGYTAGMLNSFLMNKRWTFEDR 82

Query: 58  KLRRKSFLETVRYGVMYFMLSILNYAFYVKLLLTFQGLQPLLATVLSAVSSMLFVFLLYI 117
              RK  L+ V++G    +  +L+        L       L+A +L+ + +    ++LY 
Sbjct: 83  TRGRKVLLKAVKFGFTNIISLLLSIGVLKFSKLYLSS-SILIAKILATLCAQGINYILYK 141

Query: 118 RFMTRR 123
            ++  +
Sbjct: 142 FWVFTK 147


>gi|302558859|ref|ZP_07311201.1| integral membrane protein [Streptomyces griseoflavus Tu4000]
 gi|302476477|gb|EFL39570.1| integral membrane protein [Streptomyces griseoflavus Tu4000]
          Length = 157

 Score = 70.7 bits (172), Expect = 6e-11,   Method: Composition-based stats.
 Identities = 15/126 (11%), Positives = 37/126 (29%), Gaps = 5/126 (3%)

Query: 2   KQCIIFIINIVVVFFIDVMGFFILMK-CGADPFYSRIFSIAVAFLVTWIPSRLFIFLKLR 60
           ++ + F    ++ + +D+  F  L    G DP  ++  S      V +  +    +   R
Sbjct: 22  RELLGFATAGLLAYAVDLAVFTCLRGPAGLDPLTAKALSFVAGCTVAYAGNAHGTYRGCR 81

Query: 61  RKSFLETVRYGVMYFMLSILNYAFYVKLLLTFQG----LQPLLATVLSAVSSMLFVFLLY 116
            +       +  +    + L                     +   V+  V + +  F   
Sbjct: 82  VRGPRPYALFFAVNLAGAALQLLCLAVSHYGLGLTSQRADTVSGAVVGMVPATVVRFWGT 141

Query: 117 IRFMTR 122
              + R
Sbjct: 142 RTLVFR 147


>gi|220912032|ref|YP_002487341.1| GtrA family protein [Arthrobacter chlorophenolicus A6]
 gi|219858910|gb|ACL39252.1| GtrA family protein [Arthrobacter chlorophenolicus A6]
          Length = 184

 Score = 70.7 bits (172), Expect = 6e-11,   Method: Composition-based stats.
 Identities = 23/128 (17%), Positives = 44/128 (34%), Gaps = 6/128 (4%)

Query: 2   KQCIIFIINIVVVFFIDVMGFFILMK--CGADPFYSRIFSIAVAFLVTWIPSRLFIFLKL 59
           ++   F     V F ID    + LM          +R     VA + +WI +R + F   
Sbjct: 18  REVAKFGAVGGVAFVIDNGLTYYLMHGPMTDSEAKARFVGATVATIFSWIANRFWTFRHR 77

Query: 60  RR-KSFLETVRYGVMYFMLSILNYAFYVKLLLTFQGLQ---PLLATVLSAVSSMLFVFLL 115
           R+     E V + ++  +   ++  F                 LA V+  + + +  F  
Sbjct: 78  RQDNVLREFVMFVIINGIGIGISTGFTALAKYGLGVTDKNLLFLAGVVGILVATVVRFFA 137

Query: 116 YIRFMTRR 123
           Y   +  +
Sbjct: 138 YRFLVFNK 145



 Score = 39.1 bits (90), Expect = 0.20,   Method: Composition-based stats.
 Identities = 7/59 (11%), Positives = 22/59 (37%)

Query: 64  FLETVRYGVMYFMLSILNYAFYVKLLLTFQGLQPLLATVLSAVSSMLFVFLLYIRFMTR 122
           + E  ++G +  +  +++      L+          A  + A  + +F ++    +  R
Sbjct: 17  WREVAKFGAVGGVAFVIDNGLTYYLMHGPMTDSEAKARFVGATVATIFSWIANRFWTFR 75


>gi|325289765|ref|YP_004265946.1| GtrA family protein [Syntrophobotulus glycolicus DSM 8271]
 gi|324965166|gb|ADY55945.1| GtrA family protein [Syntrophobotulus glycolicus DSM 8271]
          Length = 133

 Score = 70.7 bits (172), Expect = 7e-11,   Method: Composition-based stats.
 Identities = 17/119 (14%), Positives = 45/119 (37%), Gaps = 2/119 (1%)

Query: 3   QCIIFIINIVVVFFIDVMGFFILMKCGADPFYSRIFSIAVAFLVTWIPSRLFIFLKLRRK 62
           + + + +   V   +D++ FF+L   GA    ++    +  F  ++I +R + F      
Sbjct: 10  KFLKYCLVGGVNTAVDLILFFLLSLIGAPLLIAQCVGYSGGFFNSFILNRKWTFQTYGPS 69

Query: 63  SFLETVRYGVMYFMLSILNYAFYVKLLLTFQGLQPLLATVLSAVSSMLFVFLLYIRFMT 121
              + +R+  +      L Y   +  L        +++ ++S V      +     ++ 
Sbjct: 70  G-RQFIRFIGLNLFTLALTYG-AIVGLHDQLQWPLMISKIISTVLCTGINYTGSRLWVF 126


>gi|50954285|ref|YP_061573.1| putative integral membrane protein [Leifsonia xyli subsp. xyli str.
           CTCB07]
 gi|50950767|gb|AAT88468.1| conserved putative integral membrane protein [Leifsonia xyli subsp.
           xyli str. CTCB07]
          Length = 199

 Score = 70.7 bits (172), Expect = 7e-11,   Method: Composition-based stats.
 Identities = 20/131 (15%), Positives = 40/131 (30%), Gaps = 10/131 (7%)

Query: 1   MKQCIIFIINIVVVFFIDVMGFF-----ILMKCGADPFYSRIFSIAVAFLVTWIPSRLFI 55
           + Q I F     V   ++++ F      +L         S + +   A    W  +R + 
Sbjct: 37  LPQLIKFGAVGAVGLAVNLVVFNAMLLIVLRGVPHATVLSTVIATTAAIFANWAGNRFWA 96

Query: 56  F-LKLRRKSFLETVRYGVMYFMLSILNYAFYVKLLL----TFQGLQPLLATVLSAVSSML 110
           F  + +R +  E   +  +      +              T      + A  +     ML
Sbjct: 97  FSGQRQRNALREGAEFFTVSLAGMGIPLLCIGVSHYLLGLTSPIADNISANGIGLALGML 156

Query: 111 FVFLLYIRFMT 121
           F F  Y  ++ 
Sbjct: 157 FRFAFYRWWVF 167


>gi|309810427|ref|ZP_07704257.1| GtrA-like protein [Dermacoccus sp. Ellin185]
 gi|308435610|gb|EFP59412.1| GtrA-like protein [Dermacoccus sp. Ellin185]
          Length = 176

 Score = 70.3 bits (171), Expect = 7e-11,   Method: Composition-based stats.
 Identities = 22/126 (17%), Positives = 43/126 (34%), Gaps = 6/126 (4%)

Query: 2   KQCIIFIINIVVVFFIDVMGFFILMK--CGADPFYSRIFSIAVAFLVTWIPSRLFIFLKL 59
           ++   F I  V+  FID+  +  L           ++I S AVA +  W+ +R + F   
Sbjct: 42  RELSTFGIIGVLNIFIDMGLYNWLRAGPLDGKVTTAKIISGAVATVFAWVGNRYWTFRHR 101

Query: 60  -RRKSFLETVRYGVMYFMLSILNYAFYVKLLLTF---QGLQPLLATVLSAVSSMLFVFLL 115
             R    E V +  +  +      A+             L   +  ++      +  F+ 
Sbjct: 102 ENRPLHHEVVLFFAVNGVALAATSAWVAFAHYVLGARGALWENVHALIGIGIGTILRFVA 161

Query: 116 YIRFMT 121
           Y   + 
Sbjct: 162 YRTIVF 167



 Score = 33.7 bits (76), Expect = 7.6,   Method: Composition-based stats.
 Identities = 8/59 (13%), Positives = 23/59 (38%)

Query: 64  FLETVRYGVMYFMLSILNYAFYVKLLLTFQGLQPLLATVLSAVSSMLFVFLLYIRFMTR 122
           + E   +G++  +   ++   Y  L       +   A ++S   + +F ++    +  R
Sbjct: 41  WRELSTFGIIGVLNIFIDMGLYNWLRAGPLDGKVTTAKIISGAVATVFAWVGNRYWTFR 99


>gi|187926358|ref|YP_001892703.1| GtrA family protein [Ralstonia pickettii 12J]
 gi|241665845|ref|YP_002984204.1| GtrA family protein [Ralstonia pickettii 12D]
 gi|187728112|gb|ACD29276.1| GtrA family protein [Ralstonia pickettii 12J]
 gi|240867872|gb|ACS65532.1| GtrA family protein [Ralstonia pickettii 12D]
          Length = 170

 Score = 70.3 bits (171), Expect = 7e-11,   Method: Composition-based stats.
 Identities = 24/122 (19%), Positives = 51/122 (41%), Gaps = 3/122 (2%)

Query: 1   MKQCIIFIINIVVVFFIDVMGFFILMKCGADPFYSRIFSIAVAFLVTWIPSRLFIFLKLR 60
           ++Q   +++          +  F L++ G  P+ + +    +   + +  SR  +F    
Sbjct: 27  VEQFARYVVIGGGATLAHYVVLFGLVQVGVSPWRASVAGSVIGATLNYFISRQAVF-NST 85

Query: 61  RKSFLETVRYGVMYFMLSILNYAFYVKLLLTFQGLQPLLATVLSAVSSMLFVFLLYIRFM 120
           R      VR+G++ F+    N       L    GL  L+A V ++  + +F FL++  + 
Sbjct: 86  RGHIGAMVRFGLVAFLALGCNATIMAAGL--GIGLYYLIAQVFASSITAIFNFLVHRYWT 143

Query: 121 TR 122
            R
Sbjct: 144 FR 145



 Score = 38.7 bits (89), Expect = 0.28,   Method: Composition-based stats.
 Identities = 5/57 (8%), Positives = 20/57 (35%)

Query: 4   CIIFIINIVVVFFIDVMGFFILMKCGADPFYSRIFSIAVAFLVTWIPSRLFIFLKLR 60
            + F +   +    +       +  G     +++F+ ++  +  ++  R + F    
Sbjct: 92  MVRFGLVAFLALGCNATIMAAGLGIGLYYLIAQVFASSITAIFNFLVHRYWTFRDAD 148


>gi|297200160|ref|ZP_06917557.1| integral membrane protein [Streptomyces sviceus ATCC 29083]
 gi|197713390|gb|EDY57424.1| integral membrane protein [Streptomyces sviceus ATCC 29083]
          Length = 177

 Score = 70.3 bits (171), Expect = 7e-11,   Method: Composition-based stats.
 Identities = 15/127 (11%), Positives = 44/127 (34%), Gaps = 5/127 (3%)

Query: 1   MKQCIIFIINIVVVFFIDVMGFFILMKCGADPFY-SRIFSIAVAFLVTWIPSRLFIFLKL 59
           +++   F         ++++ F ++      P   + + +  V+ +  +I  R F +   
Sbjct: 18  VREVAKFGAVGGAGLLVNLVVFNVVRHLTDLPVVRASVVATVVSIVFNYIGFRYFTYRDR 77

Query: 60  RRK-SFLETVRYGVMYFMLSILNYAFYVKLLLTFQGLQPLLATV---LSAVSSMLFVFLL 115
            +     E   + +   +  ++           F    PL + +   +    + LF F  
Sbjct: 78  DKSGRTKELTLFLLFSVVGLVIENGILYAATYGFGWDSPLQSNIFKFVGIGIATLFRFWS 137

Query: 116 YIRFMTR 122
           Y  ++ +
Sbjct: 138 YRSWVFK 144


>gi|298251748|ref|ZP_06975551.1| GtrA family protein [Ktedonobacter racemifer DSM 44963]
 gi|297546340|gb|EFH80208.1| GtrA family protein [Ktedonobacter racemifer DSM 44963]
          Length = 218

 Score = 70.3 bits (171), Expect = 7e-11,   Method: Composition-based stats.
 Identities = 18/131 (13%), Positives = 45/131 (34%), Gaps = 11/131 (8%)

Query: 3   QCIIFIINIVVVFFIDVMGFFILMKCGADP-----FYSRIFSIAVAFLVTWIPSRLFIFL 57
           Q   + +  V    IDV+   IL+                F+       ++  ++ + F 
Sbjct: 36  QWFRYCLVGVANTLIDVLVLNILLFRFPTTQVHILVIYNSFAYIAGAASSFFLNKYWTFG 95

Query: 58  KLRRKSFLETVRYGVMYFMLSILNYAFYVK------LLLTFQGLQPLLATVLSAVSSMLF 111
             +R +  E  R+ +   +  + +             LL    L    + +L+  ++ + 
Sbjct: 96  HKQRPTSQEVGRFLLSLLLEILSSNGLLWLIGNALHPLLANAMLWGNASKLLAVAANTVL 155

Query: 112 VFLLYIRFMTR 122
            +L+   ++ R
Sbjct: 156 SYLILHFWVFR 166



 Score = 33.7 bits (76), Expect = 9.0,   Method: Composition-based stats.
 Identities = 9/67 (13%), Positives = 22/67 (32%), Gaps = 3/67 (4%)

Query: 58  KLRRKSFLETVRYGVMYFMLSILNYAFYVKLLLTFQGLQP---LLATVLSAVSSMLFVFL 114
                 F +  RY ++    ++++      LL  F   Q    ++    + ++     F 
Sbjct: 28  HSWGSRFWQWFRYCLVGVANTLIDVLVLNILLFRFPTTQVHILVIYNSFAYIAGAASSFF 87

Query: 115 LYIRFMT 121
           L   +  
Sbjct: 88  LNKYWTF 94


>gi|118577084|ref|YP_876827.1| dolichol-phosphate mannosyltransferase [Cenarchaeum symbiosum A]
 gi|118195605|gb|ABK78523.1| dolichol-phosphate mannosyltransferase [Cenarchaeum symbiosum A]
          Length = 385

 Score = 70.3 bits (171), Expect = 8e-11,   Method: Composition-based stats.
 Identities = 12/125 (9%), Positives = 43/125 (34%), Gaps = 6/125 (4%)

Query: 3   QCIIFIINIVVVFFIDVMGFFILMKC--GADPFYSRIFSIAVAFLVTWIPSRLFIFLKLR 60
           +   F         ++ +   +L          ++ +  IA +    +  ++ + F    
Sbjct: 257 KAARFYTVGATGLLVNYLFSAMLAGWPADMWYLHANLAGIAASVSTNFALNKHWTFEDRD 316

Query: 61  RKSFL---ETVRYGVMYFMLSILNYAFYVKLLLTFQGLQPLLATVLSAVSSMLFVFLLYI 117
             +     +  ++ +     +++        L+    L+  +A VL+ +++    F+L  
Sbjct: 317 FGAARTVSQYGKFVLFSSAGALVQLGMVYH-LVEGHALEYPVALVLAVLTASFGNFILNK 375

Query: 118 RFMTR 122
           +   +
Sbjct: 376 KLTFK 380



 Score = 38.7 bits (89), Expect = 0.25,   Method: Composition-based stats.
 Identities = 10/60 (16%), Positives = 21/60 (35%)

Query: 62  KSFLETVRYGVMYFMLSILNYAFYVKLLLTFQGLQPLLATVLSAVSSMLFVFLLYIRFMT 121
           +   +  R+  +     ++NY F   L      +  L A +    +S+   F L   +  
Sbjct: 253 RFASKAARFYTVGATGLLVNYLFSAMLAGWPADMWYLHANLAGIAASVSTNFALNKHWTF 312



 Score = 36.4 bits (83), Expect = 1.4,   Method: Composition-based stats.
 Identities = 7/60 (11%), Positives = 24/60 (40%), Gaps = 1/60 (1%)

Query: 1   MKQCIIFIINIVVVFFIDVMGFFILMKCGA-DPFYSRIFSIAVAFLVTWIPSRLFIFLKL 59
           + Q   F++       + +   + L++  A +   + + ++  A    +I ++   F + 
Sbjct: 323 VSQYGKFVLFSSAGALVQLGMVYHLVEGHALEYPVALVLAVLTASFGNFILNKKLTFKEK 382


>gi|108800887|ref|YP_641084.1| glycosyl transferase family protein [Mycobacterium sp. MCS]
 gi|119870027|ref|YP_939979.1| glycosyl transferase family protein [Mycobacterium sp. KMS]
 gi|108771306|gb|ABG10028.1| glycosyl transferase, family 2 [Mycobacterium sp. MCS]
 gi|119696116|gb|ABL93189.1| glycosyl transferase, family 2 [Mycobacterium sp. KMS]
          Length = 421

 Score = 70.3 bits (171), Expect = 9e-11,   Method: Composition-based stats.
 Identities = 19/125 (15%), Positives = 45/125 (36%), Gaps = 5/125 (4%)

Query: 1   MKQCIIFIINIVVVFFIDVMGFFILMKCGADPFYSRIFSIAVAFLVTWIPSRLFIFLKLR 60
           ++Q + F    VV      +  F+L +       + + ++AV  +     +R F F    
Sbjct: 292 LRQAVRFGAVGVVSTLA-YLLLFMLTRGWLGAQAANLIALAVTAVGNTAANRRFTFGVAG 350

Query: 61  R----KSFLETVRYGVMYFMLSILNYAFYVKLLLTFQGLQPLLATVLSAVSSMLFVFLLY 116
           R    +   E      +   ++  + A    +      L  L   V + +++ +  F+L 
Sbjct: 351 RRGAARHHFEGFIVFAIALGITSGSLALLHSVSAEPHRLVELGVLVAANLAATVMRFVLL 410

Query: 117 IRFMT 121
             ++ 
Sbjct: 411 RGWVF 415


>gi|83591177|ref|YP_431186.1| GtrA-like protein [Moorella thermoacetica ATCC 39073]
 gi|83574091|gb|ABC20643.1| GtrA-like protein [Moorella thermoacetica ATCC 39073]
          Length = 130

 Score = 70.3 bits (171), Expect = 9e-11,   Method: Composition-based stats.
 Identities = 22/119 (18%), Positives = 49/119 (41%), Gaps = 1/119 (0%)

Query: 3   QCIIFIINIVVVFFIDVMGFFILMKCGADPFYSRIFSIAVAFLVTWIPSRLFIFLKLRRK 62
           Q + F    V    +D+  FF L   G     +++ S +     ++  +R + F    + 
Sbjct: 10  QFLRFCAVGVGNTVVDLTTFFGLTLVGMPYLLAQVLSYSAGVANSFFFNRKWTFRVTHKA 69

Query: 63  SFLETVRYGVMYFMLSILNYAFYVKLLLTFQGLQPLLATVLSAVSSMLFVFLLYIRFMT 121
           S LE +++  +  + S+L  +  + +L     LQ  L+   +    ++  FL    ++ 
Sbjct: 70  SALEVIKFITVNGL-SLLLSSGLLFILHDVTHLQLWLSKFSATGGGIVVNFLGSRLWVF 127


>gi|302559782|ref|ZP_07312124.1| dolichyl-phosphate beta-glucosyltransferase [Streptomyces
           griseoflavus Tu4000]
 gi|302477400|gb|EFL40493.1| dolichyl-phosphate beta-glucosyltransferase [Streptomyces
           griseoflavus Tu4000]
          Length = 462

 Score = 70.3 bits (171), Expect = 9e-11,   Method: Composition-based stats.
 Identities = 14/124 (11%), Positives = 41/124 (33%), Gaps = 5/124 (4%)

Query: 2   KQCIIFIINIVVVFFIDVMGFFILMKCGADPFYSRIFSIAVAFLVTWIPSRLFIFLKLRR 61
           +Q + F +  V+     ++ +            +   ++ V+ +     +R   F    R
Sbjct: 287 RQLVGFCVVGVLSTLFYLLLYSGFRTFT-GSQTANGLALLVSAVANTAANRRLTFGVRGR 345

Query: 62  KSFL----ETVRYGVMYFMLSILNYAFYVKLLLTFQGLQPLLATVLSAVSSMLFVFLLYI 117
              +    + +    +   L+  + A              L   V + +++ +  FLL+ 
Sbjct: 346 GGAVRHQAQGLVVFGIGLALTSGSLAALNAASSDPAHSTELAVLVAANLAATVLRFLLFR 405

Query: 118 RFMT 121
            ++ 
Sbjct: 406 AWVF 409


>gi|237750816|ref|ZP_04581296.1| predicted protein [Helicobacter bilis ATCC 43879]
 gi|229373261|gb|EEO23652.1| predicted protein [Helicobacter bilis ATCC 43879]
          Length = 278

 Score = 70.3 bits (171), Expect = 9e-11,   Method: Composition-based stats.
 Identities = 25/124 (20%), Positives = 53/124 (42%), Gaps = 2/124 (1%)

Query: 1   MKQCIIFIINIVVVFFIDVMGFFILMK-CGADPFYSRIFSIAVAFLVTWIPSRLFIFLKL 59
           +KQ I+F      +  ++++GF+IL K  G     + +    +A  +     R F+F + 
Sbjct: 128 LKQLILFFCIGGGITLLELLGFYILYKIFGVHYILASLIMFVLASGIGVWLYRRFVFGET 187

Query: 60  RRKSFLETVRYGVMYFMLSILNYAFYVKLLLTFQGLQPLLATVLSAVSSMLFVFLLYIRF 119
              S LE     ++  +   LN        + F G + ++A +L+++    + F      
Sbjct: 188 HLHSSLEVGLTYLINTIGIGLNTLILWLC-VEFLGFEAIVAKILASLLVAFYGFYARKLV 246

Query: 120 MTRR 123
           + R+
Sbjct: 247 IYRK 250



 Score = 38.7 bits (89), Expect = 0.23,   Method: Composition-based stats.
 Identities = 12/72 (16%), Positives = 28/72 (38%), Gaps = 1/72 (1%)

Query: 55  IFLKLRRKSFLETVRYGVMYFMLSILNYAFYVKLLLTFQGLQPLLATVLSAVSSMLFVFL 114
                  KS  + + +  +   +++L    +   L    G+  +LA+++  V +      
Sbjct: 119 NLDSKTHKSLKQLILFFCIGGGITLLELLGFYI-LYKIFGVHYILASLIMFVLASGIGVW 177

Query: 115 LYIRFMTRRVYF 126
           LY RF+    + 
Sbjct: 178 LYRRFVFGETHL 189


>gi|332188700|ref|ZP_08390414.1| gtrA-like family protein [Sphingomonas sp. S17]
 gi|332011264|gb|EGI53355.1| gtrA-like family protein [Sphingomonas sp. S17]
          Length = 366

 Score = 69.9 bits (170), Expect = 1e-10,   Method: Composition-based stats.
 Identities = 17/127 (13%), Positives = 45/127 (35%), Gaps = 8/127 (6%)

Query: 3   QCIIFIINIVVVFFIDVMGFFILM-KCGADPFYSRIFSIAVAFLVTWIPSRLFIFLKLRR 61
           +  +F    V+   + +    +     G +   S+I ++A A    +  +    +   R 
Sbjct: 241 RFAMFSAIGVLGVGVHMAVLSLFFVLLGVNFLASQIVAVAAAMTFNFFLNNALTYRDRRL 300

Query: 62  KSFL----ETVRYGVMYFMLSILNYAFYVKLLLTFQGLQPL-LATVLSAVSSMLFVFLLY 116
           + F       V + ++  + +I N        L         ++ ++  +   ++ + L 
Sbjct: 301 RGFRPLLDGWVSFCLVCAVGAIANVGV--AAFLHDARANEWAVSALIGVLVGAVWNYALS 358

Query: 117 IRFMTRR 123
            RF+  R
Sbjct: 359 SRFVWGR 365


>gi|118431038|ref|NP_147219.2| dolichol-phosphate mannosyltransferase [Aeropyrum pernix K1]
 gi|116062364|dbj|BAA79384.2| dolichol-phosphate mannosyltransferase [Aeropyrum pernix K1]
          Length = 361

 Score = 69.9 bits (170), Expect = 1e-10,   Method: Composition-based stats.
 Identities = 19/121 (15%), Positives = 34/121 (28%), Gaps = 5/121 (4%)

Query: 6   IFIINIVVVFFIDVMGFFILMKCGADPFYSRIFSIAVAFLVTWIPSRLFIFLK----LRR 61
            FI    +   +++  + +          S I       +   I      F         
Sbjct: 242 RFIAVGALGSLVNLAVYTLAFSATGVHPLSSILGFEAGLIHNAILHDRITFRNRSMWRSH 301

Query: 62  KSFLETVRYGVMYFMLSILNYAFYVKLLLTFQGLQPLLATVLSAVSSMLFVFLLYIRFMT 121
                  +Y         +  A     L +  GL PLL+  L   +  +  F L  R++ 
Sbjct: 302 SFLRRLAKYHATSAAGIAVGVAASTI-LYSLAGLHPLLSQALGIGAGFIVNFTLASRYIW 360

Query: 122 R 122
           R
Sbjct: 361 R 361


>gi|29829835|ref|NP_824469.1| dolichol-phosphate mannosyltransferase [Streptomyces avermitilis
           MA-4680]
 gi|29606944|dbj|BAC71004.1| putative dolichol-phosphate mannosyltransferase [Streptomyces
           avermitilis MA-4680]
          Length = 400

 Score = 69.9 bits (170), Expect = 1e-10,   Method: Composition-based stats.
 Identities = 18/123 (14%), Positives = 48/123 (39%), Gaps = 3/123 (2%)

Query: 1   MKQCIIFIINIVVVFFIDVMGFFILMKCGADPFYSRIFSIAVAFLVTWIPSRLFIFLKLR 60
           + + ++F +     F  +++G + L   G     + I +  +     ++     +F + R
Sbjct: 260 IARMVVFGLIGATGFVPNLLGLYALTALGMHYVPAEILANQLGVAWNFLLIEHLLFRERR 319

Query: 61  RKS--FLETVRYGVMYFMLSILNYAFYVKLLLTFQGLQPLLATVLSAVSSMLFVFLLYIR 118
           R    +    R+ ++     +L        L+   G++ L AT ++ V + +  F+    
Sbjct: 320 RHRTWWDRVGRFALLANADLVLRIPLIAL-LVGRFGMESLPATAVALVMTFVLRFVGTEA 378

Query: 119 FMT 121
            + 
Sbjct: 379 LVY 381



 Score = 36.0 bits (82), Expect = 1.7,   Method: Composition-based stats.
 Identities = 12/64 (18%), Positives = 23/64 (35%), Gaps = 2/64 (3%)

Query: 59  LRRKSFLETVRYGVMYFMLSILNYAFYVKLLLTFQGLQPLLATVLSAVSSMLFVFLLYIR 118
                    V +G++     + N        LT  G+  + A +L+    + + FLL   
Sbjct: 255 RTASPIARMVVFGLIGATGFVPNLLGLYA--LTALGMHYVPAEILANQLGVAWNFLLIEH 312

Query: 119 FMTR 122
            + R
Sbjct: 313 LLFR 316


>gi|312115439|ref|YP_004013035.1| Dolichyl-phosphate beta-D-mannosyltransferase [Rhodomicrobium
           vannielii ATCC 17100]
 gi|311220568|gb|ADP71936.1| Dolichyl-phosphate beta-D-mannosyltransferase [Rhodomicrobium
           vannielii ATCC 17100]
          Length = 380

 Score = 69.9 bits (170), Expect = 1e-10,   Method: Composition-based stats.
 Identities = 15/125 (12%), Positives = 42/125 (33%), Gaps = 6/125 (4%)

Query: 3   QCIIFIINIVVVFFIDVMGF-FILMKCGADPFYSRIFSIAVAFLVTWIPSRLFIFLKLRR 61
           + ++F +       + +      L+        S+  +  VA +  +  +    +   R 
Sbjct: 257 RFLLFSLVGFSGVLVHLGVLRAALVATPLSFATSQALATLVAAVSNFFLNNWLTYRDKRL 316

Query: 62  KSFL---ETVRYGVMYFMLSILNYAFYVKLLLTFQGLQPLLATVLSAVSSMLFVFLLYIR 118
             +      + + +   + +++N AF   +    +     LA +  A  S +  +     
Sbjct: 317 TGWQVIPGLITFLLACSVGAVVNVAFAETVFELTELW--WLAGIAGAAVSAVLNYATTSI 374

Query: 119 FMTRR 123
           F  R+
Sbjct: 375 FTWRK 379


>gi|220918286|ref|YP_002493590.1| GtrA family protein [Anaeromyxobacter dehalogenans 2CP-1]
 gi|219956140|gb|ACL66524.1| GtrA family protein [Anaeromyxobacter dehalogenans 2CP-1]
          Length = 703

 Score = 69.9 bits (170), Expect = 1e-10,   Method: Composition-based stats.
 Identities = 14/130 (10%), Positives = 32/130 (24%), Gaps = 11/130 (8%)

Query: 3   QCIIFIINIVVVFFIDVMGFFIL-MKCGADPFYSRIFSIAVAFLVTWIPSRLFIFLKLR- 60
           +   F         +++     L    G     +   +I  + L  ++    F F   R 
Sbjct: 18  RLARFAAVGGSGVVVNLAVLHALAQWLGVPEVAASALAIEASVLSNFLLHDAFTFRDRRG 77

Query: 61  -RKSFLETVRYGVMYFMLSILNYAFYVKLLLTFQGLQPL--------LATVLSAVSSMLF 111
                    RY  +  +   +    +  L L  +              A       +  +
Sbjct: 78  GHGRLARLGRYHAVSLVGVAIQLGTFAVLALLARHALGWPSLGSLRLPAQAAGIALAFAW 137

Query: 112 VFLLYIRFMT 121
            +    R+  
Sbjct: 138 SWAGSARWAW 147



 Score = 35.3 bits (80), Expect = 3.1,   Method: Composition-based stats.
 Identities = 14/65 (21%), Positives = 26/65 (40%), Gaps = 1/65 (1%)

Query: 58  KLRRKSFLETVRYGVMYFMLSILNYAFYVKLLLTFQGLQPLLATVLSAVSSMLFVFLLYI 117
                      R+  +     ++N A     L  + G+  + A+ L+  +S+L  FLL+ 
Sbjct: 10  GRGAPGAGRLARFAAVGGSGVVVNLAVLHA-LAQWLGVPEVAASALAIEASVLSNFLLHD 68

Query: 118 RFMTR 122
            F  R
Sbjct: 69  AFTFR 73



 Score = 33.7 bits (76), Expect = 8.7,   Method: Composition-based stats.
 Identities = 14/139 (10%), Positives = 36/139 (25%), Gaps = 20/139 (14%)

Query: 1   MKQCIIFIINIVVVFFIDVMGFFILM----------KCGADPFYSRIFSIAVAFLVTWIP 50
           + +   +    +V   I +  F +L             G+    ++   IA+AF  +W  
Sbjct: 82  LARLGRYHAVSLVGVAIQLGTFAVLALLARHALGWPSLGSLRLPAQAAGIALAFAWSWAG 141

Query: 51  SRLFIFLKLRRKSFLETV----------RYGVMYFMLSILNYAFYVKLLLTFQGLQPLLA 100
           S  + +                       +  +  +  +  +                + 
Sbjct: 142 SARWAWAGAGVARKPAAGGRGRGLLPVTLFAALVALHVLPIWLVRYFPTQDGPLHVENVL 201

Query: 101 TVLSAVSSMLFVFLLYIRF 119
            +L   +S L        +
Sbjct: 202 ALLGHGASPLLRGYYEANW 220


>gi|126436513|ref|YP_001072204.1| glycosyl transferase family protein [Mycobacterium sp. JLS]
 gi|126236313|gb|ABN99713.1| glycosyl transferase, family 2 [Mycobacterium sp. JLS]
          Length = 421

 Score = 69.9 bits (170), Expect = 1e-10,   Method: Composition-based stats.
 Identities = 19/125 (15%), Positives = 46/125 (36%), Gaps = 5/125 (4%)

Query: 1   MKQCIIFIINIVVVFFIDVMGFFILMKCGADPFYSRIFSIAVAFLVTWIPSRLFIFLKLR 60
           ++Q + F    VV      +  F+L +       + + ++AV  +     +R F F    
Sbjct: 292 LRQAVRFGAVGVVSTLA-YLLLFMLTRGWLGAQAANLIALAVTAVGNTAANRRFTFGVAG 350

Query: 61  R----KSFLETVRYGVMYFMLSILNYAFYVKLLLTFQGLQPLLATVLSAVSSMLFVFLLY 116
           R    +   E +    +   ++  + A    +      L  L   V + +++ +  F+L 
Sbjct: 351 RRGAARHHFEGLIVFAIALGITSGSLALLHSVSAEPHRLVELGVLVAANLAATVMRFVLL 410

Query: 117 IRFMT 121
             ++ 
Sbjct: 411 RGWVF 415


>gi|315186137|gb|EFU19899.1| GtrA family protein [Spirochaeta thermophila DSM 6578]
          Length = 150

 Score = 69.9 bits (170), Expect = 1e-10,   Method: Composition-based stats.
 Identities = 17/132 (12%), Positives = 42/132 (31%), Gaps = 12/132 (9%)

Query: 3   QCIIFIINIVVVFFIDVMGFFILMKCGADPFYSRIFSIAVAFLVTWIPSRLFIFLKLRRK 62
           Q + F +   +   IDV  F +L   G  P  ++  S     +  +   + + F + R  
Sbjct: 13  QFVRFNLVGTLNTLIDVGIFALLTSLGTPPVAAQPVSYFCGMVNGFFLHKYWTFRQRRGS 72

Query: 63  SFLETVRYGVMYFMLSILNYAFYVKL------------LLTFQGLQPLLATVLSAVSSML 110
             ++ +++  +     +L  +                  +       +     + V+  L
Sbjct: 73  WGVQALKFVFVNLAGILLTTSIIALFEELASSTGWGSTRILAWPAYVVAGKACALVAGSL 132

Query: 111 FVFLLYIRFMTR 122
             F     ++ R
Sbjct: 133 LTFTANRWWVFR 144



 Score = 34.1 bits (77), Expect = 5.8,   Method: Composition-based stats.
 Identities = 13/67 (19%), Positives = 30/67 (44%), Gaps = 2/67 (2%)

Query: 57  LKLRRKSFLETVRYGVMYFMLSILNYAFYVKLLLTFQGLQPLLATVLSAVSSMLFVFLLY 116
                +   + VR+ ++  + ++++   +   LLT  G  P+ A  +S    M+  F L+
Sbjct: 4   RARHLQLAFQFVRFNLVGTLNTLIDVGIFA--LLTSLGTPPVAAQPVSYFCGMVNGFFLH 61

Query: 117 IRFMTRR 123
             +  R+
Sbjct: 62  KYWTFRQ 68


>gi|284047372|ref|YP_003397712.1| GtrA family protein [Conexibacter woesei DSM 14684]
 gi|283951593|gb|ADB54337.1| GtrA family protein [Conexibacter woesei DSM 14684]
          Length = 147

 Score = 69.9 bits (170), Expect = 1e-10,   Method: Composition-based stats.
 Identities = 18/122 (14%), Positives = 46/122 (37%), Gaps = 2/122 (1%)

Query: 3   QCIIFIINIVVVFFIDVMGFFILMK-CGADPFYSRIFSIAVAFLVTWIPSRLFIFLKLRR 61
           Q + F +     + +++  F I +         + + +  V+    +  +R + F     
Sbjct: 27  QLVRFGLVGASGYAVNLAVFTIAVHPLDIGYRVAAVLAFLVSVTNNFWWNRHWTFDGRGG 86

Query: 62  KSFLETVRYGVMYFMLSILNYAFYVKLLLTFQGLQPLLATVLSAVSSMLFVFLLYIRFMT 121
            +  +  R+ ++  +    NYA  V  L+    +  + A  ++  ++    FL    +  
Sbjct: 87  HAGFQAARFFLVSIVAFAFNYAILVA-LVELADVPKVAAQAIAIAAATPLNFLGQKLWSF 145

Query: 122 RR 123
           RR
Sbjct: 146 RR 147


>gi|237786593|ref|YP_002907298.1| hypothetical protein ckrop_2051 [Corynebacterium kroppenstedtii DSM
           44385]
 gi|237759505|gb|ACR18755.1| putative membrane protein [Corynebacterium kroppenstedtii DSM
           44385]
          Length = 203

 Score = 69.9 bits (170), Expect = 1e-10,   Method: Composition-based stats.
 Identities = 19/129 (14%), Positives = 39/129 (30%), Gaps = 9/129 (6%)

Query: 1   MKQCIIFIINIVVVFFIDVMGFFILMK-CGADPFYSRIFSIAVAFLVTWIPSRLFIFLK- 58
           +     F+I   +   +D     I+    G     ++        +  +I +R + F   
Sbjct: 75  LTHLYKFVIAGGISAVVDYGLTMIIQHAFGQSYPLAKAIGFIFGTITAYIINRRWTFEAE 134

Query: 59  -LRRKSFLETVRYGVMYFMLSILNYAFYVKLLLTFQGLQPLLA----TVLSAVSSMLFVF 113
              +K       Y +M         A  V  LL   G    +A     V+    +    F
Sbjct: 135 PSAKKFLQTMSLYALM--FAVQWGLAVSVNHLLLNAGASAFIAGTVGYVIGQGVATAVNF 192

Query: 114 LLYIRFMTR 122
           ++    + +
Sbjct: 193 VVQRWVIFK 201



 Score = 35.6 bits (81), Expect = 2.0,   Method: Composition-based stats.
 Identities = 8/70 (11%), Positives = 25/70 (35%), Gaps = 1/70 (1%)

Query: 60  RRKSFLETVRYGVMYFMLSILNYAFYVKLLLTFQGLQPLLATVLSAVSSMLFVFLLYIRF 119
                    ++ +   + ++++Y   + +   F G    LA  +  +   +  +++  R+
Sbjct: 71  GASVLTHLYKFVIAGGISAVVDYGLTMIIQHAF-GQSYPLAKAIGFIFGTITAYIINRRW 129

Query: 120 MTRRVYFIKK 129
                   KK
Sbjct: 130 TFEAEPSAKK 139


>gi|227873848|ref|ZP_03992070.1| possible dolichyl-phosphate beta-D-mannosyltransferase
           [Oribacterium sinus F0268]
 gi|227840274|gb|EEJ50682.1| possible dolichyl-phosphate beta-D-mannosyltransferase
           [Oribacterium sinus F0268]
          Length = 473

 Score = 69.9 bits (170), Expect = 1e-10,   Method: Composition-based stats.
 Identities = 18/151 (11%), Positives = 46/151 (30%), Gaps = 30/151 (19%)

Query: 2   KQCIIFIINIVVVFFIDVMGFFILMKCGADPFYSRIFSIAVAFLVTWIPSRLFIFLKLRR 61
           KQ + F  + +V F  D + +          F S   +  ++  + +  ++  +F     
Sbjct: 269 KQILKFSASSLVSFLADFLLYSFFFLITGGLFVSNFLARVISLHINFFLNKTMVFSTDGE 328

Query: 62  K-----------------------------SFLETVRYGVMYFMLSILNYAFYVKLLLTF 92
           K                                E   Y  +   + ++N       ++  
Sbjct: 329 KEDIAESKKRMENARVQKGTKWNLSALKSFKKEEYFSYLGLAAFIFLINSFILS-GIVGS 387

Query: 93  QGLQPLLATVLSAVSSMLFVFLLYIRFMTRR 123
            G+ P LA +L+        + +  +++  +
Sbjct: 388 LGMNPYLAKILTEGLLFCLSYFVQKKWIFEK 418


>gi|145222856|ref|YP_001133534.1| glycosyl transferase family protein [Mycobacterium gilvum PYR-GCK]
 gi|145215342|gb|ABP44746.1| glycosyl transferase, family 2 [Mycobacterium gilvum PYR-GCK]
          Length = 411

 Score = 69.9 bits (170), Expect = 1e-10,   Method: Composition-based stats.
 Identities = 21/125 (16%), Positives = 48/125 (38%), Gaps = 5/125 (4%)

Query: 1   MKQCIIFIINIVVVFFIDVMGFFILMKCGADPFYSRIFSIAVAFLVTWIPSRLFIF---- 56
           ++Q + F    VV   +     F+LM+  A    + + ++ +  L     +R F F    
Sbjct: 276 LRQAVRFGAVGVVST-VAYTVLFLLMQGWAGAQPANVIALLLTALGNTAANRRFTFGVGG 334

Query: 57  LKLRRKSFLETVRYGVMYFMLSILNYAFYVKLLLTFQGLQPLLATVLSAVSSMLFVFLLY 116
              R +  +E +    +   L+    A    +  +   L  L   V++ + + +  F+L 
Sbjct: 335 RHRRGRHHVEGLIVFAIALALTSGALALLHAVAESPHHLVGLAVLVVANLLATVVRFVLL 394

Query: 117 IRFMT 121
             ++ 
Sbjct: 395 RGWVF 399


>gi|325003578|ref|ZP_08124690.1| predicted membrane protein [Pseudonocardia sp. P1]
          Length = 151

 Score = 69.9 bits (170), Expect = 1e-10,   Method: Composition-based stats.
 Identities = 16/124 (12%), Positives = 45/124 (36%), Gaps = 2/124 (1%)

Query: 1   MKQCIIFIINIVVVFFIDVMGFFILMKCGADPFYSRIFSIAVAFLVTWIPSRLFIFLKLR 60
           ++Q   F++   +   +D   + +L+  G     S+  S  +     ++ ++ F F    
Sbjct: 27  VRQLGSFVVIGALSAVVDFGFYHLLLNLGLWVPVSKGISFVLGTTTAYLLNKRFTFTGAN 86

Query: 61  RKSFLETVRYGVMYFMLSILNYAFYVKLLLTFQGLQP--LLATVLSAVSSMLFVFLLYIR 118
                    +  +Y     +N      +L     L+    LA +++  ++    F++   
Sbjct: 87  TGGKGRFAGFVALYGTTFAVNVGVNSLVLHLLPPLEYGTSLAWLIAQGTATAINFVMLRY 146

Query: 119 FMTR 122
            + +
Sbjct: 147 VIFK 150


>gi|325527166|gb|EGD04567.1| GtrA family protein [Burkholderia sp. TJI49]
          Length = 137

 Score = 69.9 bits (170), Expect = 1e-10,   Method: Composition-based stats.
 Identities = 30/124 (24%), Positives = 53/124 (42%), Gaps = 3/124 (2%)

Query: 2   KQCIIFIINIVVVFFIDVMGFFILMKCGADPFYSRIFSIAVAFLVTWIPSRLFIF-LKLR 60
           +Q   F +   + F +D    +++++ G  P+  R+ S   A   TW  +R   F     
Sbjct: 6   RQAAFFAVAGAIGFVVDAGILYLMLRLGTGPYLGRVISFLCAAFTTWQINRRVTFSRSHG 65

Query: 61  RKSFLETVRYGVMYFMLSILNYAFYVKL--LLTFQGLQPLLATVLSAVSSMLFVFLLYIR 118
           R ++ E   Y +   +  I NYA YV    LL      PL+A    +++ M+  F     
Sbjct: 66  RSAWREWFEYLLAMAVGGICNYAVYVLTIRLLHAGTFAPLIAVAAGSLAGMVINFASAKL 125

Query: 119 FMTR 122
           ++ R
Sbjct: 126 WVFR 129


>gi|172041630|ref|YP_001801344.1| hypothetical protein cur_1951 [Corynebacterium urealyticum DSM
           7109]
 gi|171852934|emb|CAQ05910.1| putative membrane protein [Corynebacterium urealyticum DSM 7109]
          Length = 218

 Score = 69.9 bits (170), Expect = 1e-10,   Method: Composition-based stats.
 Identities = 14/159 (8%), Positives = 45/159 (28%), Gaps = 38/159 (23%)

Query: 2   KQCIIFIINIVVVFFIDVMGFFILMKCGA----------------------DPFYSRIFS 39
           +Q + F +     F ++ + F +  K                               + +
Sbjct: 33  RQFVRFGLVGASGFVVNQVVFVLAKKFFDRGFGIDDLEVLFQLLNTQWNMRWYHLFSVLA 92

Query: 40  IAVAFLVTWIPSRLFIFLKLRR-KSFLETVRYGVMYFMLSILNYAFYVKLLLTFQGLQP- 97
             VA +  ++ +R + F    +   +++  ++  +     ++  A    ++ T   +   
Sbjct: 93  FLVANVWNFVLNRYWTFKGHHKQPWWIQLPQFMAVGVFGLLITLAVSTLVVHTNSPIGLP 152

Query: 98  --------------LLATVLSAVSSMLFVFLLYIRFMTR 122
                              +  + ++   FL    +  R
Sbjct: 153 EDIFDNSTGLRTRSYWGNFIGVIVAVPANFLFNKLWTFR 191



 Score = 35.3 bits (80), Expect = 3.1,   Method: Composition-based stats.
 Identities = 9/79 (11%), Positives = 22/79 (27%), Gaps = 17/79 (21%)

Query: 3   QCIIFIINIVVVFFIDVMGFFILMK-----------------CGADPFYSRIFSIAVAFL 45
           Q   F+   V    I +    +++                       ++     + VA  
Sbjct: 120 QLPQFMAVGVFGLLITLAVSTLVVHTNSPIGLPEDIFDNSTGLRTRSYWGNFIGVIVAVP 179

Query: 46  VTWIPSRLFIFLKLRRKSF 64
             ++ ++L+ F     K  
Sbjct: 180 ANFLFNKLWTFRNKGPKGA 198


>gi|163841750|ref|YP_001626155.1| monosaccharide translocase (flippase type) [Renibacterium
           salmoninarum ATCC 33209]
 gi|162955226|gb|ABY24741.1| monosaccharide translocase (flippase type) [Renibacterium
           salmoninarum ATCC 33209]
          Length = 196

 Score = 69.9 bits (170), Expect = 1e-10,   Method: Composition-based stats.
 Identities = 18/127 (14%), Positives = 45/127 (35%), Gaps = 7/127 (5%)

Query: 2   KQCIIFIINIVVVFFIDVMGFFILMK--CGADPFYSRIFSIAVAFLVTWIPSRLFIFLKL 59
           ++   F +   + F ID   F  L          +++  +  VA + +W+ +R + F   
Sbjct: 33  REVAKFGVVGGIAFVIDSAIFIWLFSGPLHGSEVWAKAIATIVASVFSWVANRYWTFRHR 92

Query: 60  RR-KSFLETVRYGVMYFMLSILNYAFYVKLLLTFQGLQ----PLLATVLSAVSSMLFVFL 114
           ++     E V + +M  +  ++                     +  +V+  +   +F F 
Sbjct: 93  KQANVVREAVLFAIMNGVGLLIASGCVFVAKYWLGVDSKVGLFIAGSVVGLILGTIFRFF 152

Query: 115 LYIRFMT 121
            Y  ++ 
Sbjct: 153 AYRFWVF 159



 Score = 37.6 bits (86), Expect = 0.54,   Method: Composition-based stats.
 Identities = 8/59 (13%), Positives = 27/59 (45%)

Query: 64  FLETVRYGVMYFMLSILNYAFYVKLLLTFQGLQPLLATVLSAVSSMLFVFLLYIRFMTR 122
           + E  ++GV+  +  +++ A ++ L         + A  ++ + + +F ++    +  R
Sbjct: 32  WREVAKFGVVGGIAFVIDSAIFIWLFSGPLHGSEVWAKAIATIVASVFSWVANRYWTFR 90


>gi|13541793|ref|NP_111481.1| hypothetical protein TVN0962 [Thermoplasma volcanium GSS1]
 gi|14325208|dbj|BAB60133.1| hypothetical protein [Thermoplasma volcanium GSS1]
          Length = 315

 Score = 69.9 bits (170), Expect = 1e-10,   Method: Composition-based stats.
 Identities = 14/124 (11%), Positives = 45/124 (36%), Gaps = 8/124 (6%)

Query: 4   CIIFIINIVVVFFIDVMGFFILMKCGADPFYSRIFSIAVAFLVTWIPSRLFIFLKLR--- 60
            + ++        ++ M   +L        ++   +I  +    ++ +  + F   +   
Sbjct: 185 LLRYLAVGTSGIVVNEMLLKLLSY-HIPLTFADALAIETSISTNFLLNEYWTFRGRKVSK 243

Query: 61  --RKSFLETVRYGVMYFMLSILNYAFYVKLLLTFQGLQPLLATVLSAVSSMLFVFLLYIR 118
             +  F     +     +   +N   +   LL + G + L+A ++   ++ L  +L+  R
Sbjct: 244 SVKNIFKRMGLHNFTSLLGLGINLGIF--TLLVYGGTEILIANMIGITAAFLSRYLMSSR 301

Query: 119 FMTR 122
            + +
Sbjct: 302 IIWK 305



 Score = 34.9 bits (79), Expect = 4.0,   Method: Composition-based stats.
 Identities = 11/54 (20%), Positives = 23/54 (42%)

Query: 9   INIVVVFFIDVMGFFILMKCGADPFYSRIFSIAVAFLVTWIPSRLFIFLKLRRK 62
              ++   I++  F +L+  G +   + +  I  AFL  ++ S   I+     K
Sbjct: 257 FTSLLGLGINLGIFTLLVYGGTEILIANMIGITAAFLSRYLMSSRIIWKNKNEK 310


>gi|54022177|ref|YP_116419.1| hypothetical protein nfa2130 [Nocardia farcinica IFM 10152]
 gi|54013685|dbj|BAD55055.1| hypothetical protein [Nocardia farcinica IFM 10152]
          Length = 202

 Score = 69.5 bits (169), Expect = 1e-10,   Method: Composition-based stats.
 Identities = 24/126 (19%), Positives = 50/126 (39%), Gaps = 11/126 (8%)

Query: 7   FIINIVVVFFIDVMGFFILMKC------GADPFYSRIFSIAVAFLVTWIPSRLFIFLKLR 60
           F++  V+ F +D   + +L+           P  ++I SIA+A +VT+  ++ + F   +
Sbjct: 60  FLVVGVIGFLVDAGTYNLLVFWIDGGVMRHAPLPAKIISIALATVVTYFGNKWWTFGHKQ 119

Query: 61  RK-SFLETVRYGVMYFMLSILNYAFY----VKLLLTFQGLQPLLATVLSAVSSMLFVFLL 115
                 E + Y +   +   L           L L       +  T++    +M+F +  
Sbjct: 120 SGNPVREYLLYALFNAIAIGLQLGCLGFSRYVLDLASPLADNISGTLIGQAVAMIFRYWA 179

Query: 116 YIRFMT 121
           Y  F+ 
Sbjct: 180 YDTFVF 185


>gi|295704200|ref|YP_003597275.1| GtrA-like protein [Bacillus megaterium DSM 319]
 gi|294801859|gb|ADF38925.1| GtrA-like protein [Bacillus megaterium DSM 319]
          Length = 134

 Score = 69.5 bits (169), Expect = 1e-10,   Method: Composition-based stats.
 Identities = 23/118 (19%), Positives = 54/118 (45%), Gaps = 1/118 (0%)

Query: 4   CIIFIINIVVVFFIDVMGFFILMKCGADPFYSRIFSIAVAFLVTWIPSRLFIFLKLRRKS 63
            I F +  V+   ID + + +L   G +   ++  S +   L +++ +R + F +  + S
Sbjct: 8   FIKFALVGVLNTLIDFVVYALLTTIGVNYILAQWISYSAGILNSYVMNRKWTFERKEKSS 67

Query: 64  FLETVRYGVMYFMLSILNYAFYVKLLLTFQGLQPLLATVLSAVSSMLFVFLLYIRFMT 121
             E + + ++  +   L  +F + +L    G+  LL+ +L  + S+   F+    F+ 
Sbjct: 68  KREVISFVIVNLITLSLT-SFLLTVLYNKWGVALLLSKLLITIVSVGINFIGTKLFVF 124


>gi|312200458|ref|YP_004020519.1| glycosyl transferase family 2 [Frankia sp. EuI1c]
 gi|311231794|gb|ADP84649.1| glycosyl transferase family 2 [Frankia sp. EuI1c]
          Length = 455

 Score = 69.5 bits (169), Expect = 1e-10,   Method: Composition-based stats.
 Identities = 14/124 (11%), Positives = 41/124 (33%), Gaps = 5/124 (4%)

Query: 1   MKQCIIFIINIVVVFFIDVMGFFILMKCGADPFYSRIFSIAVAFLVTWIPSRLFIFLKLR 60
           ++Q   F    +      +  F +L         +  F++ V  +     +R   F +  
Sbjct: 295 IQQLARFGAIGIASTAAYLALFVLLRGW-FGAQGANFFALLVTAIANTAANRRLTFGQRG 353

Query: 61  RKSFLETVRYGVMYFMLSILNYAFYVKLLLTFQGLQ---PLLATVLSAVSSMLFVFLLYI 117
             +  + +   +++ +   L       +     G      L A + + + + L  F+ + 
Sbjct: 354 VGARSQ-IEGLIVFGLGLALTSGALGAVRALAPGAGRGVELSALIAANLMATLLRFVAFR 412

Query: 118 RFMT 121
            ++ 
Sbjct: 413 AWVF 416


>gi|167648751|ref|YP_001686414.1| hypothetical protein Caul_4796 [Caulobacter sp. K31]
 gi|167351181|gb|ABZ73916.1| UbiA prenyltransferase [Caulobacter sp. K31]
          Length = 631

 Score = 69.5 bits (169), Expect = 1e-10,   Method: Composition-based stats.
 Identities = 22/126 (17%), Positives = 44/126 (34%), Gaps = 7/126 (5%)

Query: 4   CIIFIINIVVVFFIDVMGFFILMKCGADPFYSRIFSIAVAFLVTWIPSRLFIFLKLRRKS 63
            + F++   V    +    F          +S   +  V     ++ SRLF+F    RK 
Sbjct: 5   FLRFLLVGGVAAAANWGSRFFF-AAHMSLGWSVAAAYMVGMTTAYVLSRLFVFESSGRKV 63

Query: 64  FLETVRYGVMYFMLSILNYAF------YVKLLLTFQGLQPLLATVLSAVSSMLFVFLLYI 117
           + E +R+  +  +  I           Y    + F      +A  +  +S  +  +L + 
Sbjct: 64  WDEYLRFAAVNVVAWIQVELITIGLVRYGFPAIGFHWHPESVAHAIGVLSPAVTSYLGHR 123

Query: 118 RFMTRR 123
            F  +R
Sbjct: 124 HFTFKR 129


>gi|328883821|emb|CCA57060.1| putative glycosyl transferase [Streptomyces venezuelae ATCC 10712]
          Length = 437

 Score = 69.5 bits (169), Expect = 1e-10,   Method: Composition-based stats.
 Identities = 17/124 (13%), Positives = 46/124 (37%), Gaps = 5/124 (4%)

Query: 2   KQCIIFIINIVVVFFIDVMGFFILMKCGADPFYSRIFSIAVAFLVTWIPSRLFIFLKLRR 61
           +Q + F +  V+     +   + L + G  P ++   ++ V+ +     +R   F    R
Sbjct: 301 RQLVGFCVVGVLSTLFYLA-LYSLFRLGVGPQFANAAALLVSAVANTAANRRLTFGVRGR 359

Query: 62  KSFL----ETVRYGVMYFMLSILNYAFYVKLLLTFQGLQPLLATVLSAVSSMLFVFLLYI 117
              +    + +    +   L+  + A              L   V++ +++ +  FLL+ 
Sbjct: 360 DRAVRHQAQGLVVFAIGLALTSGSLAALGAASGDPAHSTELAVLVVANLAATVLRFLLFR 419

Query: 118 RFMT 121
            ++ 
Sbjct: 420 LWVF 423


>gi|326776871|ref|ZP_08236136.1| glycosyl transferase family 2 [Streptomyces cf. griseus XylebKG-1]
 gi|326657204|gb|EGE42050.1| glycosyl transferase family 2 [Streptomyces cf. griseus XylebKG-1]
          Length = 507

 Score = 69.5 bits (169), Expect = 1e-10,   Method: Composition-based stats.
 Identities = 18/118 (15%), Positives = 44/118 (37%), Gaps = 4/118 (3%)

Query: 1   MKQCIIFIINIVVVFFIDVMGFFILMKCGADPFYSRIFSIAVAFLVTWIPSRLFIFLKLR 60
           ++Q   F++   V   + +  +  L +       + +   AV+ + +++ +         
Sbjct: 358 VRQFGSFLLIGCVNTAVYLGIYASLNRF-IPYLTAHVIGYAVSIVCSFLLNSYVT--CRT 414

Query: 61  RKSFLETVRYGVMYFMLSILNYAFYVKLLLTFQGLQPLLATVLSAVSSMLFVFLLYIR 118
           R ++   VRY +   +  + + A      +   G+   LA + + V      FLL   
Sbjct: 415 RPTWHAFVRYPISSLVNLVASGALLYGA-VGVLGMDKNLAALAAGVLVTPVSFLLARW 471


>gi|302524275|ref|ZP_07276617.1| transmembrane protein [Streptomyces sp. AA4]
 gi|302433170|gb|EFL04986.1| transmembrane protein [Streptomyces sp. AA4]
          Length = 166

 Score = 69.5 bits (169), Expect = 1e-10,   Method: Composition-based stats.
 Identities = 17/135 (12%), Positives = 48/135 (35%), Gaps = 15/135 (11%)

Query: 2   KQCIIFIINIVVVFFIDVMGFFIL--MKCGADPFYSRIFSIAVAFLVTWIPSRLFIFLKL 59
           ++ + F +     F I +   ++L        P  + I  + +A + +++ +R + F   
Sbjct: 9   RELVRFALVGGTSFVITLTITYVLKFTVLRTHPVTALIVGVLIATIFSYVANREWAFRTR 68

Query: 60  -RRKSFLETVRYGVMYFMLSILNYA------------FYVKLLLTFQGLQPLLATVLSAV 106
             R+   E   + ++  +   LN                   L+  +    +   V+  +
Sbjct: 69  GGRERAHEAALFFLISGVALGLNALPQWVSRYVLQLQVPHVSLVGQEVADFVSGMVIGTL 128

Query: 107 SSMLFVFLLYIRFMT 121
              LF +  + +++ 
Sbjct: 129 LGTLFRWWAFKKWVF 143



 Score = 41.0 bits (95), Expect = 0.057,   Method: Composition-based stats.
 Identities = 9/59 (15%), Positives = 23/59 (38%)

Query: 64  FLETVRYGVMYFMLSILNYAFYVKLLLTFQGLQPLLATVLSAVSSMLFVFLLYIRFMTR 122
             E VR+ ++     ++       L  T     P+ A ++  + + +F ++    +  R
Sbjct: 8   HRELVRFALVGGTSFVITLTITYVLKFTVLRTHPVTALIVGVLIATIFSYVANREWAFR 66


>gi|18312711|ref|NP_559378.1| dolichol-phosphate mannosyltransferase [Pyrobaculum aerophilum str.
           IM2]
 gi|18160188|gb|AAL63560.1| dolichol-phosphate mannosyltransferase [Pyrobaculum aerophilum str.
           IM2]
          Length = 339

 Score = 69.5 bits (169), Expect = 2e-10,   Method: Composition-based stats.
 Identities = 20/118 (16%), Positives = 42/118 (35%), Gaps = 4/118 (3%)

Query: 5   IIFIINIVVVFFIDVMGFFILMKCGADPFYSRIFSIAVAFLVTWIPSRLFIFLKLRRKSF 64
           + F         I +M  + L      P  S   +I V+    ++ +R + F   +    
Sbjct: 226 LKFAAVGATGIGIALMVIYALGWL--PPLISTAAAIEVSLTSNYVLNRSWTFADRQTPFL 283

Query: 65  LETVRYGVMYFMLSILNYAFYVKLLLTFQGLQPLLATVLSAVSSMLFVFLLYIRFMTR 122
               +Y +   + +I NY   V   L   GL    + VL  ++  +  ++     + +
Sbjct: 284 AGWAKYHLATAIGNITNY--LVTNGLALLGLWIYASYVLGVIAGYIANYVFSELRVFK 339


>gi|197123487|ref|YP_002135438.1| GtrA family protein [Anaeromyxobacter sp. K]
 gi|196173336|gb|ACG74309.1| GtrA family protein [Anaeromyxobacter sp. K]
          Length = 703

 Score = 69.5 bits (169), Expect = 2e-10,   Method: Composition-based stats.
 Identities = 14/130 (10%), Positives = 32/130 (24%), Gaps = 11/130 (8%)

Query: 3   QCIIFIINIVVVFFIDVMGFFIL-MKCGADPFYSRIFSIAVAFLVTWIPSRLFIFLKL-- 59
           +   F         +++     L    G     +   +I  + L  ++    F F     
Sbjct: 18  RLARFAAVGGSGVVVNLAVLHALAQWLGVPEVAASALAIEASVLSNFLLHDAFTFRDRRG 77

Query: 60  RRKSFLETVRYGVMYFMLSILNYAFYVKLLLTFQGLQPL--------LATVLSAVSSMLF 111
           R        RY  +  +   +    +  L L  +              A       +  +
Sbjct: 78  RHGRLARLGRYHAVSLVGVAIQLGTFAVLALLARHALGWPSLGSLRLPAQAAGIALAFAW 137

Query: 112 VFLLYIRFMT 121
            +    R+  
Sbjct: 138 SWAGSARWAW 147



 Score = 34.9 bits (79), Expect = 3.7,   Method: Composition-based stats.
 Identities = 14/65 (21%), Positives = 26/65 (40%), Gaps = 1/65 (1%)

Query: 58  KLRRKSFLETVRYGVMYFMLSILNYAFYVKLLLTFQGLQPLLATVLSAVSSMLFVFLLYI 117
                      R+  +     ++N A     L  + G+  + A+ L+  +S+L  FLL+ 
Sbjct: 10  GRGAPGAGRLARFAAVGGSGVVVNLAVLHA-LAQWLGVPEVAASALAIEASVLSNFLLHD 68

Query: 118 RFMTR 122
            F  R
Sbjct: 69  AFTFR 73



 Score = 33.7 bits (76), Expect = 8.5,   Method: Composition-based stats.
 Identities = 14/139 (10%), Positives = 36/139 (25%), Gaps = 20/139 (14%)

Query: 1   MKQCIIFIINIVVVFFIDVMGFFILM----------KCGADPFYSRIFSIAVAFLVTWIP 50
           + +   +    +V   I +  F +L             G+    ++   IA+AF  +W  
Sbjct: 82  LARLGRYHAVSLVGVAIQLGTFAVLALLARHALGWPSLGSLRLPAQAAGIALAFAWSWAG 141

Query: 51  SRLFIFLKLRRKSFLET----------VRYGVMYFMLSILNYAFYVKLLLTFQGLQPLLA 100
           S  + +                       +  +  +  +  +                + 
Sbjct: 142 SARWAWAGAGVARKPAAGSRGRGLLPVALFAALVALHVLPIWLVRYFPTQDGPLHVENVL 201

Query: 101 TVLSAVSSMLFVFLLYIRF 119
            +L   +S L        +
Sbjct: 202 ALLGHGASPLLRGYYEANW 220


>gi|294629734|ref|ZP_06708294.1| integral membrane protein [Streptomyces sp. e14]
 gi|292833067|gb|EFF91416.1| integral membrane protein [Streptomyces sp. e14]
          Length = 170

 Score = 69.2 bits (168), Expect = 2e-10,   Method: Composition-based stats.
 Identities = 18/130 (13%), Positives = 44/130 (33%), Gaps = 5/130 (3%)

Query: 5   IIFIINIVVVFFIDVMGFFILMKCGADPFY-SRIFSIAVAFLVTWIPSRLFIFLKLRRK- 62
           + F         ++++ F ++      P   + I +  V+ +  +I  R F +    +  
Sbjct: 1   MKFGAVGGAGLLVNLLVFNLVRHVTDLPVVRASIIATVVSIVFNYIGFRYFTYRDRDKSG 60

Query: 63  SFLETVRYGVMYFMLSILNYAFYVKLLLTFQGLQPLLA---TVLSAVSSMLFVFLLYIRF 119
              E   + +   +  ++           F    PL +     L    + LF F  Y  +
Sbjct: 61  RTKELTLFLLFSAVGLVIENGVLYLATYGFGWDTPLQSNVFKFLGIGIATLFRFWSYRTW 120

Query: 120 MTRRVYFIKK 129
           + R +   ++
Sbjct: 121 VFRALPVAEE 130


>gi|160893713|ref|ZP_02074497.1| hypothetical protein CLOL250_01267 [Clostridium sp. L2-50]
 gi|156864698|gb|EDO58129.1| hypothetical protein CLOL250_01267 [Clostridium sp. L2-50]
          Length = 1060

 Score = 69.2 bits (168), Expect = 2e-10,   Method: Composition-based stats.
 Identities = 14/124 (11%), Positives = 49/124 (39%), Gaps = 6/124 (4%)

Query: 5   IIFIINIVVVFFIDVMGFFILMKCGA-DPFYSRIFSIAVAFLVTWIPSRLFIFLKLRRK- 62
           + ++I       ++++ F++L          + I +I++A L  +  ++ F+F +  +K 
Sbjct: 13  VRYVIAGGATTVVNIVSFYLLRLFTDLSRSVANIIAISLAILFAFFANKFFVFTESSKKD 72

Query: 63  ---SFLETVRYGVMYFMLSILNYAFYVKLLLTFQGLQPLLATVLSAVSSMLFVFLLYIRF 119
                 E + +     +  ++       LL         ++ ++     ++  ++    F
Sbjct: 73  AGTLIREFISFVGTRLLAMLVE-VVGTNLLCDSFRYNEFISKIIVQFFVVIINYVFGKCF 131

Query: 120 MTRR 123
           + ++
Sbjct: 132 VFKK 135


>gi|296138777|ref|YP_003646020.1| GtrA family protein [Tsukamurella paurometabola DSM 20162]
 gi|296026911|gb|ADG77681.1| GtrA family protein [Tsukamurella paurometabola DSM 20162]
          Length = 194

 Score = 69.2 bits (168), Expect = 2e-10,   Method: Composition-based stats.
 Identities = 24/133 (18%), Positives = 49/133 (36%), Gaps = 14/133 (10%)

Query: 3   QCIIFIINIVVVFFIDVMGFFILMK--CGADPFYSRIFSIAVAFLVTWIPSRLFIFLKL- 59
           + I F I        D+  F+ L+       P  ++IFS   A ++++I +R + F    
Sbjct: 34  ELIKFAIVGATTCVFDLAIFYSLVFTVLDEKPTVAKIFSGVCAVILSYILNREWSFKNRG 93

Query: 60  RRKSFLETVRYGVMYFMLSILNYAFYVKLLLTFQG-----------LQPLLATVLSAVSS 108
            R+   E + + V+  +  ++  A        F             +  +L  ++  +  
Sbjct: 94  GRERHHEALLFFVISGIGVLIMAAPIFIANNVFNLRATDSKTTLIVVDFVLNYIVGNLLQ 153

Query: 109 MLFVFLLYIRFMT 121
           M F F    R+  
Sbjct: 154 MAFRFWALRRWAF 166



 Score = 38.7 bits (89), Expect = 0.24,   Method: Composition-based stats.
 Identities = 9/59 (15%), Positives = 28/59 (47%)

Query: 64  FLETVRYGVMYFMLSILNYAFYVKLLLTFQGLQPLLATVLSAVSSMLFVFLLYIRFMTR 122
             E +++ ++     + + A +  L+ T    +P +A + S V +++  ++L   +  +
Sbjct: 32  HHELIKFAIVGATTCVFDLAIFYSLVFTVLDEKPTVAKIFSGVCAVILSYILNREWSFK 90


>gi|317124383|ref|YP_004098495.1| GtrA family protein [Intrasporangium calvum DSM 43043]
 gi|315588471|gb|ADU47768.1| GtrA family protein [Intrasporangium calvum DSM 43043]
          Length = 235

 Score = 69.2 bits (168), Expect = 2e-10,   Method: Composition-based stats.
 Identities = 16/151 (10%), Positives = 40/151 (26%), Gaps = 33/151 (21%)

Query: 4   CIIFIINIVVVFFIDVMGFFILMKCGADPFYS-----------------RIFSIAVAFLV 46
            + F +       +++    ++ + G DP ++                    +  VA L 
Sbjct: 36  LVRFGLVGASGVVVNLATLILVKRLGTDPDHAIIGLPWSDYNLRWYHAYSTVAFLVANLW 95

Query: 47  TWIPSRLFIFL-KLRRKSFLETVRYGVMYFMLSILNYAFYVKLLLTFQGLQ--------- 96
            +  +R + F  +     + E   +  +  +  +        L+     L          
Sbjct: 96  NFQLNRTWTFRSERHPAWWREYWPFLTVGLLGQVAGLLLLTLLMHPHSPLALPTDLLDDT 155

Query: 97  ------PLLATVLSAVSSMLFVFLLYIRFMT 121
                    A +L         F+L   +  
Sbjct: 156 TGLRTRLYWAQLLVIAVVTPLSFVLNKLWTF 186


>gi|260905438|ref|ZP_05913760.1| GtrA family protein [Brevibacterium linens BL2]
          Length = 162

 Score = 69.2 bits (168), Expect = 2e-10,   Method: Composition-based stats.
 Identities = 19/133 (14%), Positives = 45/133 (33%), Gaps = 13/133 (9%)

Query: 3   QCIIFIINIVVVFFIDVMGFFILMK--------CGADPFYSRIFSIAVAFLVTWIPSRLF 54
           +   F+    + + +DV    +L              P  ++I S  ++  V W+ +RL+
Sbjct: 7   EAFKFLTVGGLGYIVDVGLSNVLAYGLGSIPPLLEGSPIKAKIVSTIISMAVVWMGNRLW 66

Query: 55  IFLKLRRKSFLETV-RYGVMYFMLSILNYAFYVKLLLTF----QGLQPLLATVLSAVSSM 109
            +      S L  +  +  +     I+                Q    +   ++    +M
Sbjct: 67  TYGDRTTGSNLRGISLFIAVNMAGMIITVIPLGVTWYLLDMRDQLTYNISTNIIGVGLAM 126

Query: 110 LFVFLLYIRFMTR 122
           +F F  Y  ++ +
Sbjct: 127 IFRFYAYRTWVFK 139


>gi|269127419|ref|YP_003300789.1| GtrA family protein [Thermomonospora curvata DSM 43183]
 gi|268312377|gb|ACY98751.1| GtrA family protein [Thermomonospora curvata DSM 43183]
          Length = 151

 Score = 69.2 bits (168), Expect = 2e-10,   Method: Composition-based stats.
 Identities = 16/124 (12%), Positives = 43/124 (34%), Gaps = 5/124 (4%)

Query: 3   QCIIFIINIVVVFFIDVMGFFILM-KCGADPFYSRIFSIAVAFLVTWIPSRLFIFLKLRR 61
           + + F     +   I + G  +L  +    P  + +    ++ L +++ +R + F     
Sbjct: 22  ELLRFGTVGTIGTVITIGGANLLRERLWESPVTTVLIPTMISTLFSYLANRHWTFRHRDS 81

Query: 62  -KSFLETVRYGVMYFMLSILNYAFYVKLLLTFQG---LQPLLATVLSAVSSMLFVFLLYI 117
             S  E   +  +  +   +  +       T      L   +A V+    +  + +  Y 
Sbjct: 82  DGSGREMALFFGLNGVGMAIQASCTAFTFYTLHLHDALSYNVALVVGLALASAWRYWSYR 141

Query: 118 RFMT 121
           R++ 
Sbjct: 142 RWIF 145


>gi|320531347|ref|ZP_08032319.1| GtrA-like protein [Actinomyces sp. oral taxon 171 str. F0337]
 gi|320136438|gb|EFW28414.1| GtrA-like protein [Actinomyces sp. oral taxon 171 str. F0337]
          Length = 155

 Score = 69.2 bits (168), Expect = 2e-10,   Method: Composition-based stats.
 Identities = 21/121 (17%), Positives = 46/121 (38%), Gaps = 2/121 (1%)

Query: 3   QCIIFIINIVVVFFIDVMGFFILMKCGADPFYSRIFSIAVAFLVTWIPSRLFIFLKLRR- 61
           Q   F++   + F +D   F +L   G     +   S + + ++ +I SR ++F      
Sbjct: 14  QFGRFLVVGGISFCVDFGLFTVLYGLGVPHLVASATSFSTSVVLNYILSRRYVFEAQENV 73

Query: 62  KSFLETVRYGVMYFMLSILNYAFYVKLLLTFQGLQPLLATVLSAVSSMLFVFLLYIRFMT 121
               E   Y ++  +   LN            G+ P L  +++    +++ F+     + 
Sbjct: 74  SVLKEFTLYVLLNVVALGLNTLILYVC-ADLAGMSPFLGKIIATAIVLIYNFISRKALLE 132

Query: 122 R 122
           R
Sbjct: 133 R 133


>gi|331003646|ref|ZP_08327141.1| hypothetical protein HMPREF0491_02003 [Lachnospiraceae oral taxon
           107 str. F0167]
 gi|330412273|gb|EGG91666.1| hypothetical protein HMPREF0491_02003 [Lachnospiraceae oral taxon
           107 str. F0167]
          Length = 354

 Score = 69.2 bits (168), Expect = 2e-10,   Method: Composition-based stats.
 Identities = 19/130 (14%), Positives = 45/130 (34%), Gaps = 4/130 (3%)

Query: 3   QCIIFIINIVVVFFIDVMGFFILMKCGADPFYSRIFSIAVAFLVTWIPS---RLFIFLKL 59
           Q I F  + ++ F ID + + I          S   +  ++    +  +           
Sbjct: 221 QIIKFCTSSILSFIIDFLVYTICFLFSGSIVLSNAIARIISLHFNFYINKKFVFKNKKND 280

Query: 60  RRKSFLETVRYGVMYFMLSILNYAFYVKLLLTFQGLQPLLATVLSAVSSMLFVFLLYIRF 119
            +    E + Y  +   + I+N      ++ T Q +   +A +L+ V      +L+    
Sbjct: 281 EKGITKEYISYLGLALFIFIMNTLILRGIVETLQ-INAYIAKILTEVILFTLSYLVQKNL 339

Query: 120 MTRRVYFIKK 129
           +  +    +K
Sbjct: 340 VFSKKTVEEK 349


>gi|291298328|ref|YP_003509606.1| GtrA family protein [Stackebrandtia nassauensis DSM 44728]
 gi|290567548|gb|ADD40513.1| GtrA family protein [Stackebrandtia nassauensis DSM 44728]
          Length = 169

 Score = 68.8 bits (167), Expect = 2e-10,   Method: Composition-based stats.
 Identities = 18/127 (14%), Positives = 43/127 (33%), Gaps = 9/127 (7%)

Query: 3   QCIIFIINIVVVFFIDVMGFFILMKCGADPFYSRIFSIAVAFLVTWIPSRLFIFLK-LRR 61
           + + F    +V   + ++ F +L+  G  P  + + +  VA   ++  +R + +    + 
Sbjct: 25  EVLKFGSIGLVNTAVTMLIFNVLLSIG--PLKANVAATVVATTCSYFMNRHWTYRHLPKT 82

Query: 62  KSFLETVRYGVMYFMLSILNYAFYVKLLLTFQ------GLQPLLATVLSAVSSMLFVFLL 115
               E   + V   +  ++                        +A     V + LF F  
Sbjct: 83  SLKREYTLFFVFNLIGFLIESIILAVARYGMHFDEHTDVAAFNIAKFSGLVIATLFRFWA 142

Query: 116 YIRFMTR 122
           Y  F+ +
Sbjct: 143 YRSFVFK 149


>gi|324997840|ref|ZP_08118952.1| hypothetical protein PseP1_03704 [Pseudonocardia sp. P1]
          Length = 169

 Score = 68.8 bits (167), Expect = 2e-10,   Method: Composition-based stats.
 Identities = 21/135 (15%), Positives = 53/135 (39%), Gaps = 15/135 (11%)

Query: 2   KQCIIFIINIVVVFFIDVMGFFIL--MKCGADPFYSRIFSIAVAFLVTWIPSRLFIFLKL 59
           ++ I F++     + ID   F +L        P  +++ ++ VA +V+++ +R + F   
Sbjct: 23  RELIKFLMVGGTTWVIDTAVFLLLKAFVLDTKPVTAKVIAVLVATIVSYVLNREWSFRTR 82

Query: 60  -RRKSFLETVRYGVMYFMLSILNYAFYVKLLLTFQGLQPLLA------------TVLSAV 106
             R    E   + ++  +   +  A        F+   P+++             ++  +
Sbjct: 83  GGRDRHHEAALFFLISGVGVAVYSAPLWVSRYVFELQVPVVSLVTQEFSDFVAGQIVGTL 142

Query: 107 SSMLFVFLLYIRFMT 121
             M F +  + RF+ 
Sbjct: 143 VGMAFRWWAFRRFVW 157



 Score = 36.4 bits (83), Expect = 1.4,   Method: Composition-based stats.
 Identities = 8/59 (13%), Positives = 28/59 (47%)

Query: 64  FLETVRYGVMYFMLSILNYAFYVKLLLTFQGLQPLLATVLSAVSSMLFVFLLYIRFMTR 122
             E +++ ++     +++ A ++ L       +P+ A V++ + + +  ++L   +  R
Sbjct: 22  HRELIKFLMVGGTTWVIDTAVFLLLKAFVLDTKPVTAKVIAVLVATIVSYVLNREWSFR 80


>gi|114328128|ref|YP_745285.1| monosaccharide translocase [Granulibacter bethesdensis CGDNIH1]
 gi|114316302|gb|ABI62362.1| undecaprenyl-phosphate mannosyltransferase [Granulibacter
           bethesdensis CGDNIH1]
          Length = 384

 Score = 68.8 bits (167), Expect = 2e-10,   Method: Composition-based stats.
 Identities = 8/123 (6%), Positives = 40/123 (32%), Gaps = 6/123 (4%)

Query: 3   QCIIFIINIVVVFFIDVMGFFILMKCGADPFYSRIFSIAVAFLVTWIPSRLFIFLK---L 59
           + + F     +   + +     +         +++ +  VA  + +  +    +      
Sbjct: 263 RFLSFAGVGAIGLVVHLAVLITVRPFMHFHL-AQLLATVVAMAMNFELNNRITYADQRLR 321

Query: 60  RRKSFLETVRYGVMYFMLSILNYAFYVKLLLTFQGLQPLLATVLSAVSSMLFVFLLYIRF 119
            R+ ++  + + ++  + +  N      +    +      A    A+  +++ + +    
Sbjct: 322 GRRLWVGRLMFFLVCGLGAAANIGIAQMIYEMDRAWSF--AGATGAMIGLVWNYTVSATL 379

Query: 120 MTR 122
           + R
Sbjct: 380 IWR 382


>gi|254502326|ref|ZP_05114477.1| glycosyl transferase, group 2 family protein [Labrenzia alexandrii
           DFL-11]
 gi|222438397|gb|EEE45076.1| glycosyl transferase, group 2 family protein [Labrenzia alexandrii
           DFL-11]
          Length = 386

 Score = 68.8 bits (167), Expect = 2e-10,   Method: Composition-based stats.
 Identities = 10/124 (8%), Positives = 35/124 (28%), Gaps = 5/124 (4%)

Query: 3   QCIIFIINIVVVFFIDVMGFFILMKCGADPFYSRIFSIAVAFLVTWIPSRLFIFLKLRRK 62
           + ++F +       + +    + +        S+  +  VA    +  +    +   R +
Sbjct: 264 RFLMFGLVGASGLVVHLAALRVFLLSDMSFNMSQTAASFVAMTSNFFLNNQLTYRDRRLR 323

Query: 63  SFLETVR---YGVMYFMLSILNYAFYVKLLLTFQGLQPLLATVLSAVSSMLFVFLLYIRF 119
                +    +  +  +  + N       L+         A    A+   ++ +      
Sbjct: 324 GLGALIGLLTFYAVCSVGVLANVGV--ANLIYADPAYWWFAGAAGAIMGAVWNYAASSAL 381

Query: 120 MTRR 123
             R+
Sbjct: 382 TWRK 385


>gi|169628023|ref|YP_001701672.1| glycosyltransferase [Mycobacterium abscessus ATCC 19977]
 gi|169239990|emb|CAM61018.1| Probable glycosyltransferase [Mycobacterium abscessus]
          Length = 407

 Score = 68.8 bits (167), Expect = 2e-10,   Method: Composition-based stats.
 Identities = 17/126 (13%), Positives = 43/126 (34%), Gaps = 6/126 (4%)

Query: 1   MKQCIIFIINIVVVFFIDVMGFFILMKCGADPFYSRIFSIAVAFLVTWIPSRLFIFLKLR 60
           + Q + F I  V          F+ +   A    +   ++ +  ++    +R F F    
Sbjct: 279 VGQLVRFGIIGVASTLA-YAVLFLALHGLAGDQAANFLALLITAVLNTSANRFFTFGVRG 337

Query: 61  RK-SFLETVRYGVMYFMLSILNYAFYVKLLLTFQGLQ---PLLATVLSAVSSMLFVFLLY 116
           R+ +     +  V++ +   L     V +            L+   ++ + + L  F+  
Sbjct: 338 RRDAAKHQFQGLVIFGIGLALTSGSLVAMHHLVPDASKHVLLIVLTVANLVATLIRFVGL 397

Query: 117 IRFMTR 122
             ++ R
Sbjct: 398 R-WVFR 402


>gi|320009636|gb|ADW04486.1| glycosyl transferase family 2 [Streptomyces flavogriseus ATCC
           33331]
          Length = 440

 Score = 68.4 bits (166), Expect = 3e-10,   Method: Composition-based stats.
 Identities = 15/124 (12%), Positives = 46/124 (37%), Gaps = 5/124 (4%)

Query: 2   KQCIIFIINIVVVFFIDVMGFFILMKCGADPFYSRIFSIAVAFLVTWIPSRLFIFLKLRR 61
           +Q + F +   +   + +   + L + G  P ++   ++ V+ +     +R   F    R
Sbjct: 296 RQLVGFCVVGALSTLVYLA-LYSLFRLGVGPQFANAAALLVSAVANTAANRRLTFGVRGR 354

Query: 62  KSFL----ETVRYGVMYFMLSILNYAFYVKLLLTFQGLQPLLATVLSAVSSMLFVFLLYI 117
              +    + +    +   L+  + A       +      L   + + +++ +  FLL+ 
Sbjct: 355 GGAVRHQAQGLVVFAIGLALTSGSLAALGTASGSASHGTELAVLIAANLAATVLRFLLFR 414

Query: 118 RFMT 121
            ++ 
Sbjct: 415 AWVF 418


>gi|300782916|ref|YP_003763207.1| GtrA-like protein [Amycolatopsis mediterranei U32]
 gi|299792430|gb|ADJ42805.1| GtrA-like protein [Amycolatopsis mediterranei U32]
          Length = 169

 Score = 68.4 bits (166), Expect = 3e-10,   Method: Composition-based stats.
 Identities = 18/135 (13%), Positives = 45/135 (33%), Gaps = 15/135 (11%)

Query: 2   KQCIIFIINIVVVFFIDVMGFFIL--MKCGADPFYSRIFSIAVAFLVTWIPSRLFIFLKL 59
           ++ + F +   + F I +   + L        P  + I  + VA + +++ +R + F   
Sbjct: 9   RELLRFAVVGGISFVITMSIDYSLKFTVLRTHPVTALIVGVLVATIFSYVANREWSFRTR 68

Query: 60  -RRKSFLETVRYGVMYFMLSILNYAFYVKLLL------------TFQGLQPLLATVLSAV 106
             R+   E   + +   +   LN                       +    +   ++  V
Sbjct: 69  GGRERAHEAALFFLFSGIALGLNALPQWVSRYVLDLQVPRLSPFGVEVADFVSGIIVGTV 128

Query: 107 SSMLFVFLLYIRFMT 121
              LF +  + R++ 
Sbjct: 129 LGTLFRWWAFKRWVF 143



 Score = 41.0 bits (95), Expect = 0.057,   Method: Composition-based stats.
 Identities = 10/61 (16%), Positives = 26/61 (42%)

Query: 62  KSFLETVRYGVMYFMLSILNYAFYVKLLLTFQGLQPLLATVLSAVSSMLFVFLLYIRFMT 121
           K   E +R+ V+  +  ++  +    L  T     P+ A ++  + + +F ++    +  
Sbjct: 6   KKHRELLRFAVVGGISFVITMSIDYSLKFTVLRTHPVTALIVGVLVATIFSYVANREWSF 65

Query: 122 R 122
           R
Sbjct: 66  R 66


>gi|256833088|ref|YP_003161815.1| GtrA family protein [Jonesia denitrificans DSM 20603]
 gi|256686619|gb|ACV09512.1| GtrA family protein [Jonesia denitrificans DSM 20603]
          Length = 158

 Score = 68.4 bits (166), Expect = 3e-10,   Method: Composition-based stats.
 Identities = 21/129 (16%), Positives = 44/129 (34%), Gaps = 10/129 (7%)

Query: 3   QCIIFIINIVVVFFIDVMGFFILMK-----CGADPFYSRIFSIAVAFLVTWIPSRLFIFL 57
           + + F     + F +D+  F +L           P  ++I S+++A +VTW+ +RL+ F 
Sbjct: 18  ELVRFGSVGALGFVVDIGLFNVLQYGPLSLLDGKPVTAKIISVSIAMVVTWLGNRLWTFS 77

Query: 58  K-LRRKSFLETVRYGVMYFMLSILNYAFYVKLLL----TFQGLQPLLATVLSAVSSMLFV 112
                    E   + V+      +                     + A  +  V    F 
Sbjct: 78  AQRTHTRVREFTGFVVVNIGGMAIAVLCLWVSRYILGFESAWADNVAANGVGLVLGTAFR 137

Query: 113 FLLYIRFMT 121
           ++ Y   + 
Sbjct: 138 YVAYKYLVF 146


>gi|307719443|ref|YP_003874975.1| membrane spanning protein [Spirochaeta thermophila DSM 6192]
 gi|306533168|gb|ADN02702.1| putative membrane spanning protein [Spirochaeta thermophila DSM
           6192]
          Length = 146

 Score = 68.4 bits (166), Expect = 3e-10,   Method: Composition-based stats.
 Identities = 18/132 (13%), Positives = 43/132 (32%), Gaps = 12/132 (9%)

Query: 3   QCIIFIINIVVVFFIDVMGFFILMKCGADPFYSRIFSIAVAFLVTWIPSRLFIFLKLRRK 62
           Q + F +   +   IDV  F +L   G  P  ++  S     +  +   + + F + R  
Sbjct: 13  QFVRFNLVGTINTLIDVGVFALLTSLGTPPVAAQPVSYFCGMVNGFFLHKYWTFRQRRGS 72

Query: 63  SFLETVRYGVMYFMLSILNYAFYVKL------------LLTFQGLQPLLATVLSAVSSML 110
             ++ +++  +     +L  +                 L+       +     + V+  L
Sbjct: 73  WGVQALKFVFVNLAGILLTTSIIALFEELVAPTAWGSTLILAWPAYVVAGKACALVAGSL 132

Query: 111 FVFLLYIRFMTR 122
             F     ++ R
Sbjct: 133 LTFTANRWWVFR 144



 Score = 33.7 bits (76), Expect = 7.7,   Method: Composition-based stats.
 Identities = 14/67 (20%), Positives = 30/67 (44%), Gaps = 2/67 (2%)

Query: 57  LKLRRKSFLETVRYGVMYFMLSILNYAFYVKLLLTFQGLQPLLATVLSAVSSMLFVFLLY 116
                   L+ VR+ ++  + ++++   +   LLT  G  P+ A  +S    M+  F L+
Sbjct: 4   RSRHLHLALQFVRFNLVGTINTLIDVGVFA--LLTSLGTPPVAAQPVSYFCGMVNGFFLH 61

Query: 117 IRFMTRR 123
             +  R+
Sbjct: 62  KYWTFRQ 68


>gi|325067619|ref|ZP_08126292.1| hypothetical protein AoriK_07354 [Actinomyces oris K20]
          Length = 155

 Score = 68.4 bits (166), Expect = 3e-10,   Method: Composition-based stats.
 Identities = 22/123 (17%), Positives = 47/123 (38%), Gaps = 2/123 (1%)

Query: 1   MKQCIIFIINIVVVFFIDVMGFFILMKCGADPFYSRIFSIAVAFLVTWIPSRLFIFLKLR 60
           + Q   F++   + F +D   F +L   G     +   S + + ++ +I SR ++F    
Sbjct: 12  LAQFGRFLVVGGISFSVDFGLFTVLYGLGVPHLIASATSFSTSVVLNYILSRRYVFEAQE 71

Query: 61  R-KSFLETVRYGVMYFMLSILNYAFYVKLLLTFQGLQPLLATVLSAVSSMLFVFLLYIRF 119
                 E   Y ++  +   LN            G+ P L  +L+    +++ F+     
Sbjct: 72  NVSVLKEFTLYVLLNVVALGLNTLILYVC-ADLAGMSPFLGKILATAIVLIYNFISRKAL 130

Query: 120 MTR 122
           + R
Sbjct: 131 LER 133


>gi|220913965|ref|YP_002489274.1| glycosyltransferase [Arthrobacter chlorophenolicus A6]
 gi|219860843|gb|ACL41185.1| glycosyltransferase [Arthrobacter chlorophenolicus A6]
          Length = 374

 Score = 68.4 bits (166), Expect = 3e-10,   Method: Composition-based stats.
 Identities = 24/121 (19%), Positives = 49/121 (40%), Gaps = 3/121 (2%)

Query: 4   CIIFIINIVVVFFIDVMGFFILMKCGADPFYSRIFSIAVAFLVTWIPSRLFIF-LKLRRK 62
            + F+ +    F +D   F +L         + + + AV+  V ++ +R  +F    +R 
Sbjct: 226 LLKFLGSSFTAFLVDTTVFLLLTVLVDSLLLAVLGARAVSSAVNFLVNRHVVFEHGKQRP 285

Query: 63  SFLETVRYGVMYFMLSILNYAFYVKLLLTFQGLQPLLATVLSAVSSMLFVFLLYIRFMTR 122
           +    +RY  +  +L   N A      L    +  L A +L+ V  +   F +  R++  
Sbjct: 286 ARSAGLRYFSLVAVLLAANVALIWA--LEAIAVPALAAKILAEVMLLAISFSVQQRWLFA 343

Query: 123 R 123
           R
Sbjct: 344 R 344


>gi|313901315|ref|ZP_07834802.1| putative cell wall teichoic acid glycosylation protein GtcA
           [Clostridium sp. HGF2]
 gi|312953923|gb|EFR35604.1| putative cell wall teichoic acid glycosylation protein GtcA
           [Clostridium sp. HGF2]
          Length = 133

 Score = 68.4 bits (166), Expect = 3e-10,   Method: Composition-based stats.
 Identities = 8/120 (6%), Positives = 45/120 (37%), Gaps = 1/120 (0%)

Query: 3   QCIIFIINIVVVFFIDVMGFFILMKCGADPFYSRIFSIAVAFLVTWIPSRLFIFLKLRRK 62
           + + +++   +   ++ + +F           + + +   A L  +I +R ++F      
Sbjct: 10  ELLNYVVVGGLTTLVNFVVYFFCTHIQLHYLIANVIAWIFAVLFAYIANRKYVFKSEGND 69

Query: 63  SFLETVRYGVMYFMLSILNYAFYVKLLLTFQGLQPLLATVLSAVSSMLFVFLLYIRFMTR 122
              E +++  +  +  ++         +    +   +A +  ++ +++  ++     + +
Sbjct: 70  QKAEFLQFVSLRAVTLVVESLLLFVC-IQLAAMNENIAKIFVSIVTVIGNYVFCKFMIFK 128


>gi|326774041|ref|ZP_08233323.1| ribonuclease H (RNase H) [Actinomyces viscosus C505]
 gi|326636180|gb|EGE37084.1| ribonuclease H (RNase H) [Actinomyces viscosus C505]
          Length = 391

 Score = 68.4 bits (166), Expect = 3e-10,   Method: Composition-based stats.
 Identities = 21/119 (17%), Positives = 42/119 (35%), Gaps = 3/119 (2%)

Query: 4   CIIFIINIVVVFFIDVMGFFILMKCGADPFYSRIFSIAVAFLVTWIPSRLFIFLKLRRKS 63
            ++F       + +D     IL        Y+ + +  V+  + ++ +R   F       
Sbjct: 260 VVLFAAVSFTGWSVDYALVLILNSLTDSVLYAVVGARIVSCTLGFLLNRRL-FGAGPENY 318

Query: 64  FLETVRYGVMYFMLSILNYAFYVKLLLTFQGLQPLLATVLSAVSSMLFVFLLYIRFMTR 122
           +     Y  +   ++  +YA      LT  G    LA VL   +  +  +L   R + R
Sbjct: 319 WRSAGGYAAVQGGVAATSYAGIAV--LTGAGAPLWLAKVLVDSTLFIVNYLAQSRLVYR 375


>gi|296268695|ref|YP_003651327.1| GtrA family protein [Thermobispora bispora DSM 43833]
 gi|296091482|gb|ADG87434.1| GtrA family protein [Thermobispora bispora DSM 43833]
          Length = 165

 Score = 68.4 bits (166), Expect = 3e-10,   Method: Composition-based stats.
 Identities = 19/126 (15%), Positives = 44/126 (34%), Gaps = 5/126 (3%)

Query: 1   MKQCIIFIINIVVVFFIDVMGFFILMK-CGADPFYSRIFSIAVAFLVTWIPSRLFIFLKL 59
           + + + F       F ID  G  +L    G  P  S++ +   A    +  +R + F   
Sbjct: 23  VHELLKFGTVGAFAFVIDFGGANLLRFGVGLGPLTSKVLATVAATTFAYFGNRYWTFRHR 82

Query: 60  RRKSF-LETVRYGVMYFMLSILNYAFYVKLLLTFQG---LQPLLATVLSAVSSMLFVFLL 115
           ++  F  E   + ++  +  +        +         +   +A  +  V   +F F  
Sbjct: 83  KQTGFGREYALFFLLNGIGLLPPLIVIWFVTYVLGLHDAVSYNIAQGIGLVLGTMFRFWS 142

Query: 116 YIRFMT 121
           Y +++ 
Sbjct: 143 YRKWVF 148


>gi|324998347|ref|ZP_08119459.1| GtrA family protein [Pseudonocardia sp. P1]
          Length = 455

 Score = 68.0 bits (165), Expect = 4e-10,   Method: Composition-based stats.
 Identities = 16/125 (12%), Positives = 41/125 (32%), Gaps = 5/125 (4%)

Query: 3   QCIIFIINIVVVFFIDVMGFFILMKCGADPFYSRIFSIAVAFLVTWIPSRLFIFLKLRRK 62
           Q   F    V     +++ F         P  + + ++ +  +V    +R F F    R+
Sbjct: 318 QLARFAAIGVASTVANLLLFLAFRGI-LGPITANVAAMVICAVVNTAANRRFTFGVRGRE 376

Query: 63  SFL----ETVRYGVMYFMLSILNYAFYVKLLLTFQGLQPLLATVLSAVSSMLFVFLLYIR 118
             +    + +    +   L+                   +   V + + + +  F+L+  
Sbjct: 377 RAVTHQFQGLVVFGLGLALTTGALGMLTLAAPGAHLAVEVAVIVAANLVATVLRFVLFRS 436

Query: 119 FMTRR 123
           ++ RR
Sbjct: 437 WIFRR 441


>gi|302877445|ref|YP_003846009.1| GtrA family protein [Gallionella capsiferriformans ES-2]
 gi|302580234|gb|ADL54245.1| GtrA family protein [Gallionella capsiferriformans ES-2]
          Length = 168

 Score = 68.0 bits (165), Expect = 4e-10,   Method: Composition-based stats.
 Identities = 17/135 (12%), Positives = 47/135 (34%), Gaps = 9/135 (6%)

Query: 2   KQCIIFIINIVVVFFIDVMGFFILMKCGADPF--------YSRIFSIAVAFLVTWIPSRL 53
           ++ + F         +++   ++  +   +           S   +I +A L  +  +RL
Sbjct: 21  RRFLKFGTVGASGTVVNIGVLYLAQEHLFNTVQHVELKLNLSLAVAILLATLNNFFWNRL 80

Query: 54  FIFLKLRRKSFLETVRYGVMYFMLSILNYAF-YVKLLLTFQGLQPLLATVLSAVSSMLFV 112
           + +    ++     +     Y +   L+ A   +   L         A +++  S+ +  
Sbjct: 81  WTWSDRTQQHHRSWLSQFGQYTLACWLSIALQVLFTNLLAPHFYYQFANLIAIASTSVLN 140

Query: 113 FLLYIRFMTRRVYFI 127
           F+L   +   RV  +
Sbjct: 141 FVLNDIWTFGRVKLL 155


>gi|296395350|ref|YP_003660234.1| GtrA family protein [Segniliparus rotundus DSM 44985]
 gi|296182497|gb|ADG99403.1| GtrA family protein [Segniliparus rotundus DSM 44985]
          Length = 192

 Score = 68.0 bits (165), Expect = 4e-10,   Method: Composition-based stats.
 Identities = 23/133 (17%), Positives = 50/133 (37%), Gaps = 14/133 (10%)

Query: 3   QCIIFIINIVVVFFIDVMGFFILMKCGAD--PFYSRIFSIAVAFLVTWIPSRLFIFLKL- 59
           + I F +        D+  ++ L+       P  ++IFS  +A ++++I +  + F    
Sbjct: 36  ELIKFGVVGATTMVFDMAVYYALIFTVMPTKPTVAKIFSGVLATVLSYILNSEWSFKHRG 95

Query: 60  RRKSFLETVRYGVMYFMLSILNYAFYVKLLLTFQG-----------LQPLLATVLSAVSS 108
            R+   E + +  +  + ++L  A        F             +  +LA ++  V  
Sbjct: 96  GRQRHHEALLFFGISGIGALLGAAPLWVANNLFHIRHGGSWMHTVLVDFVLAYIIGNVMQ 155

Query: 109 MLFVFLLYIRFMT 121
           M F F    +F  
Sbjct: 156 MAFRFWALRKFAY 168



 Score = 38.7 bits (89), Expect = 0.25,   Method: Composition-based stats.
 Identities = 12/60 (20%), Positives = 28/60 (46%)

Query: 63  SFLETVRYGVMYFMLSILNYAFYVKLLLTFQGLQPLLATVLSAVSSMLFVFLLYIRFMTR 122
              E +++GV+     + + A Y  L+ T    +P +A + S V + +  ++L   +  +
Sbjct: 33  RHHELIKFGVVGATTMVFDMAVYYALIFTVMPTKPTVAKIFSGVLATVLSYILNSEWSFK 92


>gi|305680188|ref|ZP_07402998.1| GtrA-like protein [Corynebacterium matruchotii ATCC 14266]
 gi|305660808|gb|EFM50305.1| GtrA-like protein [Corynebacterium matruchotii ATCC 14266]
          Length = 173

 Score = 68.0 bits (165), Expect = 4e-10,   Method: Composition-based stats.
 Identities = 17/126 (13%), Positives = 38/126 (30%), Gaps = 5/126 (3%)

Query: 3   QCIIFIINIVVVFFIDVMGFFILMK-CGADPFYSRIFSIAVAFLVTWIPSRLFIFLKLRR 61
           Q + FI   VV   ID     +L    G    +++           +  +  + F     
Sbjct: 47  QLVRFIAVGVVCAVIDYGTTLLLDYVLGVPRGWAKAVGWVAGTTSAYFMNAKWTFNSKTS 106

Query: 62  KSFLETVRYGVMYFMLSILNYAFYVKLLLTFQGLQPL----LATVLSAVSSMLFVFLLYI 117
                 V    +            V + L    L       ++ V++   + +  F++  
Sbjct: 107 AKATVAVAILYLSTFAVQNILYKVVPMPLHSFELPKFVVDTISFVIAQGVATVTNFVMQR 166

Query: 118 RFMTRR 123
            F+ ++
Sbjct: 167 AFIFKQ 172


>gi|262200296|ref|YP_003271504.1| GtrA family protein [Gordonia bronchialis DSM 43247]
 gi|262083643|gb|ACY19611.1| GtrA family protein [Gordonia bronchialis DSM 43247]
          Length = 170

 Score = 68.0 bits (165), Expect = 4e-10,   Method: Composition-based stats.
 Identities = 22/123 (17%), Positives = 48/123 (39%), Gaps = 5/123 (4%)

Query: 3   QCIIFIINIVVVFFIDVMGFFILMKC-GADPFYSRIFSIAVAFLVTWIPSRLFIFLKLRR 61
           Q I FII       +D     +L    GAD + ++ F   +     ++ +R + F     
Sbjct: 48  QMIRFIITGAGSGVLDFGLTILLQYVVGADFWIAKSFGFILGTTTAYLLNRRWTFEA--P 105

Query: 62  KSFLETVRYGVMYFMLSILNYAFYVKLLLTFQ--GLQPLLATVLSAVSSMLFVFLLYIRF 119
            S +  +    +Y +   +N   Y  L   +    +   +A V++  ++ +  F++    
Sbjct: 106 PSTVRFLAVVALYAVTFFVNVGLYTVLSHAWPVTLIYSFIAYVIAQGTATVINFVVQRLV 165

Query: 120 MTR 122
           + R
Sbjct: 166 IFR 168


>gi|226308571|ref|YP_002768531.1| hypothetical protein RER_50840 [Rhodococcus erythropolis PR4]
 gi|229488393|ref|ZP_04382259.1| GtrA family protein [Rhodococcus erythropolis SK121]
 gi|226187688|dbj|BAH35792.1| conserved hypothetical membrane protein [Rhodococcus erythropolis
           PR4]
 gi|229323897|gb|EEN89652.1| GtrA family protein [Rhodococcus erythropolis SK121]
          Length = 187

 Score = 68.0 bits (165), Expect = 4e-10,   Method: Composition-based stats.
 Identities = 15/134 (11%), Positives = 50/134 (37%), Gaps = 15/134 (11%)

Query: 3   QCIIFIINIVVVFFIDVMGFFILMK--CGADPFYSRIFSIAVAFLVTWIPSRLFIFLKL- 59
           + + F++   + F +  + FF +        P  + I ++ +A +++++ +R + F +  
Sbjct: 24  EMLKFLVVGGIAFIVTTVLFFGIKWTVLPQHPVTANILAVLIATVLSYVLNREWSFAQRG 83

Query: 60  RRKSFLETVRYGVMYFMLSILNYAFYVKLLLTFQG------------LQPLLATVLSAVS 107
            R+   E   + ++  +   +N          F                 +  +++  + 
Sbjct: 84  GRQRHHEAALFFIVAGIGLAINQVPLWTSRYVFHLRQPEVSVLMENFADFISGSIIGTLL 143

Query: 108 SMLFVFLLYIRFMT 121
           +  F +    R++ 
Sbjct: 144 ATAFRWWAMRRYVF 157



 Score = 37.6 bits (86), Expect = 0.54,   Method: Composition-based stats.
 Identities = 8/58 (13%), Positives = 25/58 (43%)

Query: 64  FLETVRYGVMYFMLSILNYAFYVKLLLTFQGLQPLLATVLSAVSSMLFVFLLYIRFMT 121
             E +++ V+  +  I+    +  +  T     P+ A +L+ + + +  ++L   +  
Sbjct: 22  HAEMLKFLVVGGIAFIVTTVLFFGIKWTVLPQHPVTANILAVLIATVLSYVLNREWSF 79


>gi|302536493|ref|ZP_07288835.1| predicted protein [Streptomyces sp. C]
 gi|302445388|gb|EFL17204.1| predicted protein [Streptomyces sp. C]
          Length = 180

 Score = 68.0 bits (165), Expect = 5e-10,   Method: Composition-based stats.
 Identities = 21/121 (17%), Positives = 42/121 (34%), Gaps = 3/121 (2%)

Query: 3   QCIIFIINIVVVFFIDVMGFFILMKCGADPFYSRIFSIAVAFLVTWIPSRLFIFLKLRRK 62
           + I F +  V  F  ++   ++L   G     + + +     L  ++     IF   RR 
Sbjct: 48  RMIGFGLVGVSGFVPNLAALWLLTHAGMQYLVAGVLANQAGVLWNFLLIETLIFRDRRRH 107

Query: 63  SFL--ETVRYGVMYFMLSILNYAFYVKLLLTFQGLQPLLATVLSAVSSMLFVFLLYIRFM 120
                   R+ ++     +L         +   GL+ L AT L+ V + +  F      +
Sbjct: 108 RHWADRFGRFALIANADLLLRVPLIAL-FVDRFGLEVLPATALALVITFVLRFAATEALV 166

Query: 121 T 121
            
Sbjct: 167 Y 167



 Score = 33.7 bits (76), Expect = 8.4,   Method: Composition-based stats.
 Identities = 17/61 (27%), Positives = 30/61 (49%), Gaps = 2/61 (3%)

Query: 62  KSFLETVRYGVMYFMLSILNYAFYVKLLLTFQGLQPLLATVLSAVSSMLFVFLLYIRFMT 121
              +  + +G++     + N A     LLT  G+Q L+A VL+  + +L+ FLL    + 
Sbjct: 44  SPLVRMIGFGLVGVSGFVPNLAAL--WLLTHAGMQYLVAGVLANQAGVLWNFLLIETLIF 101

Query: 122 R 122
           R
Sbjct: 102 R 102


>gi|226365771|ref|YP_002783554.1| hypothetical protein ROP_63620 [Rhodococcus opacus B4]
 gi|226244261|dbj|BAH54609.1| hypothetical membrane protein [Rhodococcus opacus B4]
          Length = 193

 Score = 67.6 bits (164), Expect = 5e-10,   Method: Composition-based stats.
 Identities = 24/134 (17%), Positives = 49/134 (36%), Gaps = 15/134 (11%)

Query: 3   QCIIFIINIVVVFFIDVMGFFIL--MKCGADPFYSRIFSIAVAFLVTWIPSRLFIFLKL- 59
           + I F I        D+  F+ L        P  +++ S  +A ++++I +R + F    
Sbjct: 36  ELIKFAIVGGTTMVFDLAIFYSLSLTILEEKPVVAKVLSGILATVLSYILNREWSFKNRG 95

Query: 60  RRKSFLETVRYGVMYFMLSILNYAFYVK------------LLLTFQGLQPLLATVLSAVS 107
            R+   E + +  +  +  +L  A                 L T   +  +L  ++  + 
Sbjct: 96  GRERHHEALLFFTISGVGVLLAAAPLWIANNVFDIRETQENLTTLVVVDFVLNYIIGNLL 155

Query: 108 SMLFVFLLYIRFMT 121
            M+F F    RF  
Sbjct: 156 QMVFRFWALRRFAF 169



 Score = 38.3 bits (88), Expect = 0.36,   Method: Composition-based stats.
 Identities = 11/60 (18%), Positives = 29/60 (48%)

Query: 63  SFLETVRYGVMYFMLSILNYAFYVKLLLTFQGLQPLLATVLSAVSSMLFVFLLYIRFMTR 122
              E +++ ++     + + A +  L LT    +P++A VLS + + +  ++L   +  +
Sbjct: 33  RHHELIKFAIVGGTTMVFDLAIFYSLSLTILEEKPVVAKVLSGILATVLSYILNREWSFK 92


>gi|323491860|ref|ZP_08097034.1| hypothetical protein VIBR0546_19142 [Vibrio brasiliensis LMG 20546]
 gi|323313877|gb|EGA66967.1| hypothetical protein VIBR0546_19142 [Vibrio brasiliensis LMG 20546]
          Length = 128

 Score = 67.6 bits (164), Expect = 5e-10,   Method: Composition-based stats.
 Identities = 25/124 (20%), Positives = 58/124 (46%), Gaps = 3/124 (2%)

Query: 3   QCIIFIINIVVVFFIDVMGFFILMKCGA-DPFYSRIFSIAVAFLVTWIPSRLFIFLKLRR 61
           + + F +   + F  D   F +       +P  +RI +   A  VTW  +R F F   +R
Sbjct: 4   KVVRFALVGSIGFLADASVFSVCFYLFQLEPLTARILAFFCAATVTWYGNRRFTFASHQR 63

Query: 62  KSFLETVRYGVMYFMLSILNYAFY--VKLLLTFQGLQPLLATVLSAVSSMLFVFLLYIRF 119
           +   + +++  +  + ++ N   +  + LLL   G+ P++A     ++ M+  +L+  R+
Sbjct: 64  QRLKQWLKFVSVASVSAVPNLVVFKSILLLLGGSGMVPMVALAAGVLAGMVSNYLISKRW 123

Query: 120 MTRR 123
           + ++
Sbjct: 124 VFKQ 127


>gi|182436242|ref|YP_001823961.1| putative sugar transferase [Streptomyces griseus subsp. griseus
           NBRC 13350]
 gi|178464758|dbj|BAG19278.1| putative sugar transferase [Streptomyces griseus subsp. griseus
           NBRC 13350]
          Length = 507

 Score = 67.6 bits (164), Expect = 5e-10,   Method: Composition-based stats.
 Identities = 18/118 (15%), Positives = 44/118 (37%), Gaps = 4/118 (3%)

Query: 1   MKQCIIFIINIVVVFFIDVMGFFILMKCGADPFYSRIFSIAVAFLVTWIPSRLFIFLKLR 60
           ++Q   F++   V   + +  +  L +       + +   AV+ + +++ +         
Sbjct: 358 VRQFGSFLLIGCVNTAVYLGIYASLNRF-IPYLTAHVIGYAVSIVCSFLLNSYVT--CRT 414

Query: 61  RKSFLETVRYGVMYFMLSILNYAFYVKLLLTFQGLQPLLATVLSAVSSMLFVFLLYIR 118
           R ++   VRY +   +  + + A      +   G+   LA + + V      FLL   
Sbjct: 415 RPTWHAFVRYPISSLVNLVASGALLYGA-VGVLGMDKNLAALAAGVLVTPVSFLLARW 471


>gi|326384279|ref|ZP_08205960.1| GtrA family protein [Gordonia neofelifaecis NRRL B-59395]
 gi|326196877|gb|EGD54070.1| GtrA family protein [Gordonia neofelifaecis NRRL B-59395]
          Length = 166

 Score = 67.6 bits (164), Expect = 5e-10,   Method: Composition-based stats.
 Identities = 19/123 (15%), Positives = 46/123 (37%), Gaps = 5/123 (4%)

Query: 3   QCIIFIINIVVVFFIDVMGFFILMK-CGADPFYSRIFSIAVAFLVTWIPSRLFIFLKLRR 61
           Q I FI    +    D    ++L +  GA  + ++     +   + ++ +R + F     
Sbjct: 44  QIIRFIATGALSAVFDFSLTYLLQEAFGAPFWLAKGCGFILGTTIAYLINRRWTF--RAE 101

Query: 62  KSFLETVRYGVMYFMLSILNYAFYVKLLLTFQ--GLQPLLATVLSAVSSMLFVFLLYIRF 119
            S    +    +YF+   +N   Y  L+  +        LA  ++   + +  F++    
Sbjct: 102 PSTARFIAVVALYFVTFFVNIGLYNWLMHRWGTELFAVALAFCIAQGVATVINFVVQRAV 161

Query: 120 MTR 122
           + +
Sbjct: 162 IFK 164


>gi|256374281|ref|YP_003097941.1| GtrA family protein [Actinosynnema mirum DSM 43827]
 gi|255918584|gb|ACU34095.1| GtrA family protein [Actinosynnema mirum DSM 43827]
          Length = 169

 Score = 67.6 bits (164), Expect = 5e-10,   Method: Composition-based stats.
 Identities = 19/131 (14%), Positives = 46/131 (35%), Gaps = 8/131 (6%)

Query: 1   MKQCIIFIINIVVVFFIDVMGFFILMKCGADPFYSRIFSIAVAFLVTWIPSRLFIFLKLR 60
           + Q + F +   V   ID++ + +L   G     +   S +     +++ ++ F F    
Sbjct: 38  LGQLVRFGLVGGVNTLIDLVLYMVLTGAGLPFVVANFVSTSAGMGFSFVANKYFTFGGGG 97

Query: 61  RKSFLETVRYGVMYFMLSILNY--------AFYVKLLLTFQGLQPLLATVLSAVSSMLFV 112
             +  +   +         + +        A    L     GL   L  + +  + +++ 
Sbjct: 98  GGAAKQGALFFAFTAFGLWVIHPVVILGAEALMAALDQPLTGLAAWLPKLAAICAGLVWN 157

Query: 113 FLLYIRFMTRR 123
           +  Y R + RR
Sbjct: 158 YTAYSRVVFRR 168


>gi|302552166|ref|ZP_07304508.1| monosaccharide translocase [Streptomyces viridochromogenes DSM
           40736]
 gi|302469784|gb|EFL32877.1| monosaccharide translocase [Streptomyces viridochromogenes DSM
           40736]
          Length = 169

 Score = 67.6 bits (164), Expect = 5e-10,   Method: Composition-based stats.
 Identities = 24/134 (17%), Positives = 48/134 (35%), Gaps = 14/134 (10%)

Query: 2   KQCIIFIINIVVVFFIDVMGFFILMK----------CGADPFYSRIFSIAVAFLVTWIPS 51
           ++   F +   + F +D  G+ +L+               P  + + + + A L +W  +
Sbjct: 33  REAAKFSVVGALAFVVDNGGYNLLVFGLPGGTRGGPMSTSPVQASVLATSAAALFSWAGN 92

Query: 52  RLFIFLKLRR-KSFLETVRYGVMYFMLSILNYAFYVKLLLTFQGLQPLL---ATVLSAVS 107
           R + + +  R K   E   + V   +   +                PL    A +L  V 
Sbjct: 93  RYWTYRRQHREKVTRELALFLVANGVGLAITAGTVFASRHLLGLDSPLSDNTARILGWVL 152

Query: 108 SMLFVFLLYIRFMT 121
           + LF F  Y R++ 
Sbjct: 153 ATLFRFYAYRRYVF 166



 Score = 34.9 bits (79), Expect = 3.9,   Method: Composition-based stats.
 Identities = 14/83 (16%), Positives = 32/83 (38%), Gaps = 8/83 (9%)

Query: 54  FIFLKLRRKSFLETVRYGVMYFMLSILNYAFYVKLLLTFQG--------LQPLLATVLSA 105
                  +  + E  ++ V+  +  +++   Y  L+    G          P+ A+VL+ 
Sbjct: 22  LRARDAVKGIWREAAKFSVVGALAFVVDNGGYNLLVFGLPGGTRGGPMSTSPVQASVLAT 81

Query: 106 VSSMLFVFLLYIRFMTRRVYFIK 128
            ++ LF +     +  RR +  K
Sbjct: 82  SAAALFSWAGNRYWTYRRQHREK 104


>gi|307328860|ref|ZP_07608030.1| GtrA family protein [Streptomyces violaceusniger Tu 4113]
 gi|306885525|gb|EFN16541.1| GtrA family protein [Streptomyces violaceusniger Tu 4113]
          Length = 442

 Score = 67.6 bits (164), Expect = 5e-10,   Method: Composition-based stats.
 Identities = 16/124 (12%), Positives = 46/124 (37%), Gaps = 5/124 (4%)

Query: 2   KQCIIFIINIVVVFFIDVMGFFILMKCGADPFYSRIFSIAVAFLVTWIPSRLFIFLKLRR 61
           +Q + F +   +   +  +  + L + G  P  +   ++ ++ L     +R   F    R
Sbjct: 304 RQLVGFCVVGALSTLV-YLLLYSLFRLGTGPQMANALALLLSALGNTAANRRLTFGVRGR 362

Query: 62  KSFL----ETVRYGVMYFMLSILNYAFYVKLLLTFQGLQPLLATVLSAVSSMLFVFLLYI 117
              +    + +    +  +L+  + A       T      L   + + +++ +  FLL+ 
Sbjct: 363 DRAMRHQAQGLVVFGIGLVLTSGSLAALDAAPGTASHGTELAVLIAANLAATVLRFLLFR 422

Query: 118 RFMT 121
            ++ 
Sbjct: 423 AWVF 426


>gi|220913038|ref|YP_002488347.1| GtrA family protein [Arthrobacter chlorophenolicus A6]
 gi|219859916|gb|ACL40258.1| GtrA family protein [Arthrobacter chlorophenolicus A6]
          Length = 163

 Score = 67.6 bits (164), Expect = 5e-10,   Method: Composition-based stats.
 Identities = 19/127 (14%), Positives = 43/127 (33%), Gaps = 5/127 (3%)

Query: 1   MKQCIIFIINIVVVFFIDVMGFFILMKCGADPFYSRIFSIAVAFLVTWIPSRLFIFL--- 57
           ++Q + F    ++     +  + +L      P  +   ++ +  L+    +R   F    
Sbjct: 34  VRQLLRFTGVGIICTGASLALYALLRPW-IGPQPANAVALVLTSLLNTALNRRLTFKISG 92

Query: 58  -KLRRKSFLETVRYGVMYFMLSILNYAFYVKLLLTFQGLQPLLATVLSAVSSMLFVFLLY 116
            + R    L  +    +  +++  +      L         LL T LS   +    F L 
Sbjct: 93  TQRRASDHLNGLVVIAVALLITGGSLGVLHWLNPEATVADELLTTTLSGFLATAVRFTLL 152

Query: 117 IRFMTRR 123
             ++ RR
Sbjct: 153 RHWIFRR 159


>gi|58337561|ref|YP_194146.1| hypothetical protein LBA1285 [Lactobacillus acidophilus NCFM]
 gi|58254878|gb|AAV43115.1| hypothetical protein LBA1285 [Lactobacillus acidophilus NCFM]
          Length = 142

 Score = 67.6 bits (164), Expect = 5e-10,   Method: Composition-based stats.
 Identities = 19/128 (14%), Positives = 48/128 (37%), Gaps = 2/128 (1%)

Query: 2   KQCIIFIINIVVVFFIDVMGFFILMKCGADPFYSRIFSIAVAFLVTWIPSRLFIFLKLRR 61
           +Q I + +   +   +D   F +L+    +   +   S +   +  ++ +    F    +
Sbjct: 15  RQLIGYCLIGGLGLVVDFGVFTLLVHLNVNVELANFISSSCGLINNFLWNSFANFKVHDK 74

Query: 62  KSFLETVRYGVMYFMLSILNYAFYVKLLLTFQGLQPLLATVLSAVSSMLFVFLLYIRFMT 121
              L  + Y ++  + +I        + +   G   ++  V+S   + L  F++      
Sbjct: 75  -LLLRFISYYLVGQVTTIFTTLCL-FIFVDKLGYNTIIVKVVSTFIATLIQFVINKVLTF 132

Query: 122 RRVYFIKK 129
           R+   IKK
Sbjct: 133 RKDTRIKK 140


>gi|154508374|ref|ZP_02044016.1| hypothetical protein ACTODO_00871 [Actinomyces odontolyticus ATCC
           17982]
 gi|153798008|gb|EDN80428.1| hypothetical protein ACTODO_00871 [Actinomyces odontolyticus ATCC
           17982]
          Length = 191

 Score = 67.6 bits (164), Expect = 5e-10,   Method: Composition-based stats.
 Identities = 19/131 (14%), Positives = 42/131 (32%), Gaps = 10/131 (7%)

Query: 1   MKQCIIFIINIVVVFFIDVMGFFILMK-----CGADPFYSRIFSIAVAFLVTWIPSRLFI 55
           +++ I F +     + +D   F +L           P  ++  + A A L +WI +RL+ 
Sbjct: 55  VREFIQFGMVGATAYIVDAGLFNLLQHGPLGFLAGHPNTAQFVAAATATLYSWIANRLWT 114

Query: 56  FLKLRR-KSFLETVRYGVMYFMLSILNYAFYVKLLLTF----QGLQPLLATVLSAVSSML 110
           +    R  +  E + +         ++    +               +   V+       
Sbjct: 115 YRGRTRENATREAILFFFANACGIGISQFCLLFTHHILGFASALADNIAVYVVGFALGTA 174

Query: 111 FVFLLYIRFMT 121
           F F  Y   + 
Sbjct: 175 FRFFFYHYVVF 185


>gi|227875960|ref|ZP_03994083.1| GtrA family protein [Mobiluncus mulieris ATCC 35243]
 gi|227843492|gb|EEJ53678.1| GtrA family protein [Mobiluncus mulieris ATCC 35243]
          Length = 140

 Score = 67.6 bits (164), Expect = 6e-10,   Method: Composition-based stats.
 Identities = 17/126 (13%), Positives = 46/126 (36%), Gaps = 7/126 (5%)

Query: 3   QCIIFIINIVVVFFIDVMGFFILMKCG--ADPFYSRIFSIAVAFLVTWIPSRLFIFLKL- 59
           +   F+      + +D+  F + +       P + +  ++AVA   +WI +R + F +  
Sbjct: 7   EIAKFLTVGGANYVVDLAVFNLFLLWLTPQWPLFDKCVAVAVATTFSWIANRSWTFRERG 66

Query: 60  RRKSFLETVRYGVMYFMLSILNYAFYVKLLL----TFQGLQPLLATVLSAVSSMLFVFLL 115
                 E + + ++  + ++   A           T      + A ++  +      ++L
Sbjct: 67  GHGVAKEALLFVLVNVIGALPPLACLWVSHYLLSFTSPLADNISANIIGLIIGTALRYVL 126

Query: 116 YIRFMT 121
           Y   + 
Sbjct: 127 YKLVVF 132



 Score = 34.5 bits (78), Expect = 5.1,   Method: Composition-based stats.
 Identities = 9/62 (14%), Positives = 24/62 (38%)

Query: 61  RKSFLETVRYGVMYFMLSILNYAFYVKLLLTFQGLQPLLATVLSAVSSMLFVFLLYIRFM 120
           R ++ E  ++  +     +++ A +   LL      PL    ++   +  F ++    + 
Sbjct: 2   RNNWSEIAKFLTVGGANYVVDLAVFNLFLLWLTPQWPLFDKCVAVAVATTFSWIANRSWT 61

Query: 121 TR 122
            R
Sbjct: 62  FR 63


>gi|294791328|ref|ZP_06756485.1| conserved hypothetical membrane protein [Scardovia inopinata F0304]
 gi|294457799|gb|EFG26153.1| conserved hypothetical membrane protein [Scardovia inopinata F0304]
          Length = 187

 Score = 67.6 bits (164), Expect = 6e-10,   Method: Composition-based stats.
 Identities = 20/132 (15%), Positives = 51/132 (38%), Gaps = 13/132 (9%)

Query: 1   MKQCIIFIINIVVVFFIDVMGFFILMKCGADPFYSRIFSIAVAFLVTWIPSRLFIFLKL- 59
           ++Q I F I  V+ F ID   + +L+    +   +   S  ++ +  ++ S  F+F+   
Sbjct: 13  LEQIIKFGIVGVIAFIIDFGLYTLLVHLHWNAVLAGALSFCISLIFNYLASMRFVFVHRP 72

Query: 60  RRKSFLETVRYGVMYFMLSILNYAFYVK------------LLLTFQGLQPLLATVLSAVS 107
               ++E + + V   +   +N                     T   +  + + +++ V 
Sbjct: 73  DMARWMEFLIFLVSSVIGLGINELIIWLGTEVILTPSAGQNNHTTYTIYAIGSKLVATVI 132

Query: 108 SMLFVFLLYIRF 119
            M++ F++    
Sbjct: 133 VMVWNFIIRKWL 144


>gi|254391637|ref|ZP_05006835.1| integral membrane protein [Streptomyces clavuligerus ATCC 27064]
 gi|294812993|ref|ZP_06771636.1| Integral membrane protein [Streptomyces clavuligerus ATCC 27064]
 gi|326441460|ref|ZP_08216194.1| cell surface polysaccharide biosynthesis protein [Streptomyces
           clavuligerus ATCC 27064]
 gi|197705322|gb|EDY51134.1| integral membrane protein [Streptomyces clavuligerus ATCC 27064]
 gi|294325592|gb|EFG07235.1| Integral membrane protein [Streptomyces clavuligerus ATCC 27064]
          Length = 174

 Score = 67.2 bits (163), Expect = 6e-10,   Method: Composition-based stats.
 Identities = 20/127 (15%), Positives = 43/127 (33%), Gaps = 5/127 (3%)

Query: 1   MKQCIIFIINIVVVFFIDVMGFFILMKCGADPFY-SRIFSIAVAFLVTWIPSRLFIFLKL 59
           M++   F         +++  F ++      P   + + + AVA L  ++  R F +   
Sbjct: 16  MREVAKFGAVGGAGVVVNLAVFNLVRATTELPVVRASLIANAVAILFNYVGYRYFTYRDR 75

Query: 60  RRK-SFLETVRYGVMYFMLSILNYAFYVKLLLTFQGLQPLLA---TVLSAVSSMLFVFLL 115
            +     E   + +   + S++           F    PL +          + LF F  
Sbjct: 76  DKSGRTREMSLFLLFSVIGSVIENGILYLATYGFGWDGPLQSNVFKFFGIGVATLFRFWS 135

Query: 116 YIRFMTR 122
           Y  ++ R
Sbjct: 136 YRTWVFR 142


>gi|309777666|ref|ZP_07672616.1| cell wall teichoic acid glycosylation protein GtcA
           [Erysipelotrichaceae bacterium 3_1_53]
 gi|308914570|gb|EFP60360.1| cell wall teichoic acid glycosylation protein GtcA
           [Erysipelotrichaceae bacterium 3_1_53]
          Length = 133

 Score = 67.2 bits (163), Expect = 6e-10,   Method: Composition-based stats.
 Identities = 9/120 (7%), Positives = 48/120 (40%), Gaps = 1/120 (0%)

Query: 3   QCIIFIINIVVVFFIDVMGFFILMKCGADPFYSRIFSIAVAFLVTWIPSRLFIFLKLRRK 62
           + + +++   +   ++ + +F           + + +   A L  +I +R ++F      
Sbjct: 10  ELLNYVVVGGLTTLVNFIVYFFCTHVAIHYLIANVIAWIFAVLFAYIANRKYVFKSEGND 69

Query: 63  SFLETVRYGVMYFMLSILNYAFYVKLLLTFQGLQPLLATVLSAVSSMLFVFLLYIRFMTR 122
              E +++  +  +  I+  +  + + +    +   +A +  ++ +++  ++     + +
Sbjct: 70  QKAEFLQFVSLRAVTLIVE-SLLLFVCIQLAAMDENIAKIFVSIVTVIGNYVFCKFMIFK 128


>gi|296282560|ref|ZP_06860558.1| putative dolichol monophosphate mannose synthase [Citromicrobium
           bathyomarinum JL354]
          Length = 362

 Score = 67.2 bits (163), Expect = 7e-10,   Method: Composition-based stats.
 Identities = 20/127 (15%), Positives = 43/127 (33%), Gaps = 7/127 (5%)

Query: 3   QCIIFIINIVVVFFIDVMGFFI-LMKCGADPFYSRIFSIAVAFLVTWIPSRLFIFLKLRR 61
           +  +F         + +    +     G+    ++  +   A    +  +    +   R 
Sbjct: 238 RFALFGTVGGAGVLVHLSVLALVFRMLGSGFTAAQALATFAAMSFNFWLNNWLTYRDQRL 297

Query: 62  KS----FLETVRYGVMYFMLSILNYAFYVKLLLTFQGLQPLLATVLSAVSSMLFVFLLYI 117
           +S          + V   + ++ N A     LL  +G   LLA +   V   ++ + L  
Sbjct: 298 RSVPAVLRGWAVFCVACSVGALANVAL--ASLLQARGTYWLLAALAGIVVGAVWNYALSN 355

Query: 118 RFMTRRV 124
           RF+  RV
Sbjct: 356 RFVWGRV 362



 Score = 36.0 bits (82), Expect = 1.8,   Method: Composition-based stats.
 Identities = 9/58 (15%), Positives = 22/58 (37%)

Query: 1   MKQCIIFIINIVVVFFIDVMGFFILMKCGADPFYSRIFSIAVAFLVTWIPSRLFIFLK 58
           ++   +F +   V    +V    +L   G     + +  I V  +  +  S  F++ +
Sbjct: 304 LRGWAVFCVACSVGALANVALASLLQARGTYWLLAALAGIVVGAVWNYALSNRFVWGR 361


>gi|313158520|gb|EFR57914.1| GtrA-like protein [Alistipes sp. HGB5]
          Length = 122

 Score = 67.2 bits (163), Expect = 7e-10,   Method: Composition-based stats.
 Identities = 18/122 (14%), Positives = 43/122 (35%), Gaps = 2/122 (1%)

Query: 1   MKQCIIFIINIVVVFFIDVMGFFILM-KCGADPFYSRIFSIAVAFLVTWIPSRLFIFLKL 59
           ++Q + F I      F+D    ++       + + +       A    +I +R++ F   
Sbjct: 2   IEQFLKFCIVGGSGVFVDFGITYLCKEWLRLNKYVANSLGFLCASTTNYILNRIWTFHNE 61

Query: 60  RRKSFLETVRYGVMYFMLSILNYAFYVKLLLTFQGLQPLLATVLSAVSSMLFVFLLYIRF 119
                 + +R+  +  +  ++N    + LL     L   LA + +      + F +   F
Sbjct: 62  NPDITGQYLRFLGIAAVGLVINN-LTIWLLHGRFRLNFYLAKLFAIGVVTFWNFFMNYFF 120

Query: 120 MT 121
             
Sbjct: 121 TF 122


>gi|295396181|ref|ZP_06806363.1| membrane protein [Brevibacterium mcbrellneri ATCC 49030]
 gi|294970969|gb|EFG46862.1| membrane protein [Brevibacterium mcbrellneri ATCC 49030]
          Length = 159

 Score = 67.2 bits (163), Expect = 7e-10,   Method: Composition-based stats.
 Identities = 17/133 (12%), Positives = 49/133 (36%), Gaps = 13/133 (9%)

Query: 3   QCIIFIINIVVVFFIDVMGFFILMKCGAD--------PFYSRIFSIAVAFLVTWIPSRLF 54
           + + F++     + +DV    +L+             P  ++I S   + +V W+ ++L+
Sbjct: 14  EVMRFLMVGGAGYVVDVGLSNLLVYGFLGIPATMPGSPVKAKIISTIASVIVAWLGNKLW 73

Query: 55  IFLKLRR-KSFLETVRYGVMYFMLSILNY----AFYVKLLLTFQGLQPLLATVLSAVSSM 109
            +       +    + + V+  +  ++        +  L L       +   ++    +M
Sbjct: 74  TYGDRTTGSNVRGFILFVVVNAIGMVITVLPLGVTWYLLNLRDPISYNISTNIVGIALAM 133

Query: 110 LFVFLLYIRFMTR 122
            F F  Y  ++ +
Sbjct: 134 AFRFYAYRTWVFK 146


>gi|303238893|ref|ZP_07325424.1| GtrA family protein [Acetivibrio cellulolyticus CD2]
 gi|302593526|gb|EFL63243.1| GtrA family protein [Acetivibrio cellulolyticus CD2]
          Length = 141

 Score = 67.2 bits (163), Expect = 7e-10,   Method: Composition-based stats.
 Identities = 21/126 (16%), Positives = 47/126 (37%), Gaps = 5/126 (3%)

Query: 2   KQCIIFIINIVVVFFIDVMGFFILMK-CGADPFYSRIFSIAVAFLVTWIPSRLFIF---L 57
           K  I F I  V+   + ++   I           S + + A     ++I ++L+ F    
Sbjct: 17  KSFIRFAIVGVINTLVTIIVNTICNNVFNIHHNVSWVIAYAAGVTNSYIMNKLWTFESKG 76

Query: 58  KLRRKSFLETVRYGVMYFMLSILNYAFYVKLLLTFQGLQPLLATVLSAVSSMLFVFLLYI 117
             + K+  E +++ V+  +            L+   G+   LA   + V S    +  Y 
Sbjct: 77  GSKEKATTELLQFIVVNLVSLAGTTLGLNY-LIENVGMDTNLAQFPTIVISQFINYFGYK 135

Query: 118 RFMTRR 123
            ++ ++
Sbjct: 136 LWVFKK 141


>gi|258517374|ref|YP_003193596.1| GtrA family protein [Desulfotomaculum acetoxidans DSM 771]
 gi|257781079|gb|ACV64973.1| GtrA family protein [Desulfotomaculum acetoxidans DSM 771]
          Length = 134

 Score = 67.2 bits (163), Expect = 7e-10,   Method: Composition-based stats.
 Identities = 15/121 (12%), Positives = 46/121 (38%), Gaps = 2/121 (1%)

Query: 2   KQCIIFIINIVVVFFIDVMGFFILMKCGADPFYS-RIFSIAVAFLVTWIPSRLFIFLKLR 60
           +  ++F +  +    ID + FF L     + F + ++ S +   + ++  ++ + F    
Sbjct: 13  RSFVLFSLVGLTNTVIDYLVFFSLYHLFPEHFLASQVISYSCGTVNSFFLNKYWTFRNKN 72

Query: 61  RKSFLETVRYGVMYFMLSILNYAFYVKLLLTFQGLQPLLATVLSAVSSMLFVFLLYIRFM 120
                E +++ V+  +   ++Y      +    GL   +    +   S +  +     ++
Sbjct: 73  IPCGAEILKFIVVNALALSISYITLDV-VSNSFGLDMFICKTFATGMSFVVNYFGSKFWV 131

Query: 121 T 121
            
Sbjct: 132 F 132


>gi|116332736|ref|YP_794263.1| hypothetical protein LVIS_0056 [Lactobacillus brevis ATCC 367]
 gi|116098083|gb|ABJ63232.1| Predicted membrane protein [Lactobacillus brevis ATCC 367]
          Length = 170

 Score = 67.2 bits (163), Expect = 7e-10,   Method: Composition-based stats.
 Identities = 13/121 (10%), Positives = 41/121 (33%), Gaps = 2/121 (1%)

Query: 2   KQCIIFIINIVVVFFIDVMGFFIL-MKCGADPFYSRIFSIAVAFLVTWIPSRLFIFLKLR 60
           KQ   +++   +   +++  F++     G +   S + +   +    +   +L +F    
Sbjct: 43  KQIQRYLLWGSLSVVVNIAMFYLFNSIFGVEYQISNLLAWVFSVQTAFWVDKLLVFKHAS 102

Query: 61  RKSFLETVRYGVMYFMLSILNYAFYVKLLLTFQGLQPLLATVLSAVSSMLFVFLLYIRFM 120
              F +  ++        IL         ++     P +  V+    +++  +     F+
Sbjct: 103 DHPFRDMGKFYGTRVFTYILEAVILYVG-ISLLSFHPTITKVIGHGLAVIGNYFFSKWFI 161

Query: 121 T 121
            
Sbjct: 162 F 162


>gi|290559815|gb|EFD93139.1| glycosyl transferase family 2 [Candidatus Parvarchaeum acidophilus
           ARMAN-5]
          Length = 335

 Score = 67.2 bits (163), Expect = 7e-10,   Method: Composition-based stats.
 Identities = 17/120 (14%), Positives = 46/120 (38%), Gaps = 5/120 (4%)

Query: 3   QCIIFIINIVVVFFIDVMGFFILMKCGADPFYSRIFSIAVAFLVTWIPSRLFIFLKLRRK 62
           + + F +  +    ++    F+            I S  ++ L  +I +    F + R  
Sbjct: 216 RFLKFALVGLSGIVVNEFFAFVFHTFLPLYLV-FIASAEISILSNFILNHKITF-ESRVS 273

Query: 63  SFLETVRYGVMYFMLSILNYAFYVKLLLTFQGLQPLLATVLSAVSSMLFVFLLYIRFMTR 122
                 RY ++  +  ++N +     L     +  LLA ++  + + +F ++L  ++  +
Sbjct: 274 IRQALPRYNLIALVGLVINVST---ALYLSIFVYYLLANLIGIIIAFVFNYILSEKYAWK 330


>gi|163748369|ref|ZP_02155634.1| GtrA-like protein [Oceanibulbus indolifex HEL-45]
 gi|161378358|gb|EDQ02862.1| GtrA-like protein [Oceanibulbus indolifex HEL-45]
          Length = 142

 Score = 67.2 bits (163), Expect = 7e-10,   Method: Composition-based stats.
 Identities = 23/124 (18%), Positives = 55/124 (44%), Gaps = 1/124 (0%)

Query: 2   KQCIIFIINIVVVFFIDVMGFFILMKCGADPFYSRIFSIAVAFLVTWIPSRLFIFLKLRR 61
           +Q + F +  ++  F+ +M  F+L++    P  + +F+  +AF+V++I    F F     
Sbjct: 3   RQLLRFGMVGLLATFVHMMIGFLLIQSTWHPLLANLFAFTIAFVVSFIGHLGFSFADQEV 62

Query: 62  KSFLETVRYGVMYFMLSILNYAFYVKLLLTFQGLQPLLATVLSAVSSMLFVFLLYIRFMT 121
            +     ++ ++  +    N      +LL+   L   ++  +S  S+ +  F L   +  
Sbjct: 63  SASSALWKFALVALIGFAFNEVLL-IMLLSEGDLSDTVSLWISTGSAAVLTFALSRLWAF 121

Query: 122 RRVY 125
           R  +
Sbjct: 122 RTPH 125


>gi|296116405|ref|ZP_06835019.1| glycosyl transferase family 2 [Gluconacetobacter hansenii ATCC
           23769]
 gi|295976998|gb|EFG83762.1| glycosyl transferase family 2 [Gluconacetobacter hansenii ATCC
           23769]
          Length = 375

 Score = 67.2 bits (163), Expect = 7e-10,   Method: Composition-based stats.
 Identities = 13/123 (10%), Positives = 48/123 (39%), Gaps = 4/123 (3%)

Query: 3   QCIIFIINIVVVFFIDVMGFFILMKCGADPFYSRIFSIAVAFLVTWIPSRLFIFLKLRRK 62
           + I F +  ++   +++    +L++CG      ++    V+ +V +  +    +   R  
Sbjct: 252 RFISFCLVGLLGIGVNLGVLSVLLQCGVTFPVGQVVGTYVSMIVNFGLNNRLTYRDCRLH 311

Query: 63  S---FLETVRYGVMYFMLSILNYAFYVKLLLTFQGLQPLLATVLSAVSSMLFVFLLYIRF 119
                     + ++  + ++ N     ++LL+        A++  A  + ++ + +    
Sbjct: 312 GMALAAGLCLFVLICSVGAVANVGV-AQMLLSSGPRHWGSASMAGAAIAAVWNYAVSSTL 370

Query: 120 MTR 122
           + +
Sbjct: 371 IWK 373


>gi|126459141|ref|YP_001055419.1| dolichyl-phosphate beta-D-mannosyltransferase [Pyrobaculum
           calidifontis JCM 11548]
 gi|126248862|gb|ABO07953.1| Dolichyl-phosphate beta-D-mannosyltransferase [Pyrobaculum
           calidifontis JCM 11548]
          Length = 340

 Score = 67.2 bits (163), Expect = 8e-10,   Method: Composition-based stats.
 Identities = 17/121 (14%), Positives = 39/121 (32%), Gaps = 4/121 (3%)

Query: 5   IIFIINIVVVFFIDVMGFFILMKCGADPFYSRIFSIAVAFLVTWIPSRLFIFLKLRRKSF 64
           + F         +              P  S   +I ++    ++ +RL+ F +      
Sbjct: 222 LKFAAVGATGVAVATAVLAATSWMT--PLASVALAIEISLTTNYLLNRLWTFSERHTPLL 279

Query: 65  LETVRYGVMYFMLSILNYAFYVKLLLTFQGLQPLLATVLSAVSSMLFVFLLYIRFMTRRV 124
               +Y +     ++ NYA  +   L F G+   LA ++   +     + L    +  + 
Sbjct: 280 AGWAKYHLATAAGNLTNYATTLA--LHFAGVWIYLAYLVGVAAGYFVNYALSELVVFSKP 337

Query: 125 Y 125
            
Sbjct: 338 P 338


>gi|290558822|gb|EFD92215.1| glycosyl transferase family 2 [Candidatus Parvarchaeum acidophilus
           ARMAN-5]
          Length = 335

 Score = 67.2 bits (163), Expect = 8e-10,   Method: Composition-based stats.
 Identities = 17/120 (14%), Positives = 46/120 (38%), Gaps = 5/120 (4%)

Query: 3   QCIIFIINIVVVFFIDVMGFFILMKCGADPFYSRIFSIAVAFLVTWIPSRLFIFLKLRRK 62
           + + F +  +    ++    F+            I S  ++ L  +I +    F + R  
Sbjct: 216 RFLKFALVGLSGIVVNEFFAFVFHTFLPLYLV-FIASAEISILSNFILNHKITF-ESRVS 273

Query: 63  SFLETVRYGVMYFMLSILNYAFYVKLLLTFQGLQPLLATVLSAVSSMLFVFLLYIRFMTR 122
                 RY ++  +  ++N +     L     +  LLA ++  + + +F ++L  ++  +
Sbjct: 274 IRQALPRYNLIALVGLVINVST---ALYLSIFVYYLLANLIGIIIAFVFNYILSEKYAWK 330


>gi|326404294|ref|YP_004284376.1| putative glycosyltransferase [Acidiphilium multivorum AIU301]
 gi|325051156|dbj|BAJ81494.1| putative glycosyltransferase [Acidiphilium multivorum AIU301]
          Length = 365

 Score = 66.8 bits (162), Expect = 8e-10,   Method: Composition-based stats.
 Identities = 13/123 (10%), Positives = 40/123 (32%), Gaps = 4/123 (3%)

Query: 3   QCIIFIINIVVVFFIDVMGFFILMKCGADPFYSRIFSIAVAFLVTWIPSRLFIFLK---L 59
           + I F +  +   F+++         G     ++     VA +  +  +    +      
Sbjct: 242 RFIAFALVGLFGIFVNLAAMQASRAAGLGFGPAQTLGTIVAMVANFELNNRLTYRTMKLR 301

Query: 60  RRKSFLETVRYGVMYFMLSILNYAFYVKLLLTFQGLQPLLATVLSAVSSMLFVFLLYIRF 119
             + +   V + ++  + +I N       L        L A+   +   +++ + +    
Sbjct: 302 GVRYWQGLVLFMLVCGLGAIANIGI-AGALYHRGDANGLAASAAGSAIGVVWNYAVSATL 360

Query: 120 MTR 122
           + R
Sbjct: 361 VWR 363


>gi|239996273|ref|ZP_04716797.1| hypothetical protein AmacA2_17605 [Alteromonas macleodii ATCC
           27126]
          Length = 132

 Score = 66.8 bits (162), Expect = 8e-10,   Method: Composition-based stats.
 Identities = 22/123 (17%), Positives = 48/123 (39%), Gaps = 3/123 (2%)

Query: 2   KQCIIFIINIVVVFFIDVMGFFILMKCGADPFY-SRIFSIAVAFLVTWIPSRLFIFLKLR 60
           K+   FI   ++ F +D   F I +         +RI +   A   TW+ +R   F +  
Sbjct: 3   KEVFRFIGVGILGFSVDAATFSIFVYASHLSLIQARIIAFLCAATATWLGNRHITFQRDD 62

Query: 61  RKSFLETVRYGVMYFMLSILNYAFYVKLL--LTFQGLQPLLATVLSAVSSMLFVFLLYIR 118
                +  R+  +  + ++ N+  +      L   G+ PLL+  +  ++     + L   
Sbjct: 63  APVLQQWFRFMTVATVSALPNFICFSIANVKLGQTGIMPLLSLSIGIIAGAACNYTLCKY 122

Query: 119 FMT 121
           ++ 
Sbjct: 123 WVF 125


>gi|20094355|ref|NP_614202.1| hypothetical protein MK0919 [Methanopyrus kandleri AV19]
 gi|19887417|gb|AAM02132.1| Uncharacterized membrane protein [Methanopyrus kandleri AV19]
          Length = 151

 Score = 66.8 bits (162), Expect = 8e-10,   Method: Composition-based stats.
 Identities = 16/124 (12%), Positives = 49/124 (39%), Gaps = 6/124 (4%)

Query: 3   QCIIFIINIVVVFFIDVMGFFILMKC-GADPFYSRIFSIAVAFLVTWIPSRLFIFLKLRR 61
           + + F +  +   F+++   + L +  G     S I ++ V+ +  +I + L+ +   R 
Sbjct: 19  RFLKFSLVGLSGVFVNLGLLWFLTEVVGIYYVVSNIIAVEVSIISNFILNDLWTWRDRRD 78

Query: 62  KSFLETVR----YGVMYFMLSILNYAFYVKLLLTFQGLQPLLATVLSAVSSMLFVFLLYI 117
              L  ++    + ++     ++N A     L     +  + + +    ++ L+ + +  
Sbjct: 79  PGLLNFLKRLAAFNIICAGGLVINTAVL-WTLTELLHIYYIASALFGIAAATLWNYWMNN 137

Query: 118 RFMT 121
           R   
Sbjct: 138 RVTW 141


>gi|312137736|ref|YP_004005072.1| gtra-like protein [Rhodococcus equi 103S]
 gi|311887075|emb|CBH46384.1| putative GtrA-like protein [Rhodococcus equi 103S]
          Length = 155

 Score = 66.8 bits (162), Expect = 9e-10,   Method: Composition-based stats.
 Identities = 13/120 (10%), Positives = 43/120 (35%)

Query: 3   QCIIFIINIVVVFFIDVMGFFILMKCGADPFYSRIFSIAVAFLVTWIPSRLFIFLKLRRK 62
           Q + F++   +   +D   + +L+  G     ++  S        ++ +R + F     +
Sbjct: 34  QIVRFVLTGGLSAVVDFGLYLLLLAVGLPLNLAKAISFIAGTTTAYLINRRWTFKAEPSR 93

Query: 63  SFLETVRYGVMYFMLSILNYAFYVKLLLTFQGLQPLLATVLSAVSSMLFVFLLYIRFMTR 122
           +    V           +     +  +   +  +  LA V++  ++ +  F++    + +
Sbjct: 94  ARFVAVVVLYALTFAVQVGLNGLMAHVFPDEWWRIPLAFVIAQGTATVINFVVQRAVIFK 153


>gi|291516011|emb|CBK65221.1| Predicted membrane protein [Alistipes shahii WAL 8301]
          Length = 122

 Score = 66.8 bits (162), Expect = 9e-10,   Method: Composition-based stats.
 Identities = 17/122 (13%), Positives = 41/122 (33%), Gaps = 2/122 (1%)

Query: 1   MKQCIIFIINIVVVFFIDVMGFFILM-KCGADPFYSRIFSIAVAFLVTWIPSRLFIFLKL 59
           ++Q   F +      F+D    ++       + + +       A    +I +R++ F   
Sbjct: 2   IEQFFKFCVVGGSGVFVDFGVTYLCKEWLKLNKYVANSLGFLCASTSNYILNRIWTFQNE 61

Query: 60  RRKSFLETVRYGVMYFMLSILNYAFYVKLLLTFQGLQPLLATVLSAVSSMLFVFLLYIRF 119
                 + +R+  +  +  ++N A     L     L   LA + +      + F +   F
Sbjct: 62  NPDITGQYLRFLGIAAVGLVINNATIYV-LHGRFRLNFYLAKLFAIGVVTFWNFFMNYFF 120

Query: 120 MT 121
             
Sbjct: 121 TF 122


>gi|326386767|ref|ZP_08208388.1| dolichyl-phosphate beta-D-mannosyltransferase [Novosphingobium
           nitrogenifigens DSM 19370]
 gi|326208820|gb|EGD59616.1| dolichyl-phosphate beta-D-mannosyltransferase [Novosphingobium
           nitrogenifigens DSM 19370]
          Length = 369

 Score = 66.8 bits (162), Expect = 9e-10,   Method: Composition-based stats.
 Identities = 12/139 (8%), Positives = 42/139 (30%), Gaps = 20/139 (14%)

Query: 3   QCIIFIINIVVVFFIDVMGFFILMKC--------------GADPFYSRIFSIAVAFLVTW 48
           +  +F     +   +     + ++                      +   +   A    +
Sbjct: 231 RFALFGTVGALGVAVQFAILWFVLSVVLRERFVYGHWAVGETTFTIANTIAALTAMTFNF 290

Query: 49  IPSRLFIFLKLRRKSF----LETVRYGVMYFMLSILNYAFYVKLLLTFQGLQPLLATVLS 104
           + +    +   R + F        ++ +   +  + N A      L    +  ++A ++ 
Sbjct: 291 VLNNELTYADKRLRGFVPLVKGWAKFALTCSIGILSNIA--SADALKRMHINDVVAVLVG 348

Query: 105 AVSSMLFVFLLYIRFMTRR 123
            V + ++ F L  +F+  +
Sbjct: 349 IVLAAVWNFALSSKFVWGK 367


>gi|310644297|ref|YP_003949056.1| bactoprenol-linked glucose translocase (flippase) gtra-like protein
           [Paenibacillus polymyxa SC2]
 gi|309249248|gb|ADO58815.1| Bactoprenol-linked glucose translocase (Flippase) GtrA-like protein
           [Paenibacillus polymyxa SC2]
          Length = 139

 Score = 66.8 bits (162), Expect = 9e-10,   Method: Composition-based stats.
 Identities = 19/119 (15%), Positives = 46/119 (38%), Gaps = 2/119 (1%)

Query: 4   CIIFIINIVVVFFIDVMGFFILMK-CGADPFYSRIFSIAVAFLVTWIPSRLFIFLKLRRK 62
            I + I  ++   I V    +L++        +      V  LV+++ +R + F      
Sbjct: 11  IIKYGIVGLLGTGIHVGVLVLLVELFAIPAVTATTIGFIVTLLVSYVLNRNWTFEPTGEG 70

Query: 63  SFLETVRYGVMYFMLSILNYAFYVKLLLTFQGLQPLLATVLSAVSSMLFVFLLYIRFMT 121
           S  + ++Y ++     +LN A     +    G   L+  VL+ +   +  ++    ++ 
Sbjct: 71  SRTQFLKYLLVCTCGLLLNAALMYVTIHWI-GWSYLIGEVLTTIIVPVHNYIWNRYWIF 128



 Score = 34.5 bits (78), Expect = 5.3,   Method: Composition-based stats.
 Identities = 6/61 (9%), Positives = 25/61 (40%), Gaps = 1/61 (1%)

Query: 3   QCIIFIINIVVVFFIDVMGFFI-LMKCGADPFYSRIFSIAVAFLVTWIPSRLFIFLKLRR 61
           Q + +++       ++    ++ +   G       + +  +  +  +I +R +IF   ++
Sbjct: 74  QFLKYLLVCTCGLLLNAALMYVTIHWIGWSYLIGEVLTTIIVPVHNYIWNRYWIFSVPQQ 133

Query: 62  K 62
           +
Sbjct: 134 R 134


>gi|300934430|ref|ZP_07149686.1| hypothetical protein CresD4_10193 [Corynebacterium resistens DSM
           45100]
          Length = 232

 Score = 66.8 bits (162), Expect = 9e-10,   Method: Composition-based stats.
 Identities = 15/158 (9%), Positives = 43/158 (27%), Gaps = 38/158 (24%)

Query: 3   QCIIFIINIVVVFFIDVMGFFILMKCGA----------------------DPFYSRIFSI 40
           Q + F I     F ++   F +  K                               + + 
Sbjct: 49  QFMQFGIVGASGFIVNQAVFVVARKLFDGAWHIGSEDPFLNLLGSQFHMRWYHVFCVIAF 108

Query: 41  AVAFLVTWIPSRLFIFLKLRRK-SFLETVRYGVMYFMLSILNYAFYVKLLLTFQGL---- 95
            VA +  ++ +R + F   +++  + +  ++  +     ++  A    ++     L    
Sbjct: 109 VVANVWNFMLNRRWTFKDSKKRAWWKQLPQFMAVGIFGLLITLAVATLVVNPESPLALPR 168

Query: 96  -----------QPLLATVLSAVSSMLFVFLLYIRFMTR 122
                             +  + ++   FL    +  R
Sbjct: 169 EIFDSSTGFRRPDYWGNFIGVMVAVPANFLFNKLWTFR 206



 Score = 37.2 bits (85), Expect = 0.83,   Method: Composition-based stats.
 Identities = 10/85 (11%), Positives = 26/85 (30%), Gaps = 17/85 (20%)

Query: 2   KQCIIFIINIVVVFFIDVMGFFILMK-----------------CGADPFYSRIFSIAVAF 44
           KQ   F+   +    I +    +++                       ++     + VA 
Sbjct: 134 KQLPQFMAVGIFGLLITLAVATLVVNPESPLALPREIFDSSTGFRRPDYWGNFIGVMVAV 193

Query: 45  LVTWIPSRLFIFLKLRRKSFLETVR 69
              ++ ++L+ F    +    + VR
Sbjct: 194 PANFLFNKLWTFRGSSKSEPEKLVR 218


>gi|325675112|ref|ZP_08154798.1| membrane protein [Rhodococcus equi ATCC 33707]
 gi|325554073|gb|EGD23749.1| membrane protein [Rhodococcus equi ATCC 33707]
          Length = 155

 Score = 66.8 bits (162), Expect = 9e-10,   Method: Composition-based stats.
 Identities = 16/122 (13%), Positives = 46/122 (37%), Gaps = 4/122 (3%)

Query: 3   QCIIFIINIVVVFFIDVMGFFILMKCGADPFYSRIFSIAVAFLVTWIPSRLFIFLKLRRK 62
           Q + F++   +   +D   + +L+  G     ++  S        ++ +R + F     +
Sbjct: 34  QIVRFVLTGGLSAVVDFGLYLLLLAVGLPLNLAKAISFIAGTTTAYLINRRWTFKAEPSR 93

Query: 63  SFLETVRYGVMYFMLSILNYAFYVKLLLTFQ--GLQPLLATVLSAVSSMLFVFLLYIRFM 120
           +    V   V+Y +   +       +   F     +  LA V++  ++ +  F++    +
Sbjct: 94  A--RFVAVVVLYGLTFAVQVGLNGLMAHVFPDEWWRIPLAFVIAQGTATVINFVVQRAVI 151

Query: 121 TR 122
            +
Sbjct: 152 FK 153


>gi|148260897|ref|YP_001235024.1| dolichyl-phosphate beta-D-mannosyltransferase [Acidiphilium cryptum
           JF-5]
 gi|146402578|gb|ABQ31105.1| Dolichyl-phosphate beta-D-mannosyltransferase [Acidiphilium cryptum
           JF-5]
          Length = 364

 Score = 66.8 bits (162), Expect = 9e-10,   Method: Composition-based stats.
 Identities = 13/123 (10%), Positives = 40/123 (32%), Gaps = 4/123 (3%)

Query: 3   QCIIFIINIVVVFFIDVMGFFILMKCGADPFYSRIFSIAVAFLVTWIPSRLFIFLK---L 59
           + I F +  +   F+++         G     ++     VA +  +  +    +      
Sbjct: 242 RFIAFALVGLFGIFVNLAAMQASRAAGLGFGPAQTLGTIVAMVANFELNNRLTYRTMKLR 301

Query: 60  RRKSFLETVRYGVMYFMLSILNYAFYVKLLLTFQGLQPLLATVLSAVSSMLFVFLLYIRF 119
             + +   V + ++  + +I N       L        L A+   +   +++ + +    
Sbjct: 302 GVRYWQGLVLFMLVCGLGAIANIGI-AGALYHRGDANGLAASAAGSAIGVVWNYAVSATL 360

Query: 120 MTR 122
           + R
Sbjct: 361 VWR 363


>gi|302380872|ref|ZP_07269335.1| glycosyltransferase, group 2 family protein [Finegoldia magna
           ACS-171-V-Col3]
 gi|303234877|ref|ZP_07321502.1| glycosyltransferase, group 2 family protein [Finegoldia magna
           BVS033A4]
 gi|302311367|gb|EFK93385.1| glycosyltransferase, group 2 family protein [Finegoldia magna
           ACS-171-V-Col3]
 gi|302493995|gb|EFL53776.1| glycosyltransferase, group 2 family protein [Finegoldia magna
           BVS033A4]
          Length = 329

 Score = 66.8 bits (162), Expect = 1e-09,   Method: Composition-based stats.
 Identities = 19/123 (15%), Positives = 46/123 (37%), Gaps = 5/123 (4%)

Query: 2   KQCIIFIINIVVVFFIDVMGFFILMKCG--ADPFYSRIFSIAVAFLVTWIPSRLFIFLKL 59
           K  + F  +  + F +D   F +L           S I + AV+    +  +  F+F   
Sbjct: 210 KSILKFSTSSYLSFLVDYFTFILLFYKLDLQSLVLSNIIARAVSSTFNFYVNNKFVFKNK 269

Query: 60  RRKSFLETVRYGVMYFMLSILNYAFYVKLLLTFQGLQPLLATVLSAVSSMLFVFLLYIRF 119
            +    + ++Y  +   +  LN        L   G++  +A +++     +  + +  R 
Sbjct: 270 DK-ILKKYIKYVTLVVFILALNTVVLKI--LQSLGIRVFVAKIITEALMFIVSYNIQKRI 326

Query: 120 MTR 122
           + +
Sbjct: 327 IFK 329



 Score = 37.2 bits (85), Expect = 0.71,   Method: Composition-based stats.
 Identities = 13/78 (16%), Positives = 35/78 (44%), Gaps = 1/78 (1%)

Query: 53  LFIFLKLRRKSFLETVRYGVMYFMLSILNYAFYVKLLLTFQGLQPLLATVLSAVSSMLFV 112
            F  LK   K +   +++    ++  +++Y  ++ L         +L+ +++   S  F 
Sbjct: 198 HFNALKDSAKIYKSILKFSTSSYLSFLVDYFTFILLFYKLDLQSLVLSNIIARAVSSTFN 257

Query: 113 FLLYIRFMTR-RVYFIKK 129
           F +  +F+ + +   +KK
Sbjct: 258 FYVNNKFVFKNKDKILKK 275


>gi|121603233|ref|YP_980562.1| GtrA family protein [Polaromonas naphthalenivorans CJ2]
 gi|120592202|gb|ABM35641.1| GtrA family protein [Polaromonas naphthalenivorans CJ2]
          Length = 162

 Score = 66.5 bits (161), Expect = 1e-09,   Method: Composition-based stats.
 Identities = 23/130 (17%), Positives = 49/130 (37%), Gaps = 9/130 (6%)

Query: 3   QCIIFIINIVVVFFIDVMGFFILMK--------CGADPFYSRIFSIAVAFLVTWIPSRLF 54
           + I F +       I+++  ++  +              YS   +I VA +  +  +R  
Sbjct: 26  RFIKFGLVGGSGTVINIVVLYLAQEHLLRGIADFHTRLNYSIALAITVATISNFYWNRRL 85

Query: 55  IFLKLRRKSFLETVRYGVMYFMLSILNYAFYVKLLLTFQG-LQPLLATVLSAVSSMLFVF 113
            +    R +    +R  V Y M + L+      L     G L  ++A +++ V + +  F
Sbjct: 86  TWRDRTRNTPQPALRLFVKYVMAAALSIVIQSLLTKWLAGYLHYIVANLIAIVLASVVNF 145

Query: 114 LLYIRFMTRR 123
           +   +   RR
Sbjct: 146 VANDKLTFRR 155



 Score = 34.9 bits (79), Expect = 3.9,   Method: Composition-based stats.
 Identities = 8/65 (12%), Positives = 26/65 (40%), Gaps = 1/65 (1%)

Query: 1   MKQCIIFIINIVVVFFIDVMGFFILMKCGADPFYSRIFSIAVAFLVTWIPSRLFIFLKLR 60
           ++  + +++   +   I  +    L         + + +I +A +V ++ +    F + R
Sbjct: 99  LRLFVKYVMAAALSIVIQSLLTKWLAGY-LHYIVANLIAIVLASVVNFVANDKLTFRRHR 157

Query: 61  RKSFL 65
            K+  
Sbjct: 158 PKAPH 162


>gi|317969652|ref|ZP_07971042.1| putative glycosyl transferase [Synechococcus sp. CB0205]
          Length = 366

 Score = 66.5 bits (161), Expect = 1e-09,   Method: Composition-based stats.
 Identities = 12/124 (9%), Positives = 38/124 (30%), Gaps = 5/124 (4%)

Query: 2   KQCIIFIINIVVVFFIDVMGFFILMK-CGADPFYSRIFSIAVAFLVTWIPSRLFIFLKLR 60
           ++ I F +  +    + ++   + M   G     +    +  A    ++ +    F   R
Sbjct: 240 RRAISFGLVGLSGVAVQLLITQLFMALWGLGFEQALPIGVISAASSNYLINNALTFRFAR 299

Query: 61  RKS---FLETVRYGVMYFMLSILNYAFYVKLLLTFQGLQPLLATVLSAVSSMLFVFLLYI 117
            K         ++ ++  +  + N         +        A +   +   ++ +    
Sbjct: 300 LKGILLLRGLFKFLLVASLPVMANVGLASA-YYSLISPNVFWAQLAGIIVVFVWNYAASS 358

Query: 118 RFMT 121
           RF+ 
Sbjct: 359 RFVW 362


>gi|222081875|ref|YP_002541240.1| glycosyltransferase protein [Agrobacterium radiobacter K84]
 gi|221726554|gb|ACM29643.1| glycosyltransferase protein [Agrobacterium radiobacter K84]
          Length = 387

 Score = 66.5 bits (161), Expect = 1e-09,   Method: Composition-based stats.
 Identities = 14/122 (11%), Positives = 44/122 (36%), Gaps = 4/122 (3%)

Query: 4   CIIFIINIVVVFFIDVMGFFILMKCGADPFYSRIFSIAVAFLVTWIPSRLFIFLKLRRKS 63
            I F+        + +   +  +  G     +++ +  VA    ++ +    F   R + 
Sbjct: 267 LISFLCVGASGVLVHLSILYCALTLGLPFTAAQVAAALVAASSNFLLNNFLTFRDKRLRG 326

Query: 64  FLET---VRYGVMYFMLSILNYAFYVKLLLTFQGLQPLLATVLSAVSSMLFVFLLYIRFM 120
           + +    V++ ++  +  + N +           +  LLAT+       ++ F++    +
Sbjct: 327 WAQFYGYVKFLLISSVGILANVSAAAITYERIVHV-VLLATLAGIAIDTIWKFVVVKHLV 385

Query: 121 TR 122
            +
Sbjct: 386 WK 387


>gi|210610913|ref|ZP_03288638.1| hypothetical protein CLONEX_00828 [Clostridium nexile DSM 1787]
 gi|210152213|gb|EEA83220.1| hypothetical protein CLONEX_00828 [Clostridium nexile DSM 1787]
          Length = 349

 Score = 66.5 bits (161), Expect = 1e-09,   Method: Composition-based stats.
 Identities = 17/129 (13%), Positives = 47/129 (36%), Gaps = 9/129 (6%)

Query: 2   KQCIIFIINIVVVFFIDVMGFFILMKC-------GADPFYSRIFSIAVAFLVTWIPSRLF 54
           K+ + F       F ID   + +L          G    +S I +  V+ +  ++ +R  
Sbjct: 220 KEILKFSAASFGSFLIDYGMYSLLTAITATGFANGGAVAFSNIGARIVSAVFNYMVNRNM 279

Query: 55  IFLKLRRKSFLETVRYGVMYFMLSILNYAFYVKLLLTFQGLQPLLATVLSAVSSMLFVFL 114
           +F           ++Y  +   + + N    +++L+   G+   +  + +        + 
Sbjct: 280 VFQSKENPV-RSALKYFTLAVGILVGN-TIMLEILVNAIGMNHYVGKLCTEFIFFFASWF 337

Query: 115 LYIRFMTRR 123
           +   F+ ++
Sbjct: 338 IQSHFIFQK 346


>gi|220927807|ref|YP_002504716.1| GtrA family protein [Clostridium cellulolyticum H10]
 gi|219998135|gb|ACL74736.1| GtrA family protein [Clostridium cellulolyticum H10]
          Length = 137

 Score = 66.5 bits (161), Expect = 1e-09,   Method: Composition-based stats.
 Identities = 20/123 (16%), Positives = 55/123 (44%), Gaps = 2/123 (1%)

Query: 1   MKQCIIFIINIVVVFFIDVMGFFILMK-CGADPFYSRIFSIAVAFLVTWIPSRLFIFLKL 59
           M+Q + + +  V+   I ++  F+L    G     +        F+ ++I ++ + F   
Sbjct: 15  MRQMVKYGLVGVINTIITMIVLFVLQNAFGVSYKLANGAGYVCGFINSFILNKFWTFKGN 74

Query: 60  RRKSFLETVRYGVMYFMLSILNYAFYVKLLLTFQGLQPLLATVLSAVSSMLFVFLLYIRF 119
           ++ +  + +R+ +++ +   +    +V LL+    ++  ++ ++  V   L  FLL   F
Sbjct: 75  QKSTLSQFIRFSLVFAVCYAMQLG-FVVLLVEKMHIEKNISQLIGMVFYTLISFLLNKVF 133

Query: 120 MTR 122
             +
Sbjct: 134 TFK 136


>gi|227904203|ref|ZP_04022008.1| conserved hypothetical protein [Lactobacillus acidophilus ATCC
           4796]
 gi|227868222|gb|EEJ75643.1| conserved hypothetical protein [Lactobacillus acidophilus ATCC
           4796]
          Length = 153

 Score = 66.5 bits (161), Expect = 1e-09,   Method: Composition-based stats.
 Identities = 19/128 (14%), Positives = 48/128 (37%), Gaps = 2/128 (1%)

Query: 2   KQCIIFIINIVVVFFIDVMGFFILMKCGADPFYSRIFSIAVAFLVTWIPSRLFIFLKLRR 61
           +Q I + +   +   +D   F +L+    +   +   S +   +  ++ +    F    +
Sbjct: 26  RQLIGYCLIGGLGLVVDFGVFTLLVHLNVNVELANFISSSCGLINNFLWNSFANFKVHDK 85

Query: 62  KSFLETVRYGVMYFMLSILNYAFYVKLLLTFQGLQPLLATVLSAVSSMLFVFLLYIRFMT 121
              L  + Y ++  + +I        + +   G   ++  V+S   + L  F++      
Sbjct: 86  -LLLRFISYYLVGQVTTIFTTLCL-FIFVDKLGYNTIIVKVVSTFIATLIQFVINKVLTF 143

Query: 122 RRVYFIKK 129
           R+   IKK
Sbjct: 144 RKDTRIKK 151


>gi|209545321|ref|YP_002277550.1| glycosyl transferase family 2 [Gluconacetobacter diazotrophicus PAl
           5]
 gi|209532998|gb|ACI52935.1| glycosyl transferase family 2 [Gluconacetobacter diazotrophicus PAl
           5]
          Length = 383

 Score = 66.5 bits (161), Expect = 1e-09,   Method: Composition-based stats.
 Identities = 11/123 (8%), Positives = 41/123 (33%), Gaps = 5/123 (4%)

Query: 3   QCIIFIINIVVVFFIDVMGFFILMKCGADPFYSRIFSIAVAFLVTWIPSRLFIFLK---L 59
           + I F +  +V   ++++   +  +CGAD    +      A +  +  +    +      
Sbjct: 261 RFIAFALVGLVGILVNLVVLDVARRCGADFASGQGIGTVAAMVANFWMNNSLTYRDCRLR 320

Query: 60  RRKSFLETVRYGVMYFMLSILNYAFYVKLLLTFQGLQPLLATVLSAVSSMLFVFLLYIRF 119
             + +L  + +  +  + ++ +      +           A   +     ++ + +    
Sbjct: 321 GGRMWLGLLLFLAICSVGALADIGIARAVFSEDGKWNQAGAAGAAIAV--VWNYAVSSTL 378

Query: 120 MTR 122
           + R
Sbjct: 379 IWR 381


>gi|254421362|ref|ZP_05035080.1| GtrA-like protein [Synechococcus sp. PCC 7335]
 gi|196188851|gb|EDX83815.1| GtrA-like protein [Synechococcus sp. PCC 7335]
          Length = 407

 Score = 66.5 bits (161), Expect = 1e-09,   Method: Composition-based stats.
 Identities = 22/130 (16%), Positives = 48/130 (36%), Gaps = 8/130 (6%)

Query: 1   MKQCIIFIINIVVVFFIDVMGFFILMK-CGADPFYSRIFSIAVAFLVTWIPSRLFIFLK- 58
           MK+ I + I       +D+   ++L +  G     S+I +   A    +I + ++ F   
Sbjct: 273 MKRFIRYGIVGFGGVVVDMALLYLLYQAVGLGLIISKIIAAEAAIFSNFIWNDIWTFADM 332

Query: 59  -----LRRKSFLETVRYGVMYFMLSILNYAFY-VKLLLTFQGLQPLLATVLSAVSSMLFV 112
                     F   +++  +     +LN     +   + F+   P LA +++      + 
Sbjct: 333 LKEQTGWSNRFKRLLKFNTICLSGLVLNILLLQMFFSVFFEHKLPYLANLITIFLVAAWN 392

Query: 113 FLLYIRFMTR 122
           F L  +   R
Sbjct: 393 FWLNFKLSWR 402


>gi|182416535|ref|ZP_02947962.1| glycosyl transferase [Clostridium butyricum 5521]
 gi|237668771|ref|ZP_04528755.1| dolichyl-phosphate beta-D-mannosyltransferase [Clostridium
           butyricum E4 str. BoNT E BL5262]
 gi|182379607|gb|EDT77089.1| glycosyl transferase [Clostridium butyricum 5521]
 gi|237657119|gb|EEP54675.1| dolichyl-phosphate beta-D-mannosyltransferase [Clostridium
           butyricum E4 str. BoNT E BL5262]
          Length = 337

 Score = 66.5 bits (161), Expect = 1e-09,   Method: Composition-based stats.
 Identities = 20/122 (16%), Positives = 56/122 (45%), Gaps = 4/122 (3%)

Query: 3   QCIIFIINIVVVFFIDVMGFFILMKCGADPFYSRIFSIAVAFLVTWIPSRLFIFLKLRR- 61
           Q + + ++ ++   +D +   I+    ++   S + +  ++    ++ ++ ++F + +  
Sbjct: 218 QILKYSMSSILSGILDFIFLLIIKALTSNLLLSVVIARFLSSSFNYVMNKNYVFSRNKEE 277

Query: 62  -KSFLETVRYGVMYFMLSILNYAFYVKLLLTFQGLQPLLATVLSAVSSMLFVFLLYIRFM 120
             + L   RY  +   + I NY     L     G+  ++A +L+  +  +F F++  RF+
Sbjct: 278 FNTTLSLPRYIFLVITVLIFNYIILDYLC--SLGVSLVIAKLLTECTLFIFSFVVQKRFV 335

Query: 121 TR 122
            R
Sbjct: 336 FR 337


>gi|218283220|ref|ZP_03489290.1| hypothetical protein EUBIFOR_01878 [Eubacterium biforme DSM 3989]
 gi|218216038|gb|EEC89576.1| hypothetical protein EUBIFOR_01878 [Eubacterium biforme DSM 3989]
          Length = 133

 Score = 66.5 bits (161), Expect = 1e-09,   Method: Composition-based stats.
 Identities = 22/123 (17%), Positives = 51/123 (41%), Gaps = 2/123 (1%)

Query: 1   MKQCIIFIINIVVVFFIDVMGFFILMKCGADPFYSRIFSIAVAFLVTWIPSRLFIFLKLR 60
           +K+ I + I  V+   ++ + +FI +K G     S   +  VA +  +  +R  +F    
Sbjct: 4   VKEFISYGIVGVMTTLVNYIVYFICLKIGIHWLISNSLAWMVAVIFAYFSNRKVVF-HSS 62

Query: 61  RKSFLETVRYGVMYFMLSILNYAFYVKLLLTFQGLQPLLATVLSAVSSMLFVFLLYIRFM 120
                E + +  + FM  ++         +    +  LL+ +L +V ++L  + L    +
Sbjct: 63  NDMKKECIEFFGLRFMTLLVENLLLAIC-IDGLHISNLLSKILVSVITVLANYFLCKSHI 121

Query: 121 TRR 123
             +
Sbjct: 122 FSK 124


>gi|33864224|ref|NP_895784.1| putative glycosyl transferase [Prochlorococcus marinus str. MIT
           9313]
 gi|33635808|emb|CAE22133.1| putative glycosyl transferase [Prochlorococcus marinus str. MIT
           9313]
          Length = 373

 Score = 66.5 bits (161), Expect = 1e-09,   Method: Composition-based stats.
 Identities = 17/124 (13%), Positives = 47/124 (37%), Gaps = 5/124 (4%)

Query: 2   KQCIIFIINIVVVFFIDVMGFFILMKCGADPFYSRI-FSIAVAFLVTWIPSRLFIFLKLR 60
           ++ I F +  +   F+ +   FIL    +  F S +  ++ +A    ++ + +  F   R
Sbjct: 248 RRAISFALVGLSGVFVQLFSVFILTNTLSYSFQSSLPIAVILAATSNYLINNILTFRFAR 307

Query: 61  R---KSFLETVRYGVMYFMLSILNYAFYVKLLLTFQGLQPLLATVLSAVSSMLFVFLLYI 117
               K      ++ ++  +  + N                L+A +L  + +  + ++   
Sbjct: 308 LNGLKLIKGLTKFLLVSSLPFLANIGLASA-YYEHISSNELIAQLLGIIFAFTWNYVASS 366

Query: 118 RFMT 121
           +F+ 
Sbjct: 367 KFVW 370


>gi|313139439|ref|ZP_07801632.1| conserved hypothetical protein [Bifidobacterium bifidum NCIMB
           41171]
 gi|313131949|gb|EFR49566.1| conserved hypothetical protein [Bifidobacterium bifidum NCIMB
           41171]
          Length = 185

 Score = 66.5 bits (161), Expect = 1e-09,   Method: Composition-based stats.
 Identities = 23/131 (17%), Positives = 46/131 (35%), Gaps = 12/131 (9%)

Query: 1   MKQCIIFIINIVVVFFIDVMGFFILMKCGADPFYSRIFSIAVAFLVTWIPSRLFIFLKL- 59
           ++Q + F I  VV F ID     IL+        +   S  V+ +  ++ S  F+F    
Sbjct: 5   IEQLMKFGIVGVVAFIIDWGLMNILLMTHMHNVLATSISFFVSLIFNYLASMKFVFKHRP 64

Query: 60  RRKSFLETVRYGVMYFMLSILNYAFYVKLLLTFQG-----------LQPLLATVLSAVSS 108
               ++E   + V   +   +N A                      L   +  +++ V  
Sbjct: 65  DMARWMEITIFFVAALIGWFMNEAIVWTSTSWMPHDSMYSMHTRYVLWTNVGKLVATVVV 124

Query: 109 MLFVFLLYIRF 119
           M++ F++    
Sbjct: 125 MIWNFVIRKWL 135



 Score = 34.1 bits (77), Expect = 6.3,   Method: Composition-based stats.
 Identities = 15/62 (24%), Positives = 36/62 (58%), Gaps = 2/62 (3%)

Query: 61  RKSFLETVRYGVMYFMLSILNYAFYVKLLLTFQGLQPLLATVLSAVSSMLFVFLLYIRFM 120
           RK   + +++G++  +  I+++     LL+T   +  +LAT +S   S++F +L  ++F+
Sbjct: 2   RKLIEQLMKFGIVGVVAFIIDWGLMNILLMT--HMHNVLATSISFFVSLIFNYLASMKFV 59

Query: 121 TR 122
            +
Sbjct: 60  FK 61


>gi|325964105|ref|YP_004242011.1| glycosyl transferase [Arthrobacter phenanthrenivorans Sphe3]
 gi|323470192|gb|ADX73877.1| glycosyl transferase [Arthrobacter phenanthrenivorans Sphe3]
          Length = 412

 Score = 66.5 bits (161), Expect = 1e-09,   Method: Composition-based stats.
 Identities = 20/124 (16%), Positives = 44/124 (35%), Gaps = 5/124 (4%)

Query: 3   QCIIFIINIVVVFFIDVMGFFILMKCGADPFYSRIFSIAVAFLVTWIPSRLFIFLKLRR- 61
           Q I F +   V   +     F+L +       +   ++ +  +     +R F F      
Sbjct: 269 QVIRFGMVGGVST-VAFALLFLLFQGPLGAQQANFLALLLTAIGNTAANRRFTFGINGPE 327

Query: 62  KSFLETVRYGVMYFMLSILNYAFYVKLLLTFQGLQ---PLLATVLSAVSSMLFVFLLYIR 118
           K F +  +  V++ +   L  +  + L +          L+    + V + L  F+L   
Sbjct: 328 KLFTQQFQGLVVFSLAWSLTSSSLMALHVISPDASSTMELVTLTGANVLATLMRFVLLRI 387

Query: 119 FMTR 122
           ++ R
Sbjct: 388 WVFR 391


>gi|296535462|ref|ZP_06897651.1| dolichyl-phosphate beta-D-mannosyltransferase [Roseomonas
           cervicalis ATCC 49957]
 gi|296264183|gb|EFH10619.1| dolichyl-phosphate beta-D-mannosyltransferase [Roseomonas
           cervicalis ATCC 49957]
          Length = 362

 Score = 66.1 bits (160), Expect = 1e-09,   Method: Composition-based stats.
 Identities = 13/123 (10%), Positives = 42/123 (34%), Gaps = 5/123 (4%)

Query: 3   QCIIFIINIVVVFFIDVMGFFILMKCGADPFYSRIFSIAVAFLVTWIPSRLFIFLK---L 59
           + + F     +   + +    + +   +    ++  +  VA  V +  +    +      
Sbjct: 240 RFLAFAAIGGLGILVHMAVLALALGPLSFH-AAQWLASFVAMTVNFWLNNRLTYSDVRLR 298

Query: 60  RRKSFLETVRYGVMYFMLSILNYAFYVKLLLTFQGLQPLLATVLSAVSSMLFVFLLYIRF 119
             + +   + + ++  +    N      LLL  + L   LA    A  ++++ + +    
Sbjct: 299 GPRLWRGLLLFYLVCGVGVAANVGI-AGLLLRDELLNWGLAGAAGAALTVVWNYAVSATL 357

Query: 120 MTR 122
           + R
Sbjct: 358 VWR 360


>gi|138895581|ref|YP_001126034.1| hypothetical protein GTNG_1934 [Geobacillus thermodenitrificans
           NG80-2]
 gi|196249651|ref|ZP_03148348.1| GtrA family protein [Geobacillus sp. G11MC16]
 gi|134267094|gb|ABO67289.1| Conserved hypothetical protein [Geobacillus thermodenitrificans
           NG80-2]
 gi|196210945|gb|EDY05707.1| GtrA family protein [Geobacillus sp. G11MC16]
          Length = 133

 Score = 66.1 bits (160), Expect = 1e-09,   Method: Composition-based stats.
 Identities = 19/116 (16%), Positives = 44/116 (37%), Gaps = 3/116 (2%)

Query: 6   IFIINIVVVFFIDVMGFFILMKCGADPFYSRIFSIAVAFLVTWIPSRLFIFLKLRRKSFL 65
            F +       +D + FF+L   G     +++ S     + ++I +R + F   ++ +  
Sbjct: 14  RFAVVGASNTIVDFVVFFLLTAAGVPAAAAQVVSYGAGVINSYIWNRRWTFQMRQKANIG 73

Query: 66  ETVRYGVMYFMLSILNYAFYVKLLLTFQGLQPLLATVLSAVSSMLFVFLLYIRFMT 121
           E  R+ V+     +      V LL+         A   + ++ M   F+    ++ 
Sbjct: 74  ELFRFLVVN---GLSLGVSLVVLLVAEPFEPLWFAKGAATMAGMAVNFIGSRCWVF 126


>gi|124024298|ref|YP_001018605.1| glycosyl transferase [Prochlorococcus marinus str. MIT 9303]
 gi|123964584|gb|ABM79340.1| putative glycosyl transferase [Prochlorococcus marinus str. MIT
           9303]
          Length = 367

 Score = 66.1 bits (160), Expect = 1e-09,   Method: Composition-based stats.
 Identities = 18/124 (14%), Positives = 47/124 (37%), Gaps = 5/124 (4%)

Query: 2   KQCIIFIINIVVVFFIDVMGFFILMKCGADPFYSRI-FSIAVAFLVTWIPSRLFIFLKLR 60
           ++ I F +  +   F+ +   FIL    A  F S +  ++ +A    ++ + +  F   R
Sbjct: 242 RRAISFALVGLSGVFVQLFSVFILTNILAYSFQSSLPIAVILAATSNYLINNILTFRFAR 301

Query: 61  R---KSFLETVRYGVMYFMLSILNYAFYVKLLLTFQGLQPLLATVLSAVSSMLFVFLLYI 117
               K      ++ ++  +  + N                L+A +L  + +  + ++   
Sbjct: 302 LNGLKLIKGLTKFLLVSSLPFVANIGLASA-YYEHISSNELIAQLLGIIFAFTWNYVASS 360

Query: 118 RFMT 121
           +F+ 
Sbjct: 361 KFVW 364


>gi|323497070|ref|ZP_08102093.1| hypothetical protein VISI1226_16723 [Vibrio sinaloensis DSM 21326]
 gi|323317914|gb|EGA70902.1| hypothetical protein VISI1226_16723 [Vibrio sinaloensis DSM 21326]
          Length = 129

 Score = 66.1 bits (160), Expect = 2e-09,   Method: Composition-based stats.
 Identities = 22/125 (17%), Positives = 49/125 (39%), Gaps = 5/125 (4%)

Query: 3   QCIIFIINIVVVFFIDVMGFFILMK-CGADPFYSRIFSIAVAFLVTWIPSRLFIF--LKL 59
           + + F     + F +D   F + +         SR+ +   A   TW+ +R   F     
Sbjct: 2   KLLKFAFVGGIGFVVDTSIFTLCLHAFEWPLMTSRVIAFFCAATSTWLGNRYLTFSATSQ 61

Query: 60  RRKSFLETVRYGVMYFMLSILNYAFY--VKLLLTFQGLQPLLATVLSAVSSMLFVFLLYI 117
                 + +++     + +I N+  +     LL  +G    +A VL  +  M+  +LL  
Sbjct: 62  HGSKRKQWLKFMTSACISAIPNFITFKLSLELLGSEGGWAYVALVLGILVGMVSNYLLSD 121

Query: 118 RFMTR 122
           +++ +
Sbjct: 122 KWVFK 126


>gi|326203347|ref|ZP_08193212.1| GtrA family protein [Clostridium papyrosolvens DSM 2782]
 gi|325986605|gb|EGD47436.1| GtrA family protein [Clostridium papyrosolvens DSM 2782]
          Length = 137

 Score = 66.1 bits (160), Expect = 2e-09,   Method: Composition-based stats.
 Identities = 19/123 (15%), Positives = 51/123 (41%), Gaps = 2/123 (1%)

Query: 1   MKQCIIFIINIVVVFFIDVMGFFILMK-CGADPFYSRIFSIAVAFLVTWIPSRLFIFLKL 59
           + Q I + +  V+   I ++  F+L    G     +        F+ ++I ++L+ F   
Sbjct: 15  ISQMIKYGLVGVINTLITMIILFVLQNAFGVSYKLANGAGYVCGFINSFILNKLWTFKGN 74

Query: 60  RRKSFLETVRYGVMYFMLSILNYAFYVKLLLTFQGLQPLLATVLSAVSSMLFVFLLYIRF 119
           ++ +  + +R+ +++     +     +  L+    +   ++ ++  V   L  FLL   F
Sbjct: 75  QKSTLSQFIRFALVFAGCYAVQLGLVIL-LVEKIHIDKNISQLMGMVFYTLVSFLLNKMF 133

Query: 120 MTR 122
             +
Sbjct: 134 TFK 136


>gi|313144414|ref|ZP_07806607.1| predicted protein [Helicobacter cinaedi CCUG 18818]
 gi|313129445|gb|EFR47062.1| predicted protein [Helicobacter cinaedi CCUG 18818]
          Length = 149

 Score = 66.1 bits (160), Expect = 2e-09,   Method: Composition-based stats.
 Identities = 22/117 (18%), Positives = 45/117 (38%), Gaps = 2/117 (1%)

Query: 5   IIFIINIVVVFFIDVMGFFILMKCGADPFYSRIFSIAVAFLVTWIPSRLFIFLKLRRKSF 64
           I ++   VV   +     F LM  G  P  + I    V F+V+++ ++ + F        
Sbjct: 28  IKYLAVGVVNTLVGYGVIFALMWGGLMPELANIVGYGVGFIVSYLLNKRYTF-ASPASHK 86

Query: 65  LETVRYGVMYFMLSILNYAFYVKLLLTFQGLQPLLATVLSAVSSMLFVFLLYIRFMT 121
            +  R+G    +  I      +  L     + P LAT++ +   ++  F +   +  
Sbjct: 87  KDLPRFGFAMGLAYIAQLG-SMSALHRALEMNPYLATIIGSGVYVVVGFFVSRNWAF 142


>gi|169824149|ref|YP_001691760.1| putative glycosyltransferase [Finegoldia magna ATCC 29328]
 gi|167830954|dbj|BAG07870.1| putative glycosyltransferase [Finegoldia magna ATCC 29328]
          Length = 329

 Score = 66.1 bits (160), Expect = 2e-09,   Method: Composition-based stats.
 Identities = 18/123 (14%), Positives = 46/123 (37%), Gaps = 5/123 (4%)

Query: 2   KQCIIFIINIVVVFFIDVMGFFILMKCG--ADPFYSRIFSIAVAFLVTWIPSRLFIFLKL 59
           K  + F  +  + F +D   F +L           S I + AV+    +  +  ++F   
Sbjct: 210 KSILKFSTSSYLSFLVDYFTFILLFYKLDVQSLVLSNIIARAVSSTFNFYVNNKYVFKNK 269

Query: 60  RRKSFLETVRYGVMYFMLSILNYAFYVKLLLTFQGLQPLLATVLSAVSSMLFVFLLYIRF 119
            +    + ++Y  +   +  LN        L   G++  +A +++     +  + +  R 
Sbjct: 270 DK-ILKKYIKYVTLVVFILALNTVVLKI--LQALGIRVFVAKIITEALMFIVSYNIQKRI 326

Query: 120 MTR 122
           + +
Sbjct: 327 IFK 329



 Score = 36.0 bits (82), Expect = 1.9,   Method: Composition-based stats.
 Identities = 12/78 (15%), Positives = 35/78 (44%), Gaps = 1/78 (1%)

Query: 53  LFIFLKLRRKSFLETVRYGVMYFMLSILNYAFYVKLLLTFQGLQPLLATVLSAVSSMLFV 112
            F  LK   K +   +++    ++  +++Y  ++ L         +L+ +++   S  F 
Sbjct: 198 HFNALKDSAKIYKSILKFSTSSYLSFLVDYFTFILLFYKLDVQSLVLSNIIARAVSSTFN 257

Query: 113 FLLYIRFMTR-RVYFIKK 129
           F +  +++ + +   +KK
Sbjct: 258 FYVNNKYVFKNKDKILKK 275


>gi|305664314|ref|YP_003860602.1| Dolichyl-phosphate beta-D-mannosyltransferase [Ignisphaera
           aggregans DSM 17230]
 gi|304378883|gb|ADM28722.1| Dolichyl-phosphate beta-D-mannosyltransferase [Ignisphaera
           aggregans DSM 17230]
          Length = 359

 Score = 66.1 bits (160), Expect = 2e-09,   Method: Composition-based stats.
 Identities = 13/125 (10%), Positives = 42/125 (33%), Gaps = 7/125 (5%)

Query: 5   IIFIINIVVVFFIDVMGFFILMK-----CGADPFYSRIFSIAVAFLVTWIPSRLFIFLKL 59
           + F +   +   +++     L +              + +I ++ L  +    L+ F   
Sbjct: 232 VKFGVVGALGMLVNLGVIEFLRRTYSYLVQRYFVVGSLLAIEISTLFNFTLHELWTFRDR 291

Query: 60  RRKS-FLETVRYGVMYFMLSILNYAFYVKLLLTFQGLQPLLATVLSAVSSMLFVFLLYIR 118
           R  + F+  + +        +  +     +L     + PL++  +  +      ++L   
Sbjct: 292 RGGNMFIRLLLFHTTILPSILSQF-IASNILFYAFSIDPLISQFIGILIGFPINYILSEL 350

Query: 119 FMTRR 123
            + R+
Sbjct: 351 GIWRK 355


>gi|116671102|ref|YP_832035.1| GtrA family protein [Arthrobacter sp. FB24]
 gi|116611211|gb|ABK03935.1| GtrA family protein [Arthrobacter sp. FB24]
          Length = 168

 Score = 66.1 bits (160), Expect = 2e-09,   Method: Composition-based stats.
 Identities = 17/127 (13%), Positives = 40/127 (31%), Gaps = 5/127 (3%)

Query: 1   MKQCIIFIINIVVVFFIDVMGFFILMKCGADPFYSRIFSIAVAFLVTWIPSRLFIFLKLR 60
           ++Q + F    +V     +  + +L         +   ++ +  ++    +R   F    
Sbjct: 39  VRQLLRFTGVGIVCTLTSLALYALLRPW-LGSQLANAAALIITSVMNTALNRRLTFKIAG 97

Query: 61  RKS----FLETVRYGVMYFMLSILNYAFYVKLLLTFQGLQPLLATVLSAVSSMLFVFLLY 116
                   L  +   V+  +++  +      L         L  T LS   +    F L 
Sbjct: 98  PGKMGRDHLSGLVVIVIALVITGGSLGVLHWLNPDATMSDELWTTTLSGFLATAVRFALL 157

Query: 117 IRFMTRR 123
             ++ RR
Sbjct: 158 RHWIFRR 164


>gi|312199906|ref|YP_004019967.1| GtrA family protein [Frankia sp. EuI1c]
 gi|311231242|gb|ADP84097.1| GtrA family protein [Frankia sp. EuI1c]
          Length = 166

 Score = 66.1 bits (160), Expect = 2e-09,   Method: Composition-based stats.
 Identities = 20/127 (15%), Positives = 44/127 (34%), Gaps = 6/127 (4%)

Query: 1   MKQCIIFIINIVVVFFIDVMGFFILM-KCGADPFYSRIFSIAVAFLVTWIPSRLFIFLKL 59
           +++   F +   V + +D +   +   +   D   ++  S  +A  V +I +R + F   
Sbjct: 14  IREVGKFGVVGAVAYVVDFVVSNVCHVQFHMDWLLAKTISTVIAATVAYIGNRQWSFTHR 73

Query: 60  RRKS-FLETVRYGVMYFMLSILNYAFY----VKLLLTFQGLQPLLATVLSAVSSMLFVFL 114
            R     E   + ++  +   +           L L       +   VL      +F F 
Sbjct: 74  ARSGVRREYTIFFILNVIGLGIALGCLGFGEYVLHLKGALAFNVFGNVLGTGLGTVFRFW 133

Query: 115 LYIRFMT 121
            Y R++ 
Sbjct: 134 AYKRWVF 140


>gi|68537139|ref|YP_251844.1| hypothetical protein jk2044 [Corynebacterium jeikeium K411]
 gi|68264738|emb|CAI38226.1| putative membrane protein [Corynebacterium jeikeium K411]
          Length = 238

 Score = 66.1 bits (160), Expect = 2e-09,   Method: Composition-based stats.
 Identities = 15/159 (9%), Positives = 42/159 (26%), Gaps = 38/159 (23%)

Query: 2   KQCIIFIINIVVVFFIDVMGFFILMKCGA----------------------DPFYSRIFS 39
           +Q I F +     F ++   F +  K                               + +
Sbjct: 49  RQFIQFGLVGASGFVVNQAIFVLSKKLAEAGWDIHVQDAFLNLLGTQYHFRWYHVFSVIA 108

Query: 40  IAVAFLVTWIPSRLFIFLK-LRRKSFLETVRYGVMYFMLSILNYAFYVKLLL-------- 90
             +A +  +  +R + F    +R  + +  ++  +     ++       L+         
Sbjct: 109 FLLANIWNFCLNRYWTFRHEPKRAWWKQLPQFMAVGVFGLLITLVVSTALVNPESPIALP 168

Query: 91  -------TFQGLQPLLATVLSAVSSMLFVFLLYIRFMTR 122
                  T    +      +  + ++   FL    +  R
Sbjct: 169 HDIFDNSTGLRTRAYWGNFIGVILAVPANFLFNKLWTFR 207



 Score = 34.9 bits (79), Expect = 4.3,   Method: Composition-based stats.
 Identities = 10/81 (12%), Positives = 25/81 (30%), Gaps = 17/81 (20%)

Query: 2   KQCIIFIINIVVVFFIDVMGFFILMK-----------------CGADPFYSRIFSIAVAF 44
           KQ   F+   V    I ++    L+                       ++     + +A 
Sbjct: 135 KQLPQFMAVGVFGLLITLVVSTALVNPESPIALPHDIFDNSTGLRTRAYWGNFIGVILAV 194

Query: 45  LVTWIPSRLFIFLKLRRKSFL 65
              ++ ++L+ F    R++  
Sbjct: 195 PANFLFNKLWTFRSAPREASR 215


>gi|163814851|ref|ZP_02206239.1| hypothetical protein COPEUT_01001 [Coprococcus eutactus ATCC 27759]
 gi|158449790|gb|EDP26785.1| hypothetical protein COPEUT_01001 [Coprococcus eutactus ATCC 27759]
          Length = 1086

 Score = 66.1 bits (160), Expect = 2e-09,   Method: Composition-based stats.
 Identities = 19/127 (14%), Positives = 52/127 (40%), Gaps = 6/127 (4%)

Query: 2   KQCIIFIINIVVVFFIDVMGFFILMKCGA-DPFYSRIFSIAVAFLVTWIPSRLFIFLKLR 60
           K+ + ++I   +   ++++ FF+L          + + +I +A L  +  +  ++F   +
Sbjct: 21  KEMVRYVIAGGMTTAVNLVSFFVLRLVTDLTRSEANVIAIMLAILFAYFANGFYVFRSEQ 80

Query: 61  RKS----FLETVRYGVMYFMLSILNYAFYVKLLLTFQGLQPLLATVLSAVSSMLFVFLLY 116
           RK       E V +  M     I+       LL        L++ ++  +  ++  ++  
Sbjct: 81  RKRVGEIVREFVSFVGMRLFAMIVE-VVGTNLLCDSFRYNELVSKIVVQLVVLVINYIFS 139

Query: 117 IRFMTRR 123
             F+ ++
Sbjct: 140 KCFVFKK 146


>gi|332639028|ref|ZP_08417891.1| glycosyltransferase [Weissella cibaria KACC 11862]
          Length = 359

 Score = 66.1 bits (160), Expect = 2e-09,   Method: Composition-based stats.
 Identities = 15/128 (11%), Positives = 51/128 (39%), Gaps = 10/128 (7%)

Query: 2   KQCIIFIINIVVVFFIDVMGFFILMKCGADP------FYSRIFSIAVAFLVTWIPSRLFI 55
           ++ + F ++ +    +DV+ F +L+              + + +  V+ +V +  ++ ++
Sbjct: 228 RRFLKFGLSSLTSAGVDVLLFALLLMTVFHNASTGTLLLASVLARLVSGVVNFSLNQRWV 287

Query: 56  FLKLRRKSFLETVRYGVMYFMLSILNYAFYVKLLLTFQGLQPLLATVLSAVSSMLFVFLL 115
           F            RY +++ +  IL+      +        P+   ++  V   +  +L+
Sbjct: 288 FRSQNVAGDRR--RYLILFSVQMILSAVLLQLVDTVIP--HPIPVKIMVDVIIFIGSYLI 343

Query: 116 YIRFMTRR 123
             + + ++
Sbjct: 344 QKQLVFKQ 351



 Score = 36.0 bits (82), Expect = 1.9,   Method: Composition-based stats.
 Identities = 15/74 (20%), Positives = 33/74 (44%), Gaps = 4/74 (5%)

Query: 53  LFIFLKLRRKSFLETVRYGVMYFMLSILNYAFYVKLLLTFQGLQ----PLLATVLSAVSS 108
            F  ++     +   +++G+     + ++   +  LL+T          LLA+VL+ + S
Sbjct: 216 HFHPVRDSLLVYRRFLKFGLSSLTSAGVDVLLFALLLMTVFHNASTGTLLLASVLARLVS 275

Query: 109 MLFVFLLYIRFMTR 122
            +  F L  R++ R
Sbjct: 276 GVVNFSLNQRWVFR 289


>gi|256375855|ref|YP_003099515.1| glycosyl transferase family 2 [Actinosynnema mirum DSM 43827]
 gi|255920158|gb|ACU35669.1| glycosyl transferase family 2 [Actinosynnema mirum DSM 43827]
          Length = 424

 Score = 65.7 bits (159), Expect = 2e-09,   Method: Composition-based stats.
 Identities = 18/125 (14%), Positives = 45/125 (36%), Gaps = 4/125 (3%)

Query: 1   MKQCIIFIINIVVVFFIDVMGFFILMKCGADPFYSRIFSIAVAFLVTWIPSRLFIFLKLR 60
           ++Q + F +  V       +  F L++ G    ++ + ++ V  +     +R F F    
Sbjct: 282 LRQLVRFAVVGVASTLA-YLLLFALLRDGVGAQWANLVALLVTAVANTSVNRRFTFGVRG 340

Query: 61  RKSFLET-VRYGVMYFMLSILNYAFYVKLL--LTFQGLQPLLATVLSAVSSMLFVFLLYI 117
           ++      +   +++ +                   G   L+A V   + + +  FLL  
Sbjct: 341 KRGAGRHQLEGLLVFALGLAFTGGALALAHGVADPGGHAELVAVVGGNLLATVARFLLLR 400

Query: 118 RFMTR 122
            ++ R
Sbjct: 401 NWVFR 405


>gi|254295554|ref|YP_003061576.1| GtrA family protein [Hirschia baltica ATCC 49814]
 gi|254044085|gb|ACT60879.1| GtrA family protein [Hirschia baltica ATCC 49814]
          Length = 157

 Score = 65.7 bits (159), Expect = 2e-09,   Method: Composition-based stats.
 Identities = 19/124 (15%), Positives = 48/124 (38%), Gaps = 4/124 (3%)

Query: 1   MKQCIIFIINIVVVFFIDVMGFFILMKCGADPFYSRIFSIAVAFLVTWIPSRLFIFLKLR 60
           + Q I F +  +    ID+  + +L+  G + + ++ F+  V  +  ++ ++ + F    
Sbjct: 26  VHQIIKFGLTGMANVGIDLSVYILLLHLGLEIWLAKTFAFIVGTIFAYLVNKKWTFNDAS 85

Query: 61  RKSFLETVRYGVMYFMLSILNYAF--YVKLLLTFQGLQPLLATVLSAVSSMLFVFLLYIR 118
                    + + Y    I+N     +   +L       ++A + + + S    FL    
Sbjct: 86  GSHRKIFAVFTL-YIFAMIINVGLNSFCISILGDNLAGKIIAYIFAVIPSAAVNFLGMKY 144

Query: 119 FMTR 122
            + R
Sbjct: 145 -IFR 147


>gi|311898338|dbj|BAJ30746.1| hypothetical protein KSE_49680 [Kitasatospora setae KM-6054]
          Length = 180

 Score = 65.7 bits (159), Expect = 2e-09,   Method: Composition-based stats.
 Identities = 18/134 (13%), Positives = 48/134 (35%), Gaps = 16/134 (11%)

Query: 2   KQCIIFIINIVVVFFIDVMGFFIL--MKCGADPFYSRIFSIAVAFLVTWIPSRLFIFLKL 59
           +  + F++     F + ++  F L      + P  +   +  +  +++++ +R + F  +
Sbjct: 24  RTLVKFLVVGGTCFLLTMVINFALKTTVLESKPVVALTIATVITTVISYVLNRKWSFRAV 83

Query: 60  RRKSFLETVRYGVMYFMLSILNYAFYVKLLLTF------------QGLQPLLATVLSAVS 107
            RK   E   + ++  +   +N    V     F            +        ++  + 
Sbjct: 84  GRK--REAAGFFLVSALAVGVNDLPLVASRYVFDFRTPDVSHFSQELADFFSGMIVGTLL 141

Query: 108 SMLFVFLLYIRFMT 121
           +M F F    RF+ 
Sbjct: 142 AMAFRFWAMNRFVF 155



 Score = 37.6 bits (86), Expect = 0.55,   Method: Composition-based stats.
 Identities = 11/61 (18%), Positives = 26/61 (42%)

Query: 64  FLETVRYGVMYFMLSILNYAFYVKLLLTFQGLQPLLATVLSAVSSMLFVFLLYIRFMTRR 123
               V++ V+     +L       L  T    +P++A  ++ V + +  ++L  ++  R 
Sbjct: 23  HRTLVKFLVVGGTCFLLTMVINFALKTTVLESKPVVALTIATVITTVISYVLNRKWSFRA 82

Query: 124 V 124
           V
Sbjct: 83  V 83


>gi|111023261|ref|YP_706233.1| hypothetical protein RHA1_ro06298 [Rhodococcus jostii RHA1]
 gi|110822791|gb|ABG98075.1| possible membrane protein [Rhodococcus jostii RHA1]
          Length = 193

 Score = 65.7 bits (159), Expect = 2e-09,   Method: Composition-based stats.
 Identities = 24/134 (17%), Positives = 49/134 (36%), Gaps = 15/134 (11%)

Query: 3   QCIIFIINIVVVFFIDVMGFFIL--MKCGADPFYSRIFSIAVAFLVTWIPSRLFIFLKL- 59
           + I F I        D+  F+ L        P  +++ S  +A ++++I +R + F    
Sbjct: 36  ELIKFAIVGGTTMIFDLAIFYSLSLTILEEKPVVAKVLSGILATVLSYILNREWSFKNRG 95

Query: 60  RRKSFLETVRYGVMYFMLSILNYAFYVK------------LLLTFQGLQPLLATVLSAVS 107
            R+   E + +  +  +  +L  A                 L T   +  +L  ++  + 
Sbjct: 96  GRERHHEALLFFTISGIGVLLAAAPLWIANNVFDIRASQENLTTLVVVDFVLNYIIGNLL 155

Query: 108 SMLFVFLLYIRFMT 121
            M+F F    RF  
Sbjct: 156 QMVFRFWALRRFAF 169



 Score = 37.6 bits (86), Expect = 0.56,   Method: Composition-based stats.
 Identities = 12/60 (20%), Positives = 29/60 (48%)

Query: 63  SFLETVRYGVMYFMLSILNYAFYVKLLLTFQGLQPLLATVLSAVSSMLFVFLLYIRFMTR 122
              E +++ ++     I + A +  L LT    +P++A VLS + + +  ++L   +  +
Sbjct: 33  RHHELIKFAIVGGTTMIFDLAIFYSLSLTILEEKPVVAKVLSGILATVLSYILNREWSFK 92


>gi|322384908|ref|ZP_08058564.1| hypothetical protein PL1_1733 [Paenibacillus larvae subsp. larvae
           B-3650]
 gi|321150205|gb|EFX43712.1| hypothetical protein PL1_1733 [Paenibacillus larvae subsp. larvae
           B-3650]
          Length = 131

 Score = 65.7 bits (159), Expect = 2e-09,   Method: Composition-based stats.
 Identities = 17/117 (14%), Positives = 48/117 (41%), Gaps = 2/117 (1%)

Query: 7   FIINIVVVFFIDVMGFFILMKC-GADPFYSRIFSIAVAFLVTWIPSRLFIFLKLRRKSFL 65
           F +  ++   ID   F+      G     ++  + A   + +++ ++ + F    + + +
Sbjct: 3   FALVGIMNTLIDWGIFWFTYSLAGMHYLVAQTLAYACGMINSYVLNKSWTFKVKNKANPV 62

Query: 66  ETVRYGVMYFMLSILNYAFYVKLLLTFQGLQPLLATVLSAVSSMLFVFLLYIRFMTR 122
           ET ++  +  +   L+Y        +F G   L+   +     M+  +LL  +++ +
Sbjct: 63  ETGKFLAVNLICLCLSYLLLYGWN-SFVGEYMLIGKAVVTAVLMVLNYLLNKQWVFK 118


>gi|295094190|emb|CBK83281.1| GtrA-like protein./Bacterial membrane protein YfhO. [Coprococcus
           sp. ART55/1]
          Length = 1015

 Score = 65.7 bits (159), Expect = 2e-09,   Method: Composition-based stats.
 Identities = 19/127 (14%), Positives = 52/127 (40%), Gaps = 6/127 (4%)

Query: 2   KQCIIFIINIVVVFFIDVMGFFILMKCGA-DPFYSRIFSIAVAFLVTWIPSRLFIFLKLR 60
           K+ + ++I   +   ++++ FF+L          + I +I +A L  +  +  ++F   +
Sbjct: 14  KEMVRYVIAGGMTTAVNLVSFFVLRLVTDLSRSAANIIAIMLAILFAYFANGFYVFRSEQ 73

Query: 61  RKS----FLETVRYGVMYFMLSILNYAFYVKLLLTFQGLQPLLATVLSAVSSMLFVFLLY 116
           RKS      E + +  M     ++       LL         ++ ++  V  ++  ++  
Sbjct: 74  RKSVGRIIREFISFVGMRLFAMVVE-VVGTNLLCDSFRYNEFISKIIIQVVVLVINYIFS 132

Query: 117 IRFMTRR 123
             F+ ++
Sbjct: 133 KCFVFKK 139


>gi|258541880|ref|YP_003187313.1| hypothetical protein APA01_07850 [Acetobacter pasteurianus IFO
           3283-01]
 gi|256632958|dbj|BAH98933.1| hypothetical protein [Acetobacter pasteurianus IFO 3283-01]
 gi|256636015|dbj|BAI01984.1| hypothetical protein [Acetobacter pasteurianus IFO 3283-03]
 gi|256639070|dbj|BAI05032.1| hypothetical protein [Acetobacter pasteurianus IFO 3283-07]
 gi|256642124|dbj|BAI08079.1| hypothetical protein [Acetobacter pasteurianus IFO 3283-22]
 gi|256645179|dbj|BAI11127.1| hypothetical protein [Acetobacter pasteurianus IFO 3283-26]
 gi|256648234|dbj|BAI14175.1| hypothetical protein [Acetobacter pasteurianus IFO 3283-32]
 gi|256651287|dbj|BAI17221.1| hypothetical protein [Acetobacter pasteurianus IFO 3283-01-42C]
 gi|256654278|dbj|BAI20205.1| hypothetical protein [Acetobacter pasteurianus IFO 3283-12]
          Length = 167

 Score = 65.7 bits (159), Expect = 2e-09,   Method: Composition-based stats.
 Identities = 23/124 (18%), Positives = 45/124 (36%), Gaps = 5/124 (4%)

Query: 3   QCIIFIINIVVVFFIDVMGFFILMKCGADPFYSRIFSIAVAFLVTWIPSRLFIFLKLRRK 62
           + I F +   + F  D    + L         + + +  VA  + W+ +R++ F      
Sbjct: 17  RLIKFGMVGSLGFLWDSGTVYALRPL-IGLTAATLVAYFVAATLNWVFNRIWTFKGAGHH 75

Query: 63  SF--LETVRYGVMYFMLSILNYAFYVKLLLTFQGL--QPLLATVLSAVSSMLFVFLLYIR 118
               L+ +R+     +   LN      L   F      P++A    A + ML  F +  +
Sbjct: 76  EHPVLQWLRFLSANSLGFFLNRGTVYLLFYIFPFCMQHPIIALAAGAGAGMLANFSMSQK 135

Query: 119 FMTR 122
            + R
Sbjct: 136 IVFR 139


>gi|114767514|ref|ZP_01446287.1| hypothetical protein 1100011001237_R2601_19482 [Pelagibaca
           bermudensis HTCC2601]
 gi|114540410|gb|EAU43495.1| hypothetical protein R2601_19482 [Roseovarius sp. HTCC2601]
          Length = 156

 Score = 65.7 bits (159), Expect = 2e-09,   Method: Composition-based stats.
 Identities = 33/123 (26%), Positives = 49/123 (39%), Gaps = 2/123 (1%)

Query: 2   KQCIIFIINIVVVFFIDVMGFFILMKCGADPFYSRIFSIAVAFLVTWIPSRLFIFLKLRR 61
           +    F +  +  F ID      L+  G  P  +R+ S   A L TW  +R   F    R
Sbjct: 34  RHLGGFALAGLAGFGIDAGVLSALLGLGLSPGLARVPSFVAAVLTTWAINRTMTFRTSTR 93

Query: 62  KSFLETVRYGVMYFMLSILNYA--FYVKLLLTFQGLQPLLATVLSAVSSMLFVFLLYIRF 119
            S  E +RY +   +   +NYA       L      QP+LA V +  + M+  FL     
Sbjct: 94  ASLGEFLRYILAMGLGLAINYATFLLALRLSEAAAAQPVLALVPATAAGMVVNFLSSRHI 153

Query: 120 MTR 122
           + R
Sbjct: 154 LHR 156


>gi|91786374|ref|YP_547326.1| GtrA-like protein [Polaromonas sp. JS666]
 gi|91695599|gb|ABE42428.1| GtrA-like protein [Polaromonas sp. JS666]
          Length = 176

 Score = 65.7 bits (159), Expect = 2e-09,   Method: Composition-based stats.
 Identities = 19/130 (14%), Positives = 42/130 (32%), Gaps = 9/130 (6%)

Query: 3   QCIIFIINIVVVFFIDVMGFFILMKCGADPFY--------SRIFSIAVAFLVTWIPSRLF 54
           + I F         I++   ++  +               S   +I  A +  +  +R  
Sbjct: 26  RFIKFGAVGASGTVINIAVLYVAQEFLLTFIADFHSRLNYSIALAITCATISNFYWNRRL 85

Query: 55  IFLKLRRKSFLETVRYGVMYFMLSILNYAFYVKLLLTFQG-LQPLLATVLSAVSSMLFVF 113
            +   + +     +     Y M + L+      L       L  +LA +++ V + +  F
Sbjct: 86  TWRDRKHEVHHSALFLFFKYVMAAGLSIVVQSLLTKWLAIYLHYILANLVAIVVASVCNF 145

Query: 114 LLYIRFMTRR 123
           +   R   RR
Sbjct: 146 VANDRMTFRR 155



 Score = 34.5 bits (78), Expect = 4.9,   Method: Composition-based stats.
 Identities = 5/58 (8%), Positives = 20/58 (34%), Gaps = 1/58 (1%)

Query: 4   CIIFIINIVVVFFIDVMGFFILMKCGADPFYSRIFSIAVAFLVTWIPSRLFIFLKLRR 61
              +++   +   +  +    L         + + +I VA +  ++ +    F +  +
Sbjct: 102 FFKYVMAAGLSIVVQSLLTKWL-AIYLHYILANLVAIVVASVCNFVANDRMTFRRRAK 158


>gi|154151140|ref|YP_001404758.1| GtrA family protein [Candidatus Methanoregula boonei 6A8]
 gi|153999692|gb|ABS56115.1| GtrA family protein [Methanoregula boonei 6A8]
          Length = 155

 Score = 65.7 bits (159), Expect = 2e-09,   Method: Composition-based stats.
 Identities = 14/116 (12%), Positives = 40/116 (34%), Gaps = 2/116 (1%)

Query: 7   FIINIVVVFFIDVMGFFILM-KCGADPFYSRIFSIAVAFLVTWIPSRLFIFLKLRRKSFL 65
           F++  ++   +D+   + L          S   S +   ++ ++ ++   F    R    
Sbjct: 25  FVVIGIISTILDLGLLYGLTEYFHIWYLLSATVSYSCGMVLNFLLNKFLNFQDTSRHYLW 84

Query: 66  ETVRYGVMYFMLSILNYAFYVKLLLTFQGLQPLLATVLSAVSSMLFVFLLYIRFMT 121
           + V + ++      L         +       L+A +++ + S  + +L   R   
Sbjct: 85  QFVTFALISSTGLALTLGVLYIA-VEIFSQNYLVAKLIAIILSFAWNYLGQSRITF 139


>gi|119717727|ref|YP_924692.1| GtrA family protein [Nocardioides sp. JS614]
 gi|119538388|gb|ABL83005.1| GtrA family protein [Nocardioides sp. JS614]
          Length = 192

 Score = 65.7 bits (159), Expect = 2e-09,   Method: Composition-based stats.
 Identities = 17/136 (12%), Positives = 43/136 (31%), Gaps = 14/136 (10%)

Query: 3   QCIIFIINIVVVFFIDVMGFFILMK---------CGADPFYSRIFSIAVAFLVTWIPSRL 53
           +   F+    +   +  + F  L+              P+   + +  V   +++  SR 
Sbjct: 11  EAYRFLAVGGIATIVAFVIFNFLVHGFNTEHQALLDGQPYLGYVIANTVGMTISYRGSRT 70

Query: 54  FIFLKLRRKSFLET-VRYGVMYFMLSILNYAFYVKLL----LTFQGLQPLLATVLSAVSS 108
           ++F     +S       +  +  +  +L  A          L       + A V+     
Sbjct: 71  WVFKHRPPRSADGGRTAFIAINVVTMLLPIACLWLSRDVLGLDDPWSDNISANVIGLFFG 130

Query: 109 MLFVFLLYIRFMTRRV 124
           ++  F L+   + +R 
Sbjct: 131 LVARFYLFRTLVFKRP 146


>gi|308050544|ref|YP_003914110.1| GtrA family protein [Ferrimonas balearica DSM 9799]
 gi|307632734|gb|ADN77036.1| GtrA family protein [Ferrimonas balearica DSM 9799]
          Length = 133

 Score = 65.7 bits (159), Expect = 2e-09,   Method: Composition-based stats.
 Identities = 25/125 (20%), Positives = 50/125 (40%), Gaps = 4/125 (3%)

Query: 1   MKQCIIFIINIVVVFFIDVMGFFILMK-CGADPFYSRIFSIAVAFLVTWIPSRLFIFLKL 59
           MK+   F +   + F +D + F +L +  G     +R  +   A   TW+ +R   F   
Sbjct: 1   MKRFARFALIGALGFAVDSLCFALLWQGLGWPLQLARGVAFVAAASTTWLGNRWLTFADR 60

Query: 60  RRKS-FLETVRYGVMYFMLSILNYAFY--VKLLLTFQGLQPLLATVLSAVSSMLFVFLLY 116
             +  + +  R      + ++ N   +    +LL  QGL P +A V   ++ M   +   
Sbjct: 61  PSQPCWHQWRRALASALVAAVPNLGVFQLFLMLLGHQGLAPYVALVGGILAGMGVNYFAS 120

Query: 117 IRFMT 121
             ++ 
Sbjct: 121 QTWVF 125


>gi|119025189|ref|YP_909034.1| hypothetical protein BAD_0171 [Bifidobacterium adolescentis ATCC
           15703]
 gi|118764773|dbj|BAF38952.1| narrowly conserved hypothetical membrane protein [Bifidobacterium
           adolescentis ATCC 15703]
          Length = 186

 Score = 65.7 bits (159), Expect = 2e-09,   Method: Composition-based stats.
 Identities = 19/132 (14%), Positives = 44/132 (33%), Gaps = 13/132 (9%)

Query: 1   MKQCIIFIINIVVVFFIDVMGFFILM-KCGADPFYSRIFSIAVAFLVTWIPSRLFIFLKL 59
           ++Q + F I  V+ F ID     IL+         +   S  ++ +  ++ S   +F   
Sbjct: 5   IEQLMKFGIVGVIAFIIDWGILNILVGAFHMHNVLAATISFIISLIFNYVASMKMVFKHR 64

Query: 60  -RRKSFLETVRYGVMYFMLSILNYAFYVKLLLTFQGLQPL-----------LATVLSAVS 107
                ++E V + V   +   +N A              +           +  +++   
Sbjct: 65  EDMARWMEIVIFVVGAVIGLFMNDAIIWISTYGMNHDAYVSQSAEYLIRTNVGKLIATAV 124

Query: 108 SMLFVFLLYIRF 119
            M++ F+     
Sbjct: 125 VMVWNFVTRKWL 136



 Score = 34.9 bits (79), Expect = 3.4,   Method: Composition-based stats.
 Identities = 10/62 (16%), Positives = 33/62 (53%), Gaps = 1/62 (1%)

Query: 61  RKSFLETVRYGVMYFMLSILNYAFYVKLLLTFQGLQPLLATVLSAVSSMLFVFLLYIRFM 120
           RK   + +++G++  +  I+++      L+    +  +LA  +S + S++F ++  ++ +
Sbjct: 2   RKLIEQLMKFGIVGVIAFIIDWGILNI-LVGAFHMHNVLAATISFIISLIFNYVASMKMV 60

Query: 121 TR 122
            +
Sbjct: 61  FK 62


>gi|320095238|ref|ZP_08026936.1| hypothetical protein HMPREF9005_1548 [Actinomyces sp. oral taxon
           178 str. F0338]
 gi|319977822|gb|EFW09467.1| hypothetical protein HMPREF9005_1548 [Actinomyces sp. oral taxon
           178 str. F0338]
          Length = 183

 Score = 65.7 bits (159), Expect = 2e-09,   Method: Composition-based stats.
 Identities = 19/131 (14%), Positives = 40/131 (30%), Gaps = 10/131 (7%)

Query: 1   MKQCIIFIINIVVVFFIDVMGFFILMK-----CGADPFYSRIFSIAVAFLVTWIPSRLFI 55
           +++ I F +     F +D   F +L           P  ++  + A A L  W+ +RL+ 
Sbjct: 49  IREFIQFGMVGATAFVVDWGLFNLLQHGPLGLLAGHPNTAQFCAAATATLYAWVANRLWT 108

Query: 56  FLKLRRKSF-LETVRYGVMYFMLSILNYAFYVKLLLTF----QGLQPLLATVLSAVSSML 110
           +    R     E + +         ++    +               +   V+       
Sbjct: 109 YRGRTRARASREALLFFFANACGIGISQFCLLFTHHILGLASALADNVAVYVVGFALGTA 168

Query: 111 FVFLLYIRFMT 121
           F F  Y   + 
Sbjct: 169 FRFFFYHYVVF 179


>gi|296392772|ref|YP_003657656.1| GtrA family protein [Segniliparus rotundus DSM 44985]
 gi|296179919|gb|ADG96825.1| GtrA family protein [Segniliparus rotundus DSM 44985]
          Length = 153

 Score = 65.3 bits (158), Expect = 2e-09,   Method: Composition-based stats.
 Identities = 23/126 (18%), Positives = 44/126 (34%), Gaps = 8/126 (6%)

Query: 3   QCIIFIINIVVVFFIDVMGFFILMKCGADPFYSRIFSIAVAFLVTWIPSRLFIFLKLRRK 62
           Q + F++  V    +D      L + GA P  + I    V   V ++ +R + F      
Sbjct: 12  QALRFLVTGVFSAVVDYGLVMALSQLGAAPNAANIVGFVVGTTVAYLINRRWTFQA--EP 69

Query: 63  SFLETVRYGVMYFMLSILNYAFYVKLLLTFQGL------QPLLATVLSAVSSMLFVFLLY 116
           S     +  ++Y    +L    +   L   +            A VL+  +  +  FL+ 
Sbjct: 70  SAKRFAQVALLYTAAFLLRAGIFAGALALARSWEVSKFLAESGAWVLAQGTVTVMNFLVQ 129

Query: 117 IRFMTR 122
              + R
Sbjct: 130 RMVIFR 135



 Score = 34.1 bits (77), Expect = 6.3,   Method: Composition-based stats.
 Identities = 11/72 (15%), Positives = 27/72 (37%), Gaps = 2/72 (2%)

Query: 58  KLRRKSFLETVRYGVMYFMLSILNYAFYVKLLLTFQGLQPLLATVLSAVSSMLFVFLLYI 117
                   + +R+ V     ++++Y   +   L+  G  P  A ++  V      +L+  
Sbjct: 4   DSTAGLRTQALRFLVTGVFSAVVDYGLVMA--LSQLGAAPNAANIVGFVVGTTVAYLINR 61

Query: 118 RFMTRRVYFIKK 129
           R+  +     K+
Sbjct: 62  RWTFQAEPSAKR 73


>gi|54022162|ref|YP_116404.1| hypothetical protein nfa1980 [Nocardia farcinica IFM 10152]
 gi|54013670|dbj|BAD55040.1| hypothetical protein [Nocardia farcinica IFM 10152]
          Length = 154

 Score = 65.3 bits (158), Expect = 2e-09,   Method: Composition-based stats.
 Identities = 15/121 (12%), Positives = 40/121 (33%), Gaps = 1/121 (0%)

Query: 3   QCIIFIINIVVVFFIDVMGF-FILMKCGADPFYSRIFSIAVAFLVTWIPSRLFIFLKLRR 61
           Q I F +       +D   + F+L   G     ++           ++ +R + F     
Sbjct: 32  QIIRFTVTGGFSAIVDFGLYVFLLKVVGLPVPVAKSIGFVAGTTTAYLINRRWTFQAPPS 91

Query: 62  KSFLETVRYGVMYFMLSILNYAFYVKLLLTFQGLQPLLATVLSAVSSMLFVFLLYIRFMT 121
           ++    V           +     +  LL    +   +A V++  ++ +  F++    + 
Sbjct: 92  RARFLAVVALYATTFAVQVGINQLMVHLLGEDPVPVAVAFVVAQGTATVINFVVQRLVIF 151

Query: 122 R 122
           +
Sbjct: 152 K 152


>gi|297587570|ref|ZP_06946214.1| dolichyl-phosphate mannose synthase [Finegoldia magna ATCC 53516]
 gi|297574259|gb|EFH92979.1| dolichyl-phosphate mannose synthase [Finegoldia magna ATCC 53516]
          Length = 329

 Score = 65.3 bits (158), Expect = 2e-09,   Method: Composition-based stats.
 Identities = 18/123 (14%), Positives = 48/123 (39%), Gaps = 5/123 (4%)

Query: 2   KQCIIFIINIVVVFFIDVMGFFILMKCG--ADPFYSRIFSIAVAFLVTWIPSRLFIFLKL 59
           K  + F  +  + F +D   F +L+          S I + AV+    +  +  ++F   
Sbjct: 210 KSILKFSASSYLSFLVDYFTFLLLVYKLNVQSLVLSNIIARAVSSTFNFYVNNKYVFKNK 269

Query: 60  RRKSFLETVRYGVMYFMLSILNYAFYVKLLLTFQGLQPLLATVLSAVSSMLFVFLLYIRF 119
            +    + ++Y  +   +  LN        L+  G++  +A +++     +  + +  R 
Sbjct: 270 DK-ILKKYIKYVTLVVFILALNTIVLKI--LSSLGIKVFVAKIITEALMFIVSYNIQKRI 326

Query: 120 MTR 122
           + +
Sbjct: 327 IFK 329



 Score = 36.0 bits (82), Expect = 1.5,   Method: Composition-based stats.
 Identities = 12/78 (15%), Positives = 36/78 (46%), Gaps = 1/78 (1%)

Query: 53  LFIFLKLRRKSFLETVRYGVMYFMLSILNYAFYVKLLLTFQGLQPLLATVLSAVSSMLFV 112
            F  LK   K +   +++    ++  +++Y  ++ L+        +L+ +++   S  F 
Sbjct: 198 HFNALKDSVKIYKSILKFSASSYLSFLVDYFTFLLLVYKLNVQSLVLSNIIARAVSSTFN 257

Query: 113 FLLYIRFMTR-RVYFIKK 129
           F +  +++ + +   +KK
Sbjct: 258 FYVNNKYVFKNKDKILKK 275


>gi|209551848|ref|YP_002283765.1| GtrA family protein [Rhizobium leguminosarum bv. trifolii WSM2304]
 gi|209537604|gb|ACI57539.1| GtrA family protein [Rhizobium leguminosarum bv. trifolii WSM2304]
          Length = 125

 Score = 65.3 bits (158), Expect = 3e-09,   Method: Composition-based stats.
 Identities = 43/123 (34%), Positives = 66/123 (53%), Gaps = 1/123 (0%)

Query: 1   MKQCIIFIINIVVVFFIDVMGFFILMKCGA-DPFYSRIFSIAVAFLVTWIPSRLFIFLKL 59
           MK+ + F I   + F +D      L+      PF +R+ +IA+A   TW  +R F F + 
Sbjct: 1   MKKLVRFAIAGGIGFLVDAGVLSALLHLTPLGPFLARLVAIALAMAATWAFNRSFTFDRS 60

Query: 60  RRKSFLETVRYGVMYFMLSILNYAFYVKLLLTFQGLQPLLATVLSAVSSMLFVFLLYIRF 119
            R    E  RYG +    +++NY  Y  LLL+   LQPL A V+++++SM+F F  Y RF
Sbjct: 61  GRSLASEGFRYGSVGVTAALVNYGLYSALLLSLPSLQPLAAMVIASLASMIFSFFGYSRF 120

Query: 120 MTR 122
           + R
Sbjct: 121 VFR 123


>gi|294811189|ref|ZP_06769832.1| putative sugar transferase [Streptomyces clavuligerus ATCC 27064]
 gi|294323788|gb|EFG05431.1| putative sugar transferase [Streptomyces clavuligerus ATCC 27064]
          Length = 1010

 Score = 65.3 bits (158), Expect = 3e-09,   Method: Composition-based stats.
 Identities = 15/117 (12%), Positives = 42/117 (35%), Gaps = 4/117 (3%)

Query: 2   KQCIIFIINIVVVFFIDVMGFFILMKCGADPFYSRIFSIAVAFLVTWIPSRLFIFLKLRR 61
           +Q + F++   V   +    +  L +       + +    V+ + +++ +         +
Sbjct: 378 RQFLSFVLVGCVNTAVYFAVYVTLNRWT-PYPVAHVLGYTVSVVGSFLLNSYVT--CRTK 434

Query: 62  KSFLETVRYGVMYFMLSILNYAFYVKLLLTFQGLQPLLATVLSAVSSMLFVFLLYIR 118
            ++   +RY +      +      + L +   G+    A +L+ V +    FLL   
Sbjct: 435 PTWHAFMRYPISSLAGLVA-AGCLLLLAVGRFGMDENAAALLAGVLATPLSFLLARW 490


>gi|294012945|ref|YP_003546405.1| hypothetical protein SJA_C1-29590 [Sphingobium japonicum UT26S]
 gi|292676275|dbj|BAI97793.1| hypothetical protein SJA_C1-29590 [Sphingobium japonicum UT26S]
          Length = 640

 Score = 65.3 bits (158), Expect = 3e-09,   Method: Composition-based stats.
 Identities = 20/118 (16%), Positives = 41/118 (34%), Gaps = 1/118 (0%)

Query: 4   CIIFIINIVVVFFIDVMGFFILMKCGADPFYSRIFSIAVAFLVTWIPSRLFIFLKLRRKS 63
            I F +  +V   +        +  G   + +      + F+++++ +R + F      S
Sbjct: 3   IIKFGLVGLVNTALGFSIILSALALGFGDYAASALGYGLGFILSYVANRRWTFAVREPMS 62

Query: 64  FLETVRYGVMYFMLSILNYAFYVKLLLTFQGLQPLLATVLSAVSSMLFVFLLYIRFMT 121
             E  R+GV+  +    N        L     QP +      + S  F +LL    + 
Sbjct: 63  AAELARFGVVTALAYATNLLVVSAFRLAGWIDQPFVHLAGVTLYSASF-YLLSRLLVF 119


>gi|291612788|ref|YP_003522945.1| GtrA family protein [Sideroxydans lithotrophicus ES-1]
 gi|291582900|gb|ADE10558.1| GtrA family protein [Sideroxydans lithotrophicus ES-1]
          Length = 164

 Score = 65.3 bits (158), Expect = 3e-09,   Method: Composition-based stats.
 Identities = 16/136 (11%), Positives = 46/136 (33%), Gaps = 9/136 (6%)

Query: 2   KQCIIFIINIVVVFFIDVMGFFILMKCGADPF--------YSRIFSIAVAFLVTWIPSRL 53
           ++ + F         +++   ++  +               S   +I +A +  +  +RL
Sbjct: 21  RRFLKFGTVGASGTVVNLGILYLGQEHLFRDIQPTQLKLNLSLALAIFLATVNNFFWNRL 80

Query: 54  FIFLKLRRKSFLETVRYGVMYFMLSILNYAF-YVKLLLTFQGLQPLLATVLSAVSSMLFV 112
           + +   +       +     Y +   L+ A   V   L        +A +++   + +  
Sbjct: 81  WTWADRKEHHHKPWLAQFWQYTLACWLSIALQIVFTNLLAPHFFYQIANLIAIGLTSVLN 140

Query: 113 FLLYIRFMTRRVYFIK 128
           F+L   +   R+  I+
Sbjct: 141 FVLNDIWTFGRLKLIR 156


>gi|225020118|ref|ZP_03709310.1| hypothetical protein CORMATOL_00114 [Corynebacterium matruchotii
           ATCC 33806]
 gi|224947083|gb|EEG28292.1| hypothetical protein CORMATOL_00114 [Corynebacterium matruchotii
           ATCC 33806]
          Length = 159

 Score = 65.3 bits (158), Expect = 3e-09,   Method: Composition-based stats.
 Identities = 17/126 (13%), Positives = 38/126 (30%), Gaps = 5/126 (3%)

Query: 3   QCIIFIINIVVVFFIDVMGFFILMK-CGADPFYSRIFSIAVAFLVTWIPSRLFIFLKLRR 61
           Q + FI   VV   ID     +L    G    +++           +  +  + F     
Sbjct: 33  QLVRFIAVGVVCAVIDYGTTLLLDYVLGVPRGWAKAVGWVAGTTSAYFMNAKWTFNSKTS 92

Query: 62  KSFLETVRYGVMYFMLSILNYAFYVKLLLTFQGLQPL----LATVLSAVSSMLFVFLLYI 117
                 V    +            V + L    L       ++ V++   + +  F++  
Sbjct: 93  AKATVAVAILYLSTFAVQNILYKVVPMPLHSFELPKFVVDTISFVIAQGVATVTNFVMQR 152

Query: 118 RFMTRR 123
            F+ ++
Sbjct: 153 AFIFKQ 158


>gi|34540675|ref|NP_905154.1| GtrA family protein [Porphyromonas gingivalis W83]
 gi|188994893|ref|YP_001929145.1| hypothetical protein PGN_1029 [Porphyromonas gingivalis ATCC 33277]
 gi|34396989|gb|AAQ66053.1| GtrA family protein [Porphyromonas gingivalis W83]
 gi|188594573|dbj|BAG33548.1| conserved hypothetical protein [Porphyromonas gingivalis ATCC
           33277]
          Length = 131

 Score = 65.3 bits (158), Expect = 3e-09,   Method: Composition-based stats.
 Identities = 20/122 (16%), Positives = 41/122 (33%), Gaps = 2/122 (1%)

Query: 3   QCIIFIINIVVVFFIDVMGFFILMKC-GADPFYSRIFSIAVAFLVTWIPSRLFIFLKLRR 61
           Q I + I  V    I ++  F+L+K  G     + +       + ++I +R + F   R 
Sbjct: 9   QLIKYGIVGVSNTLISMIVIFLLLKIAGMKDGPANLIGYIAGLINSFIWNRKWTFR-SRT 67

Query: 62  KSFLETVRYGVMYFMLSILNYAFYVKLLLTFQGLQPLLATVLSAVSSMLFVFLLYIRFMT 121
                 V + +M+ +   L Y   + L             ++      +  FL       
Sbjct: 68  SWRQTFVPFILMFVICYALQYGLLMWLNEYSTSYDKYYNHLIGMAFFTIINFLANKFITF 127

Query: 122 RR 123
            +
Sbjct: 128 GK 129


>gi|254473617|ref|ZP_05087013.1| dolichyl-phosphate beta-D-mannosyltransferase [Pseudovibrio sp.
           JE062]
 gi|211957329|gb|EEA92533.1| dolichyl-phosphate beta-D-mannosyltransferase [Pseudovibrio sp.
           JE062]
          Length = 382

 Score = 65.3 bits (158), Expect = 3e-09,   Method: Composition-based stats.
 Identities = 12/125 (9%), Positives = 39/125 (31%), Gaps = 6/125 (4%)

Query: 3   QCIIFIINIVVVFFIDVMGFFILMK-CGADPFYSRIFSIAVAFLVTWIPSRLFIFLKLRR 61
           + +++ +       + ++   IL+   G     +++ +  VA    +  +    +   R 
Sbjct: 259 RFLMYSMVGGTGVVVHLIALKILLALFGLPFGVAQLIATFVAMSSNFFLNNRLTYRDRRL 318

Query: 62  KSF---LETVRYGVMYFMLSILNYAFYVKLLLTFQGLQPLLATVLSAVSSMLFVFLLYIR 118
           K          + V+     + N      +           A    A+   ++ +++   
Sbjct: 319 KGLAWVKGLFTFYVICSFGILANVGVAELIYTNKPIW--WFAGAAGAIMGAVWNYIVSNA 376

Query: 119 FMTRR 123
              R+
Sbjct: 377 LTWRK 381


>gi|222147132|ref|YP_002548089.1| GtrA family protein [Agrobacterium vitis S4]
 gi|221734122|gb|ACM35085.1| GtrA family protein [Agrobacterium vitis S4]
          Length = 124

 Score = 65.3 bits (158), Expect = 3e-09,   Method: Composition-based stats.
 Identities = 41/124 (33%), Positives = 64/124 (51%), Gaps = 1/124 (0%)

Query: 1   MKQCIIFIINIVVVFFIDVMGFFILM-KCGADPFYSRIFSIAVAFLVTWIPSRLFIFLKL 59
           MK+ + F +     F +D    ++L+      P  +R  +I VA LVTW  +R F F   
Sbjct: 1   MKKLVRFALVGSTGFAVDAGLLWLLLSYSALGPLAARALAILVALLVTWRLNRAFTFGAS 60

Query: 60  RRKSFLETVRYGVMYFMLSILNYAFYVKLLLTFQGLQPLLATVLSAVSSMLFVFLLYIRF 119
           RR   +E  RYG +  + +++NY  Y  LL+    L P  A V +++++M F F  Y RF
Sbjct: 61  RRSLAVEGFRYGSVGVVSALVNYGLYAGLLIVIPALNPFAALVFASLAAMAFSFFGYSRF 120

Query: 120 MTRR 123
           + RR
Sbjct: 121 VFRR 124


>gi|257070107|ref|YP_003156362.1| hypothetical protein Bfae_30110 [Brachybacterium faecium DSM 4810]
 gi|256560925|gb|ACU86772.1| predicted membrane protein [Brachybacterium faecium DSM 4810]
          Length = 188

 Score = 65.3 bits (158), Expect = 3e-09,   Method: Composition-based stats.
 Identities = 25/139 (17%), Positives = 56/139 (40%), Gaps = 16/139 (11%)

Query: 1   MKQCIIFIINIVVVFFIDVMGFFILMKC-----------GADPFYSRIFSIAVAFLVTWI 49
           ++    F++   VVF +D   + +L+                P  +++ +IAVA  +T++
Sbjct: 49  LRPTATFLLVGGVVFLLDAAMYNLLVFWSPSQGWGAGLMHGSPLTAKLLTIAVASCLTYL 108

Query: 50  PSRLFIFLKLRRK-SFLETVRYGVMYFMLSILNYAFY----VKLLLTFQGLQPLLATVLS 104
            +R + F    R  +    V + ++  + + L  +        L L       +  T++ 
Sbjct: 109 GNRFWTFGDRPRPDTTRSIVLFILVNLIAAGLQLSCLGFSRYVLGLDSVLADNISGTLVG 168

Query: 105 AVSSMLFVFLLYIRFMTRR 123
            V S  F ++ Y R +  +
Sbjct: 169 QVVSTSFRYVTYGRLVFPK 187


>gi|111021715|ref|YP_704687.1| glycosyl transferase [Rhodococcus jostii RHA1]
 gi|110821245|gb|ABG96529.1| glycosyl transferase [Rhodococcus jostii RHA1]
          Length = 417

 Score = 65.3 bits (158), Expect = 3e-09,   Method: Composition-based stats.
 Identities = 14/126 (11%), Positives = 41/126 (32%), Gaps = 6/126 (4%)

Query: 1   MKQCIIFIINIVVVFFIDVMGFFILMKCGADPFYSRIFSIAVAFLVTWIPSRLFIFLKLR 60
           + Q   F +  V    +     ++++       ++   S+ V  ++    +R F F    
Sbjct: 285 VGQLARFAVIGVAST-VAYALLYLILHPIVGAQWANAVSLLVTAVLNTAANRAFTFGVRG 343

Query: 61  R----KSFLETVRYGVMYFMLSILNYAFYVKLLLTFQGLQPLLATVLSAVSSMLFVFLLY 116
                +  ++ +       +L+  +                L   VL+ + + +  F+  
Sbjct: 344 SEGAARHQMQGLLVFAFGLLLTSGSLYVLHSAAPDVSKHVELAVLVLANLVATISRFIAL 403

Query: 117 IRFMTR 122
             ++ R
Sbjct: 404 R-WVFR 408


>gi|290957888|ref|YP_003489070.1| glycosyltransferase [Streptomyces scabiei 87.22]
 gi|260647414|emb|CBG70519.1| putative glycosyltransferase [Streptomyces scabiei 87.22]
          Length = 426

 Score = 64.9 bits (157), Expect = 3e-09,   Method: Composition-based stats.
 Identities = 20/123 (16%), Positives = 47/123 (38%), Gaps = 3/123 (2%)

Query: 1   MKQCIIFIINIVVVFFIDVMGFFILMKCGADPFYSRIFSIAVAFLVTWIPSRLFIF--LK 58
           + + ++F +  V  F  ++ G   L   G     + I +  +  L  ++      F   +
Sbjct: 263 VARMLVFGLIGVTGFLPNLAGLHALTSAGMHYLPAEILANQLGVLWNFLLIEHLCFRERR 322

Query: 59  LRRKSFLETVRYGVMYFMLSILNYAFYVKLLLTFQGLQPLLATVLSAVSSMLFVFLLYIR 118
             R+++    R+ V+     +L         +   G+  L AT L+ V++ +  F+    
Sbjct: 323 RHRRAWDRLGRFAVLANADLVLRIPLIAL-FVGRFGMGALSATALALVTTFVLRFVATEA 381

Query: 119 FMT 121
            + 
Sbjct: 382 LVY 384



 Score = 35.3 bits (80), Expect = 2.9,   Method: Composition-based stats.
 Identities = 13/63 (20%), Positives = 23/63 (36%), Gaps = 2/63 (3%)

Query: 59  LRRKSFLETVRYGVMYFMLSILNYAFYVKLLLTFQGLQPLLATVLSAVSSMLFVFLLYIR 118
                    + +G++     + N A      LT  G+  L A +L+    +L+ FLL   
Sbjct: 258 RTASPVARMLVFGLIGVTGFLPNLAGLHA--LTSAGMHYLPAEILANQLGVLWNFLLIEH 315

Query: 119 FMT 121
              
Sbjct: 316 LCF 318


>gi|169627298|ref|YP_001700947.1| hypothetical protein MAB_0193c [Mycobacterium abscessus ATCC 19977]
 gi|169239265|emb|CAM60293.1| Conserved hypothetical protein [Mycobacterium abscessus]
          Length = 137

 Score = 64.9 bits (157), Expect = 3e-09,   Method: Composition-based stats.
 Identities = 14/122 (11%), Positives = 44/122 (36%), Gaps = 4/122 (3%)

Query: 3   QCIIFIINIVVVFFIDVMGFFILMKCGADPFYSRIFSIAVAFLVTWIPSRLFIFLKLRRK 62
           Q   F+I   +   +D   + + +  G     ++  S        ++ +R + F     +
Sbjct: 16  QAARFVITGGLSAIVDFGLYVLFLHVGLQVNVAKSISFVAGTTTAYLINRRWTFQAEPSR 75

Query: 63  SFLETVRYGVMYFMLSILNYAFYVKLLLTFQG--LQPLLATVLSAVSSMLFVFLLYIRFM 120
           +    +    +Y +   +         + F+    +  +A V++  ++ +  F++    +
Sbjct: 76  A--RFIAVMALYGLTYAVQVGINYLFYMQFEDKPWRVPVAFVIAQGTATVINFIVQRAVI 133

Query: 121 TR 122
            R
Sbjct: 134 FR 135


>gi|85374493|ref|YP_458555.1| putative dolichol monophosphate mannose synthase [Erythrobacter
           litoralis HTCC2594]
 gi|84787576|gb|ABC63758.1| putative dolichol monophosphate mannose synthase [Erythrobacter
           litoralis HTCC2594]
          Length = 362

 Score = 64.9 bits (157), Expect = 3e-09,   Method: Composition-based stats.
 Identities = 19/126 (15%), Positives = 44/126 (34%), Gaps = 7/126 (5%)

Query: 3   QCIIFIINIVVVFFIDVMGFFILMKCGADPFYS-RIFSIAVAFLVTWIPSRLFIFLKLRR 61
           + ++F     +   + +    +L+      F   +  +   A    +  +    +   R 
Sbjct: 238 RFMLFSTVGALGVGVHMGVLALLLLLLGSGFALGQAVATFTAMTFNFWLNNWLTYRDQRL 297

Query: 62  KSFLETVR----YGVMYFMLSILNYAFYVKLLLTFQGLQPLLATVLSAVSSMLFVFLLYI 117
           K   + +R    + +   + ++ N A      L   GL   LA +   V   ++ + L  
Sbjct: 298 KGTAQLLRGWIGFCLTCSVGALANIALASW--LEANGLFWALAALAGIVIGAVWNYALSS 355

Query: 118 RFMTRR 123
           RF+  R
Sbjct: 356 RFVWGR 361



 Score = 35.3 bits (80), Expect = 2.7,   Method: Composition-based stats.
 Identities = 8/58 (13%), Positives = 21/58 (36%)

Query: 1   MKQCIIFIINIVVVFFIDVMGFFILMKCGADPFYSRIFSIAVAFLVTWIPSRLFIFLK 58
           ++  I F +   V    ++     L   G     + +  I +  +  +  S  F++ +
Sbjct: 304 LRGWIGFCLTCSVGALANIALASWLEANGLFWALAALAGIVIGAVWNYALSSRFVWGR 361


>gi|260579496|ref|ZP_05847370.1| membrane protein [Corynebacterium jeikeium ATCC 43734]
 gi|258602382|gb|EEW15685.1| membrane protein [Corynebacterium jeikeium ATCC 43734]
          Length = 238

 Score = 64.9 bits (157), Expect = 3e-09,   Method: Composition-based stats.
 Identities = 16/159 (10%), Positives = 42/159 (26%), Gaps = 38/159 (23%)

Query: 2   KQCIIFIINIVVVFFIDVMGFFILMKCGA----------------------DPFYSRIFS 39
           +Q I F I     F ++   F +  K                               + +
Sbjct: 49  RQFIQFGIVGASGFVVNQAIFVLSKKLAEAGWDIHVQDAFMNLLGTQYHFRWYHVFSVVA 108

Query: 40  IAVAFLVTWIPSRLFIFLK-LRRKSFLETVRYGVMYFMLSILNYAFYVKLLL-------- 90
             +A +  +  +R + F    +R  + +  ++  +     ++       L+         
Sbjct: 109 FLLANIWNFCLNRYWTFRHEPKRAWWKQLPQFMAVGVFGLLITLVVSTALVNPESPIALP 168

Query: 91  -------TFQGLQPLLATVLSAVSSMLFVFLLYIRFMTR 122
                  T    +      +  + ++   FL    +  R
Sbjct: 169 HDIFDNSTGLRTRAYWGNFIGVILAVPANFLFNKLWTFR 207



 Score = 34.9 bits (79), Expect = 3.8,   Method: Composition-based stats.
 Identities = 10/81 (12%), Positives = 25/81 (30%), Gaps = 17/81 (20%)

Query: 2   KQCIIFIINIVVVFFIDVMGFFILMK-----------------CGADPFYSRIFSIAVAF 44
           KQ   F+   V    I ++    L+                       ++     + +A 
Sbjct: 135 KQLPQFMAVGVFGLLITLVVSTALVNPESPIALPHDIFDNSTGLRTRAYWGNFIGVILAV 194

Query: 45  LVTWIPSRLFIFLKLRRKSFL 65
              ++ ++L+ F    R++  
Sbjct: 195 PANFLFNKLWTFRAKPREASR 215


>gi|317507690|ref|ZP_07965397.1| GtrA protein [Segniliparus rugosus ATCC BAA-974]
 gi|316254017|gb|EFV13380.1| GtrA protein [Segniliparus rugosus ATCC BAA-974]
          Length = 150

 Score = 64.9 bits (157), Expect = 3e-09,   Method: Composition-based stats.
 Identities = 20/126 (15%), Positives = 42/126 (33%), Gaps = 8/126 (6%)

Query: 3   QCIIFIINIVVVFFIDVMGFFILMKCGADPFYSRIFSIAVAFLVTWIPSRLFIFLKLRRK 62
           Q + F++  V    +D      L + G  P  + I    V   V ++ +R + F      
Sbjct: 21  QVLRFLVTGVFSAVVDYGLVMALSQLGVPPNAANIVGFVVGTTVAYLINRRWTFQAEPSS 80

Query: 63  SFLETVRYGVMYFMLSILNYAFYVKLLLTFQGL------QPLLATVLSAVSSMLFVFLLY 116
                ++   +Y +  +L    +   L                A V++  +  +  FL+ 
Sbjct: 81  --KRFMQVAALYAVAFLLRTGLFAGALALLLSWGAAKFFAESAAWVVAQGTVTVMNFLVQ 138

Query: 117 IRFMTR 122
              + R
Sbjct: 139 RLVIFR 144


>gi|291302701|ref|YP_003513979.1| glycosyl transferase family 2 [Stackebrandtia nassauensis DSM
           44728]
 gi|290571921|gb|ADD44886.1| glycosyl transferase family 2 [Stackebrandtia nassauensis DSM
           44728]
          Length = 416

 Score = 64.9 bits (157), Expect = 3e-09,   Method: Composition-based stats.
 Identities = 19/125 (15%), Positives = 49/125 (39%), Gaps = 5/125 (4%)

Query: 1   MKQCIIFIINIVVVFFIDVMGFFILMKCGADPFYSRIFSIAVAFLVTWIPSRLFIFLKLR 60
           ++Q + F +  ++      +  + + + G  P  S + ++ V  + +   +R F F    
Sbjct: 283 VRQLLSFCVIGILSTLF-YLVLYTVFRDGLGPQVSNMVALLVTAMASTAVNRRFTFGVRG 341

Query: 61  RKSFL----ETVRYGVMYFMLSILNYAFYVKLLLTFQGLQPLLATVLSAVSSMLFVFLLY 116
           R   +    + +    +   L+  + A       T      L   V++ +++ L  FLL+
Sbjct: 342 RDGAVRQQAQGLAVFAIGLTLTSGSLAALEIASPTAGQTTELAVLVVANLAASLLKFLLF 401

Query: 117 IRFMT 121
             ++ 
Sbjct: 402 RGWVF 406


>gi|209542587|ref|YP_002274816.1| GtrA family protein [Gluconacetobacter diazotrophicus PAl 5]
 gi|209530264|gb|ACI50201.1| GtrA family protein [Gluconacetobacter diazotrophicus PAl 5]
          Length = 191

 Score = 64.9 bits (157), Expect = 3e-09,   Method: Composition-based stats.
 Identities = 21/123 (17%), Positives = 42/123 (34%), Gaps = 5/123 (4%)

Query: 4   CIIFIINIVVVFFIDVMGFFILMKCGADPFYSRIFSIAVAFLVTWIPSRLFIFLK--LRR 61
            + F +        D    +           + I +  VA  + W+ +R + F       
Sbjct: 29  FVKFGVVGTFGLMWDTATVYGFRAL-LGLTGATILAYFVAATMNWLLNRHWTFRHVVHAD 87

Query: 62  KSFLETVRYGVMYFMLSILNYAFYVKLLLTFQGLQ--PLLATVLSAVSSMLFVFLLYIRF 119
              ++  R+ +   +  +LN      L LT    +  P LA    +++ +   F L  R 
Sbjct: 88  HPLVQWARFLMANSLGFVLNRGMVFTLFLTVPLCRTIPFLALAAGSLTGLFANFTLSHRV 147

Query: 120 MTR 122
           + R
Sbjct: 148 VFR 150


>gi|329114348|ref|ZP_08243110.1| GtrA Family Protein [Acetobacter pomorum DM001]
 gi|326696424|gb|EGE48103.1| GtrA Family Protein [Acetobacter pomorum DM001]
          Length = 167

 Score = 64.9 bits (157), Expect = 3e-09,   Method: Composition-based stats.
 Identities = 24/124 (19%), Positives = 45/124 (36%), Gaps = 5/124 (4%)

Query: 3   QCIIFIINIVVVFFIDVMGFFILMKCGADPFYSRIFSIAVAFLVTWIPSRLFIFLKLRRK 62
           + I F +   + F  D    + L         + + +  VA  + WI +R++ F      
Sbjct: 17  RLIKFGMVGSLGFLWDSGTVYALRPL-IGLTAATLVAYFVAATLNWIFNRIWTFKGAGHH 75

Query: 63  SF--LETVRYGVMYFMLSILNYAFYVKLLLTFQGL--QPLLATVLSAVSSMLFVFLLYIR 118
               L+ +R+     +   LN      L   F      P++A    A + ML  F +  +
Sbjct: 76  EHPVLQWLRFLSANSLGFFLNRGTVYLLFYIFPFCMQHPIIALAAGAGAGMLANFSMSQK 135

Query: 119 FMTR 122
            + R
Sbjct: 136 VVFR 139


>gi|182677060|ref|YP_001831206.1| GtrA family protein [Beijerinckia indica subsp. indica ATCC 9039]
 gi|182632943|gb|ACB93717.1| GtrA family protein [Beijerinckia indica subsp. indica ATCC 9039]
          Length = 133

 Score = 64.9 bits (157), Expect = 3e-09,   Method: Composition-based stats.
 Identities = 17/122 (13%), Positives = 44/122 (36%), Gaps = 3/122 (2%)

Query: 1   MKQCIIFIINIVVVFFIDVMGFFILMK-CGADPFYSRIFSIAVAFLVTWIPSRLFIFLKL 59
           ++Q   F    +    +      +L++  G D   + +       + ++  +R   F   
Sbjct: 5   LRQFSTFAGVGLCAAVVHYGLLIVLVEAMGVDVIIATLVGYCGGGICSYWLNRRHTFQSE 64

Query: 60  RRKSFLETVRYGVMYFMLSILNYAFYVKLLLTFQGLQPLLATVLSAVSSMLFVFLLYIRF 119
           RR       R+ ++  +   L +   +  L+    +  LLA  L+    M++ +  +  +
Sbjct: 65  RRHR-EAIWRFILVAAVGFGLTWLC-MLGLVRGLKIPYLLAQALTTGIVMVWSYGAHKVW 122

Query: 120 MT 121
             
Sbjct: 123 TF 124


>gi|154486561|ref|ZP_02027968.1| hypothetical protein BIFADO_00376 [Bifidobacterium adolescentis
           L2-32]
 gi|154084424|gb|EDN83469.1| hypothetical protein BIFADO_00376 [Bifidobacterium adolescentis
           L2-32]
          Length = 186

 Score = 64.9 bits (157), Expect = 3e-09,   Method: Composition-based stats.
 Identities = 18/132 (13%), Positives = 44/132 (33%), Gaps = 13/132 (9%)

Query: 1   MKQCIIFIINIVVVFFIDVMGFFILMKC-GADPFYSRIFSIAVAFLVTWIPSRLFIFLKL 59
           ++Q + F I  V+ F ID     +L+         +   S  ++ +  ++ S   +F   
Sbjct: 5   IEQLMKFGIVGVIAFIIDWGILNLLVGLFHMHNVLAATISFIISLIFNYVASMKVVFKHR 64

Query: 60  -RRKSFLETVRYGVMYFMLSILNYAFYVKLLLTFQGLQPL-----------LATVLSAVS 107
                ++E V + V   +   +N A              +           +  +++   
Sbjct: 65  DDMARWMEIVIFVVGAVIGLFMNDAIIWISTYGMNHDAYVSQSAEYLIRTNVGKLIATAV 124

Query: 108 SMLFVFLLYIRF 119
            M++ F+     
Sbjct: 125 VMVWNFVTRKWL 136



 Score = 36.0 bits (82), Expect = 1.9,   Method: Composition-based stats.
 Identities = 9/62 (14%), Positives = 33/62 (53%), Gaps = 1/62 (1%)

Query: 61  RKSFLETVRYGVMYFMLSILNYAFYVKLLLTFQGLQPLLATVLSAVSSMLFVFLLYIRFM 120
           +K   + +++G++  +  I+++      L+    +  +LA  +S + S++F ++  ++ +
Sbjct: 2   KKLIEQLMKFGIVGVIAFIIDWGILNL-LVGLFHMHNVLAATISFIISLIFNYVASMKVV 60

Query: 121 TR 122
            +
Sbjct: 61  FK 62


>gi|288919202|ref|ZP_06413540.1| glycosyl transferase family 2 [Frankia sp. EUN1f]
 gi|288349449|gb|EFC83688.1| glycosyl transferase family 2 [Frankia sp. EUN1f]
          Length = 547

 Score = 64.9 bits (157), Expect = 4e-09,   Method: Composition-based stats.
 Identities = 20/124 (16%), Positives = 44/124 (35%), Gaps = 5/124 (4%)

Query: 2   KQCIIFIINIVVVFFIDVMGFFILMKCGADPFYSRIFSIAVAFLVTWIPSRLFIFLKLRR 61
           +Q + F    V       +  F+L+        + + ++ V  +     +R   F    R
Sbjct: 408 RQLVRFTGVGVASTLA-YLLLFLLLHGATGAQAANLIALLVTAIANTAANRRLTFGVSGR 466

Query: 62  ----KSFLETVRYGVMYFMLSILNYAFYVKLLLTFQGLQPLLATVLSAVSSMLFVFLLYI 117
               +  L+ +    +   L+  + A    +      L  L   VL+ ++S +  FLL  
Sbjct: 467 DDAGRHHLQGLFVFAIGLALTSGSLAALHAVSDDPGRLPELTVLVLANLASTVIRFLLLR 526

Query: 118 RFMT 121
            ++ 
Sbjct: 527 AWVF 530


>gi|326439695|ref|ZP_08214429.1| putative sugar transferase [Streptomyces clavuligerus ATCC 27064]
          Length = 987

 Score = 64.9 bits (157), Expect = 4e-09,   Method: Composition-based stats.
 Identities = 15/117 (12%), Positives = 42/117 (35%), Gaps = 4/117 (3%)

Query: 2   KQCIIFIINIVVVFFIDVMGFFILMKCGADPFYSRIFSIAVAFLVTWIPSRLFIFLKLRR 61
           +Q + F++   V   +    +  L +       + +    V+ + +++ +         +
Sbjct: 355 RQFLSFVLVGCVNTAVYFAVYVTLNRWT-PYPVAHVLGYTVSVVGSFLLNSYVT--CRTK 411

Query: 62  KSFLETVRYGVMYFMLSILNYAFYVKLLLTFQGLQPLLATVLSAVSSMLFVFLLYIR 118
            ++   +RY +      +      + L +   G+    A +L+ V +    FLL   
Sbjct: 412 PTWHAFMRYPISSLAGLVA-AGCLLLLAVGRFGMDENAAALLAGVLATPLSFLLARW 467


>gi|288549284|gb|ADC52844.1| YbfF [Streptomyces platensis]
          Length = 405

 Score = 64.9 bits (157), Expect = 4e-09,   Method: Composition-based stats.
 Identities = 18/119 (15%), Positives = 47/119 (39%), Gaps = 3/119 (2%)

Query: 8   IINIVVVFFIDVMGFFILMKCGA-DPFYSRIFSIAVAFLVTWIPSRLFIFLKLRR-KSFL 65
            +  +  F  ++   + L    A     + + +     L  ++     ++   +R  S++
Sbjct: 284 GMVGLSGFLPNLAVLWALTHHTALHYTAAEVIANQFGLLWNFVLIDKVLYHGRKRLDSWM 343

Query: 66  ETVRYGVMYFMLSILNYAFYVKLLLTFQGLQPLLATVLSAVSSMLFVFLLYIRFMTRRV 124
             + +  +     ++     V  L++  G  P+ AT ++   ++   FL   RF+ RR+
Sbjct: 344 RLLGFAALANADLMVRIPLMVL-LVSGFGFTPVPATAITLAVALALRFLCVDRFLYRRI 401


>gi|296394939|ref|YP_003659823.1| family 2 glycosyltransferase [Segniliparus rotundus DSM 44985]
 gi|296182086|gb|ADG98992.1| glycosyl transferase family 2 [Segniliparus rotundus DSM 44985]
          Length = 419

 Score = 64.9 bits (157), Expect = 4e-09,   Method: Composition-based stats.
 Identities = 17/127 (13%), Positives = 42/127 (33%), Gaps = 7/127 (5%)

Query: 1   MKQCIIFIINIVVVFFIDVMGFFILMKCGADPFYSRIFSIAVAFLVTWIPSRLFIFLKLR 60
           + Q + F I  V+   I     F+ ++       + + ++    +     +R F F    
Sbjct: 287 VGQLVRFGIVGVLST-IAFAVLFLALRPALGAQAANLIALLTTAVANTAANRAFTFGVRG 345

Query: 61  RK-----SFLETVRYGVMYFMLSILNYAFYVKLLLTFQGLQPLLATVLSAVSSMLFVFLL 115
           R             + + + + S   Y  +  +         LL  +++ + + L  F+ 
Sbjct: 346 RSGAGLHHLQGLAIFLIGWTLTSGSLYVLHTFVSSDPGHHIELLVLIVANLVATLVRFIG 405

Query: 116 YIRFMTR 122
               + R
Sbjct: 406 LR-LVFR 411


>gi|148977379|ref|ZP_01813979.1| hypothetical protein VSWAT3_22667 [Vibrionales bacterium SWAT-3]
 gi|145963331|gb|EDK28596.1| hypothetical protein VSWAT3_22667 [Vibrionales bacterium SWAT-3]
          Length = 154

 Score = 64.5 bits (156), Expect = 4e-09,   Method: Composition-based stats.
 Identities = 21/128 (16%), Positives = 46/128 (35%), Gaps = 7/128 (5%)

Query: 3   QCIIFIINIVVVFFIDVMGFFILMKC-GADPFYSRIFSIAVAFLVTWIPSRLFIFLKLRR 61
           + I F    V  F +D   F +L    G     +RI +   A   TW+ +R+  F    +
Sbjct: 27  KIIRFAAVGVGGFVVDCTVFSLLHYLAGLPLMSARIGAFIAAATTTWLGNRVLTFEFKGQ 86

Query: 62  KSF----LETVRYGVMYFMLSILNYAFYVKLLLTFQGLQ--PLLATVLSAVSSMLFVFLL 115
             +    ++  ++ +   + +I N   +               +A  +  +  M+  +L 
Sbjct: 87  DGWSDTLIQWQKFMLSASISAIPNLLCFKLTTEMLPAFDGAVFVAMAMGILVGMVTNYLF 146

Query: 116 YIRFMTRR 123
              ++  R
Sbjct: 147 SQYWVFAR 154


>gi|307941733|ref|ZP_07657088.1| dolichyl-phosphate beta-D-mannosyltransferase [Roseibium sp.
           TrichSKD4]
 gi|307775341|gb|EFO34547.1| dolichyl-phosphate beta-D-mannosyltransferase [Roseibium sp.
           TrichSKD4]
          Length = 379

 Score = 64.5 bits (156), Expect = 4e-09,   Method: Composition-based stats.
 Identities = 11/125 (8%), Positives = 38/125 (30%), Gaps = 6/125 (4%)

Query: 3   QCIIFIINIVVVFFIDVMGFFILMKC-GADPFYSRIFSIAVAFLVTWIPSRLFIFLKLRR 61
           + ++F +      F+ ++   + +   G +   ++  +  VA    +  +    +   R 
Sbjct: 256 RFLMFGLVGASGLFVHLLALKLFLDMAGLEFNLAQTGASFVAMTSNFFLNNQLTYRDRRL 315

Query: 62  KSFL---ETVRYGVMYFMLSILNYAFYVKLLLTFQGLQPLLATVLSAVSSMLFVFLLYIR 118
                    + +  +  +  + N       L+         A    A+   ++ +     
Sbjct: 316 TGLKVLIGLLTFYAVCSVGVLANVGV--ANLIYSDPTYWWFAGAAGAIMGAVWNYAASSA 373

Query: 119 FMTRR 123
              R+
Sbjct: 374 LTWRK 378


>gi|307353221|ref|YP_003894272.1| GtrA family protein [Methanoplanus petrolearius DSM 11571]
 gi|307156454|gb|ADN35834.1| GtrA family protein [Methanoplanus petrolearius DSM 11571]
          Length = 145

 Score = 64.5 bits (156), Expect = 4e-09,   Method: Composition-based stats.
 Identities = 17/121 (14%), Positives = 42/121 (34%), Gaps = 2/121 (1%)

Query: 3   QCIIFIINIVVVFFIDVMGFFILM-KCGADPFYSRIFSIAVAFLVTWIPSRLFIFLKLRR 61
           + I+F    +V    D+   ++L  + G     S   S     ++++  ++   F    R
Sbjct: 24  KIIVFFFIGIVSSLADIGILYLLTDELGVWYLESAAVSYCCGTVLSYWLNKHLTFRDSSR 83

Query: 62  KSFLETVRYGVMYFMLSILNYAFYVKLLLTFQGLQPLLATVLSAVSSMLFVFLLYIRFMT 121
           K   + + +  +     +L         +    L  L   V++ + +  + F    R   
Sbjct: 84  KYLSQFLLFAAISISSLLLTLCIIWVS-VEIFSLSYLTGKVIAIIIAFFWNFTGQSRITF 142

Query: 122 R 122
           +
Sbjct: 143 K 143


>gi|326794813|ref|YP_004312633.1| GtrA family protein [Marinomonas mediterranea MMB-1]
 gi|326545577|gb|ADZ90797.1| GtrA family protein [Marinomonas mediterranea MMB-1]
          Length = 146

 Score = 64.5 bits (156), Expect = 4e-09,   Method: Composition-based stats.
 Identities = 26/135 (19%), Positives = 51/135 (37%), Gaps = 10/135 (7%)

Query: 3   QCIIFIINIVVVFFIDVMGFFILMKCGADPFYSRIFSIAVAFLVTWIPSRLFIF--LKLR 60
           Q I F +  ++ F IDV   ++          +R  +  +A L  W+  RL+ F     R
Sbjct: 8   QFIKFSLVGLISFVIDVFAMWVFSHW-LPLVLARAVAFVLAVLTNWVCHRLYTFKSHASR 66

Query: 61  RKSFLETVRYGVMYFMLSILNYAFYVKLL-------LTFQGLQPLLATVLSAVSSMLFVF 113
           +    E + +     +  I N   Y  ++            L PL+A +   V+  +  F
Sbjct: 67  QAKLKEAITFLTASLVGMIPNVGIYWWIVHSDWYVNYHSMSLAPLIAMIPGIVAGQITNF 126

Query: 114 LLYIRFMTRRVYFIK 128
           +L   ++ +    + 
Sbjct: 127 VLSKYWVFKEQPVVA 141


>gi|77919341|ref|YP_357156.1| hypothetical protein Pcar_1743 [Pelobacter carbinolicus DSM 2380]
 gi|77545424|gb|ABA88986.1| predicted membrane protein [Pelobacter carbinolicus DSM 2380]
          Length = 155

 Score = 64.5 bits (156), Expect = 4e-09,   Method: Composition-based stats.
 Identities = 24/137 (17%), Positives = 47/137 (34%), Gaps = 11/137 (8%)

Query: 3   QCIIFIINIVVVFFIDVMGFFILMKCG-----ADPFYSRIFSIAVAFLVTWIPSRLFIFL 57
           + + F +  ++   +D     I +               +FS   A + +++ ++ + F 
Sbjct: 2   KILRFGLVGIINTVVDCALLNIFVLVLRVFTPGGLVLCNVFSFLGANVNSYVMNKKWTFR 61

Query: 58  KLRRKSFLETVRYGVMYFMLSILNYAFY------VKLLLTFQGLQPLLATVLSAVSSMLF 111
                S  E + + V       +N             L     L   LA + + V SML+
Sbjct: 62  HPEHASQKEYLVFLVCSLGGLGINSGMIFILSQDFFDLGLSFFLHLNLAKIAATVVSMLW 121

Query: 112 VFLLYIRFMTRRVYFIK 128
            F  Y  F+ + V   K
Sbjct: 122 NFFSYKLFVFKDVNVAK 138


>gi|30265452|ref|NP_847829.1| gtrA family protein [Bacillus anthracis str. Ames]
 gi|47778427|ref|YP_022735.1| gtrA family protein [Bacillus anthracis str. 'Ames Ancestor']
 gi|49188271|ref|YP_031524.1| gtrA family protein [Bacillus anthracis str. Sterne]
 gi|65317414|ref|ZP_00390373.1| COG2246: Predicted membrane protein [Bacillus anthracis str. A2012]
 gi|165872501|ref|ZP_02217134.1| gtrA family protein [Bacillus anthracis str. A0488]
 gi|167636264|ref|ZP_02394567.1| gtrA family protein [Bacillus anthracis str. A0442]
 gi|167641410|ref|ZP_02399660.1| gtrA family protein [Bacillus anthracis str. A0193]
 gi|170689187|ref|ZP_02880384.1| gtrA family protein [Bacillus anthracis str. A0465]
 gi|170708671|ref|ZP_02899110.1| gtrA family protein [Bacillus anthracis str. A0389]
 gi|177651835|ref|ZP_02934418.1| gtrA family protein [Bacillus anthracis str. A0174]
 gi|190568893|ref|ZP_03021795.1| gtrA family protein [Bacillus anthracis Tsiankovskii-I]
 gi|196036136|ref|ZP_03103536.1| gtrA family protein [Bacillus cereus W]
 gi|196045496|ref|ZP_03112727.1| gtrA family protein [Bacillus cereus 03BB108]
 gi|225867415|ref|YP_002752793.1| gtrA family protein [Bacillus cereus 03BB102]
 gi|227818202|ref|YP_002818211.1| gtrA family protein [Bacillus anthracis str. CDC 684]
 gi|229600085|ref|YP_002869642.1| gtrA family protein [Bacillus anthracis str. A0248]
 gi|254687126|ref|ZP_05150984.1| gtrA family protein [Bacillus anthracis str. CNEVA-9066]
 gi|254724091|ref|ZP_05185876.1| gtrA family protein [Bacillus anthracis str. A1055]
 gi|254735553|ref|ZP_05193260.1| gtrA family protein [Bacillus anthracis str. Western North America
           USA6153]
 gi|254742183|ref|ZP_05199870.1| gtrA family protein [Bacillus anthracis str. Kruger B]
 gi|254755907|ref|ZP_05207939.1| gtrA family protein [Bacillus anthracis str. Vollum]
 gi|254761619|ref|ZP_05213639.1| gtrA family protein [Bacillus anthracis str. Australia 94]
 gi|301056898|ref|YP_003795109.1| putative GtrA-like protein [Bacillus anthracis CI]
 gi|30260130|gb|AAP29315.1| gtrA family protein [Bacillus anthracis str. Ames]
 gi|47552132|gb|AAT35469.1| gtrA family protein [Bacillus anthracis str. 'Ames Ancestor']
 gi|49182198|gb|AAT57574.1| gtrA family protein [Bacillus anthracis str. Sterne]
 gi|164711724|gb|EDR17268.1| gtrA family protein [Bacillus anthracis str. A0488]
 gi|167510585|gb|EDR85981.1| gtrA family protein [Bacillus anthracis str. A0193]
 gi|167528379|gb|EDR91150.1| gtrA family protein [Bacillus anthracis str. A0442]
 gi|170126453|gb|EDS95341.1| gtrA family protein [Bacillus anthracis str. A0389]
 gi|170666830|gb|EDT17596.1| gtrA family protein [Bacillus anthracis str. A0465]
 gi|172082539|gb|EDT67603.1| gtrA family protein [Bacillus anthracis str. A0174]
 gi|190559960|gb|EDV13943.1| gtrA family protein [Bacillus anthracis Tsiankovskii-I]
 gi|195991303|gb|EDX55271.1| gtrA family protein [Bacillus cereus W]
 gi|196023703|gb|EDX62379.1| gtrA family protein [Bacillus cereus 03BB108]
 gi|225790151|gb|ACO30368.1| gtrA family protein [Bacillus cereus 03BB102]
 gi|227003478|gb|ACP13221.1| gtrA family protein [Bacillus anthracis str. CDC 684]
 gi|229264493|gb|ACQ46130.1| gtrA family protein [Bacillus anthracis str. A0248]
 gi|300379067|gb|ADK07971.1| putative GtrA-like protein [Bacillus cereus biovar anthracis str.
           CI]
          Length = 127

 Score = 64.5 bits (156), Expect = 4e-09,   Method: Composition-based stats.
 Identities = 16/121 (13%), Positives = 52/121 (42%), Gaps = 2/121 (1%)

Query: 1   MKQCIIFIINIVVVFFIDVMGFFILMKCGADPFYSRIFSIAVAFLVTWIPSRLFIFLKLR 60
           M++ + F +  +    I ++ F+IL+K G +   +   +  +    ++  ++ ++F    
Sbjct: 1   MEKLLKFGLVGIFNTLITIISFWILLKFGMNYLIANTIAYLIGVANSYYWNKNWVFKPNN 60

Query: 61  RKSFLETVRYGVMYFMLSILNYAFYVKLLLTFQGLQPLLATVLSAVSSMLFVFLLYIRFM 120
           + + +   ++  +  ++   N      +L+    +  L+A + +    M+  F+L   + 
Sbjct: 61  KSTSM-FFKFLTVNLIVLGFNTLCL-FILVDKLTVNKLIAQIFAIGVGMVINFVLNKIWT 118

Query: 121 T 121
            
Sbjct: 119 F 119


>gi|256390048|ref|YP_003111612.1| GtrA family protein [Catenulispora acidiphila DSM 44928]
 gi|256356274|gb|ACU69771.1| GtrA family protein [Catenulispora acidiphila DSM 44928]
          Length = 213

 Score = 64.5 bits (156), Expect = 4e-09,   Method: Composition-based stats.
 Identities = 19/125 (15%), Positives = 38/125 (30%), Gaps = 6/125 (4%)

Query: 3   QCIIFIINIVVVFFIDVMGFFILM-KCGADPFYSRIFSIAVAFLVTWIPSRLFIFLKL-R 60
           +   F +   V    DV    +L    G     + +    VA +  +I +R ++F     
Sbjct: 16  EMFKFGVVGAVGVISDVSSSNLLWKYTGLSHTVASVGGTCVATITAYIGARYWVFRGRPD 75

Query: 61  RKSFLETVRYGVMYFMLSILNYAFYVKLLLTFQGLQPLLAT----VLSAVSSMLFVFLLY 116
                E   + ++  +  I+  +F               A     VL    + +F F   
Sbjct: 76  DARRREMAMFALISLVGLIIENSFVFVGDRILGFHSIEAANVAKFVLGLPVAGVFRFTTS 135

Query: 117 IRFMT 121
              + 
Sbjct: 136 HLIVF 140



 Score = 38.3 bits (88), Expect = 0.35,   Method: Composition-based stats.
 Identities = 13/62 (20%), Positives = 29/62 (46%), Gaps = 1/62 (1%)

Query: 61  RKSFLETVRYGVMYFMLSILNYAFYVKLLLTFQGLQPLLATVLSAVSSMLFVFLLYIRFM 120
           RK + E  ++GV+  +  I + +    LL  + GL   +A+V     + +  ++    ++
Sbjct: 11  RKLYAEMFKFGVVGAVGVISDVS-SSNLLWKYTGLSHTVASVGGTCVATITAYIGARYWV 69

Query: 121 TR 122
            R
Sbjct: 70  FR 71


>gi|116328659|ref|YP_798379.1| undP-glycosyltransferase [Leptospira borgpetersenii serovar
           Hardjo-bovis L550]
 gi|116330684|ref|YP_800402.1| undP-glycosyltransferase [Leptospira borgpetersenii serovar
           Hardjo-bovis JB197]
 gi|116121403|gb|ABJ79446.1| undP-glycosyltransferase [Leptospira borgpetersenii serovar
           Hardjo-bovis L550]
 gi|116124373|gb|ABJ75644.1| undP-glycosyltransferase [Leptospira borgpetersenii serovar
           Hardjo-bovis JB197]
          Length = 380

 Score = 64.5 bits (156), Expect = 4e-09,   Method: Composition-based stats.
 Identities = 17/144 (11%), Positives = 53/144 (36%), Gaps = 24/144 (16%)

Query: 3   QCIIFIINIVVVFFIDVMGFFILMKCGADPFY------------SRIFSIAVAFLVTWIP 50
           + I + I  +   F+++ G F+     A                + +F   ++ L  ++ 
Sbjct: 236 EFIKYGITGLSGVFVNLGGQFLYNNVLAINVVEQIQSAISLPSGAIVFGFELSVLTNYLL 295

Query: 51  SRLFIFLKLRR----KSFLETVRYGVMYFMLSILNYAFYVKLLLTFQGLQP--------L 98
           + ++ F   R      + +  +++ V+  +  ++ ++ +  L+  FQ   P         
Sbjct: 296 NNVWTFSDRRNVGFWDNMIGFLKFNVISLLGFLIQFSTWFFLVKYFQIHYPDFLPYRLTY 355

Query: 99  LATVLSAVSSMLFVFLLYIRFMTR 122
           +  ++  + +    + L   F  +
Sbjct: 356 MGNIVGILLATATNYFLNRNFTWK 379


>gi|309778841|ref|ZP_07673612.1| GtrA family protein [Ralstonia sp. 5_7_47FAA]
 gi|308922365|gb|EFP67991.1| GtrA family protein [Ralstonia sp. 5_7_47FAA]
          Length = 154

 Score = 64.5 bits (156), Expect = 5e-09,   Method: Composition-based stats.
 Identities = 24/122 (19%), Positives = 51/122 (41%), Gaps = 3/122 (2%)

Query: 1   MKQCIIFIINIVVVFFIDVMGFFILMKCGADPFYSRIFSIAVAFLVTWIPSRLFIFLKLR 60
           ++Q   +++          +  F L++ G  P+ + +    +   + +  SR  +F    
Sbjct: 11  VEQFARYVVIGGGATLAHYVVLFGLVQVGVSPWRASVAGSVIGATLNYFISRQAVF-NST 69

Query: 61  RKSFLETVRYGVMYFMLSILNYAFYVKLLLTFQGLQPLLATVLSAVSSMLFVFLLYIRFM 120
           R      VR+G++ F+    N       L    GL  L+A V ++  + +F FL++  + 
Sbjct: 70  RGHIGAMVRFGLVAFLALGCNATIMAVGL--GIGLYYLIAQVFASSITAIFNFLVHRYWT 127

Query: 121 TR 122
            R
Sbjct: 128 FR 129



 Score = 36.0 bits (82), Expect = 1.8,   Method: Composition-based stats.
 Identities = 5/57 (8%), Positives = 21/57 (36%)

Query: 4   CIIFIINIVVVFFIDVMGFFILMKCGADPFYSRIFSIAVAFLVTWIPSRLFIFLKLR 60
            + F +   +    +     + +  G     +++F+ ++  +  ++  R + F    
Sbjct: 76  MVRFGLVAFLALGCNATIMAVGLGIGLYYLIAQVFASSITAIFNFLVHRYWTFRDAD 132


>gi|227534395|ref|ZP_03964444.1| GtcA family membrane protein [Lactobacillus paracasei subsp.
           paracasei ATCC 25302]
 gi|227188012|gb|EEI68079.1| GtcA family membrane protein [Lactobacillus paracasei subsp.
           paracasei ATCC 25302]
          Length = 159

 Score = 64.5 bits (156), Expect = 5e-09,   Method: Composition-based stats.
 Identities = 21/123 (17%), Positives = 44/123 (35%), Gaps = 3/123 (2%)

Query: 1   MKQCIIFIINIVVVFFIDVMGFFILMKCGADPFYSRIFSIAVAFLVTWIPSRLFIFLKLR 60
           +KQ I F +   V   +  + +  L +       +      +  +     +  ++F    
Sbjct: 29  LKQFIGFGLVGGVNTILTYLIYLTLYQLINP-TAAMGVGYGLTSIFGLFLNDTWVFKAKD 87

Query: 61  RKSFLE-TVRYGVMYFMLSILNYAFYVKLLLTFQGLQPLLATVLSAVSSMLFVFLLYIRF 119
           R+       RY + Y +  IL+          F  L   LA + + + ++   FLL   +
Sbjct: 88  RRQLKTVAPRYYLSYGLTFILSLVLTSFWN-DFLRLPKPLAPMFALMITVPTNFLLSKFW 146

Query: 120 MTR 122
           + R
Sbjct: 147 VFR 149


>gi|42518253|ref|NP_964183.1| hypothetical protein LJ0167 [Lactobacillus johnsonii NCC 533]
 gi|227888985|ref|ZP_04006790.1| gtrA family protein [Lactobacillus johnsonii ATCC 33200]
 gi|268318737|ref|YP_003292393.1| hypothetical protein FI9785_241 [Lactobacillus johnsonii FI9785]
 gi|41582537|gb|AAS08149.1| hypothetical protein LJ_0167 [Lactobacillus johnsonii NCC 533]
 gi|227850214|gb|EEJ60300.1| gtrA family protein [Lactobacillus johnsonii ATCC 33200]
 gi|262397112|emb|CAX66126.1| hypothetical protein predicted by Glimmer/Critica [Lactobacillus
           johnsonii FI9785]
 gi|329666563|gb|AEB92511.1| hypothetical protein LJP_0172 [Lactobacillus johnsonii DPC 6026]
          Length = 145

 Score = 64.5 bits (156), Expect = 5e-09,   Method: Composition-based stats.
 Identities = 19/128 (14%), Positives = 48/128 (37%), Gaps = 2/128 (1%)

Query: 1   MKQCIIFIINIVVVFFIDVMGFFILMKCGADPFYSRIFSIAVAFLVTWIPSRLFIFLKLR 60
           ++Q II+++  V+   +D   F IL         +   S +   +  +  +    F    
Sbjct: 13  LRQLIIYVLIGVLGLGVDFGIFAILTHFKMQVEVANFISSSCGLINNFFWNSFLNFKVHD 72

Query: 61  RKSFLETVRYGVMYFMLSILNYAFYVKLLLTFQGLQPLLATVLSAVSSMLFVFLLYIRFM 120
           +   +  + Y ++  + ++        + +T  G   L+   +S   + L  F++     
Sbjct: 73  K-LLVRFISYYLVGQITTLFTTVCL-FIFVTQLGYNQLIVKAVSTFIATLIQFVINKLLT 130

Query: 121 TRRVYFIK 128
            R++   K
Sbjct: 131 FRKIKTTK 138


>gi|302872325|ref|YP_003840961.1| GtrA family protein [Caldicellulosiruptor obsidiansis OB47]
 gi|302575184|gb|ADL42975.1| GtrA family protein [Caldicellulosiruptor obsidiansis OB47]
          Length = 159

 Score = 64.5 bits (156), Expect = 5e-09,   Method: Composition-based stats.
 Identities = 19/124 (15%), Positives = 51/124 (41%), Gaps = 4/124 (3%)

Query: 3   QCIIFIINIVVVFFIDVMGFFILMK-CGADPFYSRIFSIAVAFLVTWIPSRLFIFLKLRR 61
           + + F I  V+   ID   FF+       +  +S++F      + +++ ++ + F    +
Sbjct: 25  ELVKFSIVGVINTTIDFAVFFVCYSILHFNSSFSQVFGYTAGMVNSFLMNKKWTFEDSTK 84

Query: 62  KS--FLETVRYGVMYFMLSILNYAFYVKLLLTFQGLQPLLATVLSAVSSMLFVFLLYIRF 119
                L+ V++     +  +L+        L       L+A +L+ + +    ++LY  +
Sbjct: 85  GRIIILKVVKFAFTNIISLLLSIVMIKLSRLYLSN-SILIAKILATLCAQGVNYILYKFW 143

Query: 120 MTRR 123
           +  +
Sbjct: 144 VFTK 147


>gi|323703744|ref|ZP_08115383.1| GtrA family protein [Desulfotomaculum nigrificans DSM 574]
 gi|323531268|gb|EGB21168.1| GtrA family protein [Desulfotomaculum nigrificans DSM 574]
          Length = 133

 Score = 64.5 bits (156), Expect = 5e-09,   Method: Composition-based stats.
 Identities = 14/122 (11%), Positives = 53/122 (43%), Gaps = 2/122 (1%)

Query: 2   KQCIIFIINIVVVFFIDVMGFFILMKCGA-DPFYSRIFSIAVAFLVTWIPSRLFIFLKLR 60
           +  +IF +  +    ID + FF+L    +     +++ S +   + +++ ++ + F K  
Sbjct: 13  RSFVIFSLVGLSNTLIDYLVFFLLYHWFSAYYLLAQVISYSCGAVNSYLLNKYWTFQKKN 72

Query: 61  RKSFLETVRYGVMYFMLSILNYAFYVKLLLTFQGLQPLLATVLSAVSSMLFVFLLYIRFM 120
             +  E +R+ ++  ++  ++ +  + ++         +   ++  SS    ++    ++
Sbjct: 73  VPTGAEILRFIIINVLVLAVS-SLSLYVVTKNFSFNMFICKTIATGSSFAVNYIGNKFWV 131

Query: 121 TR 122
            +
Sbjct: 132 FK 133


>gi|295395837|ref|ZP_06806025.1| GtrA family protein [Brevibacterium mcbrellneri ATCC 49030]
 gi|294971372|gb|EFG47259.1| GtrA family protein [Brevibacterium mcbrellneri ATCC 49030]
          Length = 145

 Score = 64.5 bits (156), Expect = 5e-09,   Method: Composition-based stats.
 Identities = 22/127 (17%), Positives = 48/127 (37%), Gaps = 7/127 (5%)

Query: 3   QCIIFIINIVVVFFIDVMGFFILMK--CGADPFYSRIFSIAVAFLVTWIPSRLFIFLK-L 59
           +   F     V F +D + F +L        P +++I S+A+A  V+W+ SR + F    
Sbjct: 9   RVAKFSAVGTVAFIVDFLVFNLLRLEVLHLGPVWAKIISVALATTVSWLGSRYWTFTDGR 68

Query: 60  RRKSFLETVRYGVMYFMLSILNYAFYVKLLL----TFQGLQPLLATVLSAVSSMLFVFLL 115
            +    E + +  +     ++  A                  +   V+  +   +F + +
Sbjct: 69  NKSKTKEAIYFFSINGAGLLIALACLWVSHYLLGFRSALADNISGNVVGVLLGNIFRYFM 128

Query: 116 YIRFMTR 122
           Y  F+ +
Sbjct: 129 YRFFVFK 135



 Score = 33.3 bits (75), Expect = 9.7,   Method: Composition-based stats.
 Identities = 10/61 (16%), Positives = 25/61 (40%)

Query: 61  RKSFLETVRYGVMYFMLSILNYAFYVKLLLTFQGLQPLLATVLSAVSSMLFVFLLYIRFM 120
           R+  L   ++  +  +  I+++  +  L L    L P+ A ++S   +    +L    + 
Sbjct: 4   RRETLRVAKFSAVGTVAFIVDFLVFNLLRLEVLHLGPVWAKIISVALATTVSWLGSRYWT 63

Query: 121 T 121
            
Sbjct: 64  F 64


>gi|153954652|ref|YP_001395417.1| hypothetical protein CKL_2034 [Clostridium kluyveri DSM 555]
 gi|219855123|ref|YP_002472245.1| hypothetical protein CKR_1780 [Clostridium kluyveri NBRC 12016]
 gi|146347510|gb|EDK34046.1| Conserved hypothetical protein [Clostridium kluyveri DSM 555]
 gi|219568847|dbj|BAH06831.1| hypothetical protein [Clostridium kluyveri NBRC 12016]
          Length = 152

 Score = 64.5 bits (156), Expect = 5e-09,   Method: Composition-based stats.
 Identities = 25/125 (20%), Positives = 50/125 (40%), Gaps = 5/125 (4%)

Query: 2   KQCIIFIINIVVVFFIDVMGFFILMKC-GADPFYSRIFSIAVAFLVTWIPSRLFIFLKL- 59
           +    F     +   ID + F IL    G +   S+I S     L ++I ++ + F    
Sbjct: 18  RHITKFSCVGGLNTIIDFILFCILNSLFGVNYIISQIVSYGGGTLNSYILNKFWTFKDTE 77

Query: 60  -RRKSFLETVRYGVMYFMLSILNYAFYVKLLLTFQGLQPLLATVLSAVSSMLFVFLLYIR 118
            ++K+  E +++  +       + +     +L       LLA ++S V +    FL Y  
Sbjct: 78  VKKKTLKEIIQFIAVNSASL--SISLIGLSILMDNSFNSLLAKIISMVLAQGVNFLGYRF 135

Query: 119 FMTRR 123
           ++  R
Sbjct: 136 WVFGR 140


>gi|293193544|ref|ZP_06609814.1| putative integral membrane protein [Actinomyces odontolyticus
           F0309]
 gi|292819900|gb|EFF78902.1| putative integral membrane protein [Actinomyces odontolyticus
           F0309]
          Length = 191

 Score = 64.1 bits (155), Expect = 5e-09,   Method: Composition-based stats.
 Identities = 19/131 (14%), Positives = 42/131 (32%), Gaps = 10/131 (7%)

Query: 1   MKQCIIFIINIVVVFFIDVMGFFILMK-----CGADPFYSRIFSIAVAFLVTWIPSRLFI 55
           +++ I F +     + +D   F +L           P  ++  + A A L +WI +RL+ 
Sbjct: 55  VREFIQFGMVGATAYIVDAGLFNLLQHGPLGFLAGHPNTAQFVAAATATLYSWIANRLWT 114

Query: 56  FLKLRR-KSFLETVRYGVMYFMLSILNYAFYVKLLLTF----QGLQPLLATVLSAVSSML 110
           +    R  +  E + +         ++    +               +   V+       
Sbjct: 115 YRGRTRENATREAILFFFANACGIGISQFCLLFTHHILGFASALADNIAVYVVGFALGTA 174

Query: 111 FVFLLYIRFMT 121
           F F  Y   + 
Sbjct: 175 FRFFFYHYVVF 185


>gi|285019462|ref|YP_003377173.1| membrane protein involved in synthesis of cell surface
           polysaccharides [Xanthomonas albilineans GPE PC73]
 gi|283474680|emb|CBA17179.1| putative membrane protein involved in synthesis of cell surface
           polysaccharides [Xanthomonas albilineans]
          Length = 140

 Score = 64.1 bits (155), Expect = 5e-09,   Method: Composition-based stats.
 Identities = 17/122 (13%), Positives = 46/122 (37%), Gaps = 2/122 (1%)

Query: 1   MKQCIIFIINIVVVFFIDVMGFFILMKCGADPFYSRIFSIAVAFLVTWIPSRLFIFLKLR 60
           ++Q I++ +       +D+  + +L+    +   +     A   L+++  +R F F    
Sbjct: 13  LRQFILYAMCGGTGVMVDLSLYTLLIWLHVNYQAANAIGYAAGTLISFALNRHFTFQAYD 72

Query: 61  RKSFLETVRYGVMYFMLSILNYAFYVKLLLTFQGLQPLLATVLSAVSSMLFVFLLYIRFM 120
           + +      +     +  + + A    +L+   G  PL A + +    ++  F L     
Sbjct: 73  K-TLQRLSLFFAAALVGYLASSALL-WILVGVLGWAPLPAKLATLFFVLILQFSLNRAIT 130

Query: 121 TR 122
            +
Sbjct: 131 FK 132


>gi|258648016|ref|ZP_05735485.1| GtrA family protein [Prevotella tannerae ATCC 51259]
 gi|260851864|gb|EEX71733.1| GtrA family protein [Prevotella tannerae ATCC 51259]
          Length = 132

 Score = 64.1 bits (155), Expect = 5e-09,   Method: Composition-based stats.
 Identities = 17/124 (13%), Positives = 43/124 (34%), Gaps = 3/124 (2%)

Query: 4   CIIFIINIVVVFFIDVMGFFILMKCGADPFYSRIFSIAVAFLVTWIPSRLFIFLKLRRKS 63
            + +    ++   + +  +F+L + G     +   S     L +++ +RL++F     + 
Sbjct: 12  IVRYGAVGILNTLVTIATYFLLRRVGVGLDTANFLSYLAGILNSYVFNRLWVFRSRENRY 71

Query: 64  FLETVRYGVMYFMLSILNYAFYVKLLLTFQGLQPLLATVLSAVSSMLFVFLLYIRFMTRR 123
             E   +     +   L +  +  LLL    L    A ++         +L       +R
Sbjct: 72  LREGAVFFFGAALCWALQWVAFRLLLL---CLSERAAYLIGMCVYPGLNYLYNRLVTFKR 128

Query: 124 VYFI 127
              +
Sbjct: 129 NNRV 132


>gi|218906613|ref|YP_002454447.1| gtrA family protein [Bacillus cereus AH820]
 gi|218539220|gb|ACK91618.1| gtrA family protein [Bacillus cereus AH820]
          Length = 127

 Score = 64.1 bits (155), Expect = 5e-09,   Method: Composition-based stats.
 Identities = 16/121 (13%), Positives = 52/121 (42%), Gaps = 2/121 (1%)

Query: 1   MKQCIIFIINIVVVFFIDVMGFFILMKCGADPFYSRIFSIAVAFLVTWIPSRLFIFLKLR 60
           M++ + F +  +    I ++ F+IL+K G +   +   +  +    ++  ++ ++F    
Sbjct: 1   MEKLLKFGLVGIFNTLITIISFWILLKFGMNYLIANTIAYLIGVANSYYWNKNWVFKPNN 60

Query: 61  RKSFLETVRYGVMYFMLSILNYAFYVKLLLTFQGLQPLLATVLSAVSSMLFVFLLYIRFM 120
           + + +   ++  +  ++   N      +L+    +  L+A + +    M+  F+L   + 
Sbjct: 61  KSTSM-FFKFLTVNLIVLGFNTLCL-FILVDKLTVNKLIAQIFAIGVGMVINFVLNKIWT 118

Query: 121 T 121
            
Sbjct: 119 F 119


>gi|291542575|emb|CBL15685.1| GtrA-like protein./Glycosyl transferase family 2 [Ruminococcus
           bromii L2-63]
          Length = 354

 Score = 64.1 bits (155), Expect = 5e-09,   Method: Composition-based stats.
 Identities = 16/130 (12%), Positives = 48/130 (36%), Gaps = 8/130 (6%)

Query: 5   IIFIINIVVVFFIDVMGFFIL-----MKCGADPFYSRIFSIAVAFLVTWIPSRLFIFLKL 59
           + F    +    ID++ F I           +   + + +  V+  + ++ +R  IF   
Sbjct: 221 LRFATASIGCTIIDLVLFTIFAYILPSHMFFNIMLATLMARVVSGGINFLINRKVIFGNT 280

Query: 60  RRKSFLETVRYGVMYFMLSILNYAFYVKLLLTFQGLQPLLATVLSAVSSMLFVFLLYIRF 119
                 + +R+ +++F   I+  +  +   L F  +   L   +  +      + +   +
Sbjct: 281 DNG-AKQALRFFILFF--CIMCASSLIVSALWFLPIPVTLTKAIVDLLLWTVNYKMQRIW 337

Query: 120 MTRRVYFIKK 129
           + +    +K+
Sbjct: 338 VFKDSNRLKR 347


>gi|220909540|ref|YP_002484851.1| family 2 glycosyl transferase [Cyanothece sp. PCC 7425]
 gi|219866151|gb|ACL46490.1| glycosyl transferase family 2 [Cyanothece sp. PCC 7425]
          Length = 432

 Score = 64.1 bits (155), Expect = 5e-09,   Method: Composition-based stats.
 Identities = 18/130 (13%), Positives = 50/130 (38%), Gaps = 10/130 (7%)

Query: 3   QCIIFIINIVVVFFIDVMGFFILMKCGADPF-----YSRIFSIAVAFLVTWIPSRLFIFL 57
           +   F+    V F I+V+   +L+             + I SI ++ + ++   R +++ 
Sbjct: 14  RLTKFLFAGGVAFLINVLILALLINYWQWNTPILRNLANIVSIEISLVFSFFIYRTWVWP 73

Query: 58  KLRRK----SFLETVRYGVMYFMLSILNYAFYVKLLLTFQGLQPLLATVLSAVSSMLFVF 113
                       +   Y     M+ +L   F +  LL +  +   + T++  +   +  +
Sbjct: 74  GGSWSISEVILRQLPLYHFSGGMVILLRI-FLIFPLLDWLKVNYAINTLIGVLIGAIINY 132

Query: 114 LLYIRFMTRR 123
           ++  R + ++
Sbjct: 133 VINDRLIFQK 142


>gi|326384012|ref|ZP_08205695.1| glycosyl transferase family 2 protein [Gordonia neofelifaecis NRRL
           B-59395]
 gi|326197172|gb|EGD54363.1| glycosyl transferase family 2 protein [Gordonia neofelifaecis NRRL
           B-59395]
          Length = 407

 Score = 64.1 bits (155), Expect = 6e-09,   Method: Composition-based stats.
 Identities = 18/127 (14%), Positives = 41/127 (32%), Gaps = 7/127 (5%)

Query: 1   MKQCIIFIINIVVVFFIDVMGFFILMKCGADPFYSRIFSIAVAFLVTWIPSRLFIFLKLR 60
           + Q + F    V       + + +L   GA    +   ++A+  ++    +R F F    
Sbjct: 268 VGQLVRFCAVGVASTLAFALLYLVLRPLGAQG--ANFLALAITAVMNTAANRRFTFGVRG 325

Query: 61  RKSFLETVRYG-VMYFMLSILNYAFYVKLLLTFQGLQ---PLLATVLSAVSSMLFVFLLY 116
            +       +G  ++     +       L            L   V+S + +    F+  
Sbjct: 326 AEGRGRHHLFGWGVFLFGWAVTAGSLFALHRWQPDAGRGLELTVLVVSNLVATATRFVGL 385

Query: 117 IRFMTRR 123
             ++ RR
Sbjct: 386 R-WVFRR 391


>gi|224437969|ref|ZP_03658911.1| GtrA family protein [Helicobacter cinaedi CCUG 18818]
          Length = 133

 Score = 64.1 bits (155), Expect = 6e-09,   Method: Composition-based stats.
 Identities = 22/117 (18%), Positives = 45/117 (38%), Gaps = 2/117 (1%)

Query: 5   IIFIINIVVVFFIDVMGFFILMKCGADPFYSRIFSIAVAFLVTWIPSRLFIFLKLRRKSF 64
           I ++   VV   +     F LM  G  P  + I    V F+V+++ ++ + F        
Sbjct: 12  IKYLAVGVVNTLVGYGVIFALMWGGLMPELANIVGYGVGFIVSYLLNKRYTF-ASPASHK 70

Query: 65  LETVRYGVMYFMLSILNYAFYVKLLLTFQGLQPLLATVLSAVSSMLFVFLLYIRFMT 121
            +  R+G    +  I      +  L     + P LAT++ +   ++  F +   +  
Sbjct: 71  KDLPRFGFAMGLAYIAQLG-SMSALHRALEMNPYLATIIGSGVYVVVGFFVSRNWAF 126


>gi|297158648|gb|ADI08360.1| glycosyl transferase [Streptomyces bingchenggensis BCW-1]
          Length = 410

 Score = 64.1 bits (155), Expect = 6e-09,   Method: Composition-based stats.
 Identities = 18/125 (14%), Positives = 45/125 (36%), Gaps = 6/125 (4%)

Query: 2   KQCIIFIINIVVVFFIDVMGFFILMKCGADPFYSRIFSIAVAFLVTWIPSRLFIFLKLRR 61
           +Q + F +   +   +  +  + L + G  P  +   ++ ++ L     +R   F    R
Sbjct: 263 RQLVGFCVVGALSTLV-YLLLYSLFRLGTGPQIANALALLLSALGNTAANRRLTFGVRGR 321

Query: 62  KSFLE-----TVRYGVMYFMLSILNYAFYVKLLLTFQGLQPLLATVLSAVSSMLFVFLLY 116
              +       V +G+   + S    A       T      L   + + +++ +  FLL+
Sbjct: 322 DRAMRHQAQGLVVFGIGLALTSGSLAALDAAASGTPAHSTELAVLIAANLAATVLRFLLF 381

Query: 117 IRFMT 121
             ++ 
Sbjct: 382 RAWVF 386


>gi|229818405|ref|ZP_04448686.1| hypothetical protein BIFANG_03710 [Bifidobacterium angulatum DSM
           20098]
 gi|229784275|gb|EEP20389.1| hypothetical protein BIFANG_03710 [Bifidobacterium angulatum DSM
           20098]
          Length = 189

 Score = 64.1 bits (155), Expect = 6e-09,   Method: Composition-based stats.
 Identities = 18/132 (13%), Positives = 44/132 (33%), Gaps = 13/132 (9%)

Query: 1   MKQCIIFIINIVVVFFIDVMGFFILMKC-GADPFYSRIFSIAVAFLVTWIPSRLFIFLKL 59
           ++Q + F I  V+ F ID     +L+         +   S  ++ +  ++ S   +F   
Sbjct: 8   IEQLMKFGIVGVIAFIIDWGILNLLVGLFHMHNVLAATISFIISLIFNYVASMKVVFKHR 67

Query: 60  -RRKSFLETVRYGVMYFMLSILNYAFYVKLLLTFQGLQPL-----------LATVLSAVS 107
                ++E V + +   +   +N A              +           +  +++   
Sbjct: 68  DDMARWMEIVIFVIGAVIGLFMNDAIIWISTYGMNHDAYVSQSTEYLIRTNVGKLIATAV 127

Query: 108 SMLFVFLLYIRF 119
            M++ FL     
Sbjct: 128 VMVWNFLTRKWL 139



 Score = 35.3 bits (80), Expect = 2.7,   Method: Composition-based stats.
 Identities = 9/62 (14%), Positives = 33/62 (53%), Gaps = 1/62 (1%)

Query: 61  RKSFLETVRYGVMYFMLSILNYAFYVKLLLTFQGLQPLLATVLSAVSSMLFVFLLYIRFM 120
           +K   + +++G++  +  I+++      L+    +  +LA  +S + S++F ++  ++ +
Sbjct: 5   KKLIEQLMKFGIVGVIAFIIDWGILNL-LVGLFHMHNVLAATISFIISLIFNYVASMKVV 63

Query: 121 TR 122
            +
Sbjct: 64  FK 65


>gi|218134178|ref|ZP_03462982.1| hypothetical protein BACPEC_02068 [Bacteroides pectinophilus ATCC
           43243]
 gi|217991553|gb|EEC57559.1| hypothetical protein BACPEC_02068 [Bacteroides pectinophilus ATCC
           43243]
          Length = 352

 Score = 64.1 bits (155), Expect = 6e-09,   Method: Composition-based stats.
 Identities = 19/129 (14%), Positives = 50/129 (38%), Gaps = 10/129 (7%)

Query: 4   CIIFIINIVVVFFIDVMGFFILMKC-------GADPFYSRIFSIAVAFLVTWIPSRLFIF 56
            + F+ + +    ID+  F I+              F + + +  ++ L  +  +R  +F
Sbjct: 225 ILKFMASSLASSGIDLGAFAIIRWLCVKVMETKTAVFTATVTARIISSLFNYTMNRKAVF 284

Query: 57  LKLRRKSFLETVRYGVMYFMLSILNYAFYVK--LLLTFQGLQPLLATVLSAVSSMLFVFL 114
                      VRY ++  +  +++Y        +L+  G+  +++  +      L  F 
Sbjct: 285 KDDGN-VGKSLVRYYILCVVQMLVSYYLVWMVTDVLSLGGVLTVVSKAVIDTILFLISFQ 343

Query: 115 LYIRFMTRR 123
           +  R++ R+
Sbjct: 344 IQRRWVFRK 352


>gi|283795469|ref|ZP_06344622.1| putative teichoic acid glycosylation protein [Clostridium sp.
           M62/1]
 gi|291077132|gb|EFE14496.1| putative teichoic acid glycosylation protein [Clostridium sp.
           M62/1]
          Length = 186

 Score = 64.1 bits (155), Expect = 6e-09,   Method: Composition-based stats.
 Identities = 20/124 (16%), Positives = 51/124 (41%), Gaps = 4/124 (3%)

Query: 2   KQCIIFIINIVVVFFIDVMGFFILMKCGADPFYSRIFSIAVAFLVTWIPSRLFIFLKLRR 61
           ++ + + I  V+   +D +G+F+L   G    +S+  S   A L  ++ +++++F     
Sbjct: 58  RETVSYFIFGVLTTAVDWVGYFVLYYMGYSVVFSQTISFVAAVLFAFVTNKIYVFQSKTL 117

Query: 62  KSFL---ETVRYGVMYFMLSILNYAFYVKLLLTFQGLQPLLATVLSAVSSMLFVFLLYIR 118
                  E   +        ++  A     ++   G   L+  +  +  S++  ++L   
Sbjct: 118 HPAKLLNELTSFVACRLFTGVITIAGMEI-MVNGLGWPNLIGKIAVSAVSLVLNYVLSKL 176

Query: 119 FMTR 122
           F+ R
Sbjct: 177 FIFR 180


>gi|331087963|ref|ZP_08336886.1| hypothetical protein HMPREF1025_00469 [Lachnospiraceae bacterium
           3_1_46FAA]
 gi|330409274|gb|EGG88723.1| hypothetical protein HMPREF1025_00469 [Lachnospiraceae bacterium
           3_1_46FAA]
          Length = 355

 Score = 64.1 bits (155), Expect = 6e-09,   Method: Composition-based stats.
 Identities = 14/128 (10%), Positives = 43/128 (33%), Gaps = 9/128 (7%)

Query: 2   KQCIIFIINIVVVFFIDVMGFFILMKC------GADPFYSRIFSIAVAFLVTWIPSRLFI 55
           K+ + F  +  + F +D   +   +        G     S + +  ++    +  +R  +
Sbjct: 223 KEILKFSASSFLSFLLDYGMYSAFLWVMRGTAKGFSVLCSNVAARIISGCFNYHINRKLV 282

Query: 56  FLKLRRKSFLETVRYGVMYFMLSILNYAFYVKLLLTFQGLQPLLATVLSAVSSMLFVFLL 115
           F K    + +      +   +L+          L    G+   +A   + +   +  + +
Sbjct: 283 FQKETNTTAMAAEYVFLAAGILAGNTLIL---ELFVGAGMNRYVAKPCTELLFFMISWFV 339

Query: 116 YIRFMTRR 123
              F+ ++
Sbjct: 340 QRTFIFKQ 347


>gi|218260139|ref|ZP_03475563.1| hypothetical protein PRABACTJOHN_01224 [Parabacteroides johnsonii
           DSM 18315]
 gi|218224723|gb|EEC97373.1| hypothetical protein PRABACTJOHN_01224 [Parabacteroides johnsonii
           DSM 18315]
          Length = 127

 Score = 64.1 bits (155), Expect = 6e-09,   Method: Composition-based stats.
 Identities = 22/123 (17%), Positives = 48/123 (39%), Gaps = 2/123 (1%)

Query: 1   MKQCIIFIINIVVVFFIDVMGFFILMKC-GADPFYSRIFSIAVAFLVTWIPSRLFIFLKL 59
           +KQ I + I  V    I  +  +I+MK  G     S +       L ++I ++ + F   
Sbjct: 5   VKQAIKYGIVGVSNTVITAVVIWIMMKLFGCSDVVSNMVGYIAGVLNSFIWNKQWTFRSS 64

Query: 60  RRKSFLETVRYGVMYFMLSILNYAFYVKLLLTFQGLQPLLATVLSAVSSMLFVFLLYIRF 119
                    R+GV++ +  +L     V +L     + P    +++     +  F++   +
Sbjct: 65  A-GWIGSAARFGVVFGVCYLLQLGLLVYVLNPLLSIDPYYNQLIAMAFYTVINFIMNKFY 123

Query: 120 MTR 122
             +
Sbjct: 124 TFK 126


>gi|154492693|ref|ZP_02032319.1| hypothetical protein PARMER_02330 [Parabacteroides merdae ATCC
           43184]
 gi|154086998|gb|EDN86043.1| hypothetical protein PARMER_02330 [Parabacteroides merdae ATCC
           43184]
          Length = 127

 Score = 64.1 bits (155), Expect = 6e-09,   Method: Composition-based stats.
 Identities = 23/123 (18%), Positives = 50/123 (40%), Gaps = 2/123 (1%)

Query: 1   MKQCIIFIINIVVVFFIDVMGFFILMKC-GADPFYSRIFSIAVAFLVTWIPSRLFIFLKL 59
           +KQ I + I  V    I  +  +I+MK  G     S +       L ++I ++ + F   
Sbjct: 5   VKQAIKYGIVGVSNTVITAVVIWIMMKLFGCSDVVSNMVGYVAGVLNSFIWNKQWTFRSS 64

Query: 60  RRKSFLETVRYGVMYFMLSILNYAFYVKLLLTFQGLQPLLATVLSAVSSMLFVFLLYIRF 119
                   VR+GV++ +  +L     V +L  +  + P    +++     +  F++   +
Sbjct: 65  A-GWIGSAVRFGVVFGVCYLLQLGLLVYVLNPYLSIDPYYNQLIAMAFYTVINFIMNKFY 123

Query: 120 MTR 122
             +
Sbjct: 124 TFK 126


>gi|302875245|ref|YP_003843878.1| glycosyl transferase family 2 [Clostridium cellulovorans 743B]
 gi|307687902|ref|ZP_07630348.1| glycosyl transferase family 2 [Clostridium cellulovorans 743B]
 gi|302578102|gb|ADL52114.1| glycosyl transferase family 2 [Clostridium cellulovorans 743B]
          Length = 334

 Score = 64.1 bits (155), Expect = 6e-09,   Method: Composition-based stats.
 Identities = 19/118 (16%), Positives = 45/118 (38%), Gaps = 3/118 (2%)

Query: 4   CIIFIINIVVVFFIDVMGFFILMKCGADPFYSRIFSIAVAFLVTWIPSRLFIFLKLRRKS 63
            I F    ++   +D +    + K   + F +   S   + L  +  +R  +F    +  
Sbjct: 219 MIKFSAVSLLSGVLDFVLLLGIEKILGNLFVAVFLSRLCSSLFNYGCNRNLVFNSKGK-- 276

Query: 64  FLETVRYGVMYFMLSILNYAFYVKLLLTFQGLQPLLATVLSAVSSMLFVFLLYIRFMT 121
               V+Y  +  ++ + NY        +   L  +L+ V++     LF ++   +F+ 
Sbjct: 277 VNSFVKYYFLVLVVLVCNYVMMSL-FTSTLMLPLVLSKVITEAILFLFSYISQRKFVF 333


>gi|297192425|ref|ZP_06909823.1| dolichol-phosphate mannosyltransferase [Streptomyces
           pristinaespiralis ATCC 25486]
 gi|197717961|gb|EDY61869.1| dolichol-phosphate mannosyltransferase [Streptomyces
           pristinaespiralis ATCC 25486]
          Length = 402

 Score = 64.1 bits (155), Expect = 7e-09,   Method: Composition-based stats.
 Identities = 16/123 (13%), Positives = 44/123 (35%), Gaps = 3/123 (2%)

Query: 1   MKQCIIFIINIVVVFFIDVMGFFILMKCGADPFYSRIFSIAVAFLVTWIPSRLFIFLKLR 60
           M + + F +  +  F  +++   +L   G     + I +        ++   + +F   R
Sbjct: 260 MARMVAFGLIGLTGFVPNLLALHLLTGAGMHYLPAEIVANQFGVAWNFLLIEVLLFRDRR 319

Query: 61  RKSFL--ETVRYGVMYFMLSILNYAFYVKLLLTFQGLQPLLATVLSAVSSMLFVFLLYIR 118
           R         R+ ++     +L         +++  +  L AT L+ +++ +  F     
Sbjct: 320 RHRHWADRAGRFALLANADLLLRIPLIAL-FVSWLDMAVLPATALALLTTFVVRFAATEA 378

Query: 119 FMT 121
            + 
Sbjct: 379 LVY 381



 Score = 36.4 bits (83), Expect = 1.3,   Method: Composition-based stats.
 Identities = 13/64 (20%), Positives = 25/64 (39%), Gaps = 2/64 (3%)

Query: 59  LRRKSFLETVRYGVMYFMLSILNYAFYVKLLLTFQGLQPLLATVLSAVSSMLFVFLLYIR 118
               +    V +G++     + N       LLT  G+  L A +++    + + FLL   
Sbjct: 255 RTASAMARMVAFGLIGLTGFVPNLLALH--LLTGAGMHYLPAEIVANQFGVAWNFLLIEV 312

Query: 119 FMTR 122
            + R
Sbjct: 313 LLFR 316


>gi|298345604|ref|YP_003718291.1| hypothetical protein HMPREF0573_10478 [Mobiluncus curtisii ATCC
           43063]
 gi|304390707|ref|ZP_07372660.1| conserved hypothetical protein [Mobiluncus curtisii subsp. curtisii
           ATCC 35241]
 gi|315657899|ref|ZP_07910779.1| conserved hypothetical protein [Mobiluncus curtisii subsp. holmesii
           ATCC 35242]
 gi|298235665|gb|ADI66797.1| conserved hypothetical protein [Mobiluncus curtisii ATCC 43063]
 gi|304326463|gb|EFL93708.1| conserved hypothetical protein [Mobiluncus curtisii subsp. curtisii
           ATCC 35241]
 gi|315491696|gb|EFU81307.1| conserved hypothetical protein [Mobiluncus curtisii subsp. holmesii
           ATCC 35242]
          Length = 147

 Score = 63.8 bits (154), Expect = 7e-09,   Method: Composition-based stats.
 Identities = 23/119 (19%), Positives = 47/119 (39%), Gaps = 1/119 (0%)

Query: 2   KQCIIFIINIVVVFFIDVMGFFILMKC-GADPFYSRIFSIAVAFLVTWIPSRLFIFLKLR 60
           +Q I F I  ++ FFID   F +L K  G     + + S  V+    +  S  ++F    
Sbjct: 21  RQIIGFGIVGLLAFFIDYALFALLYKIVGIHYLIAAVISFCVSLAFNYAASMRYVFRHKS 80

Query: 61  RKSFLETVRYGVMYFMLSILNYAFYVKLLLTFQGLQPLLATVLSAVSSMLFVFLLYIRF 119
             +    V    +  ++ +      + +      ++PL+  +L+ V    + F+    F
Sbjct: 81  DMTRRREVVLFFVGAVIGLGINEIMLYVGDVVFCIEPLITKILATVVVAAWNFVTRKIF 139


>gi|219853924|ref|YP_002471046.1| hypothetical protein CKR_0581 [Clostridium kluyveri NBRC 12016]
 gi|219567648|dbj|BAH05632.1| hypothetical protein [Clostridium kluyveri NBRC 12016]
          Length = 151

 Score = 63.8 bits (154), Expect = 7e-09,   Method: Composition-based stats.
 Identities = 19/124 (15%), Positives = 47/124 (37%), Gaps = 4/124 (3%)

Query: 1   MKQCIIFIINIVVVFFIDVMGFFIL-MKCGADPFYSRIFSIAVAFLVTWIPSRLFIF--L 57
           +K    F    V+   +D   F I     G     S++       + ++I ++ + F   
Sbjct: 28  LKCISRFSATGVLNTLVDFCVFTICESLFGIHYALSQVLGYGFGIINSFIMNKKWTFESK 87

Query: 58  KLRRKSFLETVRYGVMYFMLSILNYAFYVKLLLTFQGLQPLLATVLSAVSSMLFVFLLYI 117
              +K + E +++ V+      +        L+    +   ++ V+  + + +  FLLY 
Sbjct: 88  ASNKKVYHELIQFIVVNVCSLTITVVCMKL-LVNNFSINIYISKVIVTLIAQVVNFLLYK 146

Query: 118 RFMT 121
            ++ 
Sbjct: 147 LWVF 150


>gi|332671000|ref|YP_004454008.1| GtrA family protein [Cellulomonas fimi ATCC 484]
 gi|332340038|gb|AEE46621.1| GtrA family protein [Cellulomonas fimi ATCC 484]
          Length = 158

 Score = 63.8 bits (154), Expect = 7e-09,   Method: Composition-based stats.
 Identities = 22/130 (16%), Positives = 50/130 (38%), Gaps = 9/130 (6%)

Query: 4   CIIFIINIVVVFFIDVMGFFILMKCGADPFYSRIFSIAVAFLVTWIPSRLFIFLKLRRKS 63
              F    V+   +D   + +L   G  P  + + S     +V+++ +  F+F       
Sbjct: 21  LARFASVGVINTLVDFGVYVLLFALGTAPVLANLISTTAGLIVSFLGNSRFVFRSTG-GR 79

Query: 64  FLETVRYGVMYFMLSIL--------NYAFYVKLLLTFQGLQPLLATVLSAVSSMLFVFLL 115
             +  R+ ++  +   +          A    L +   G+   +A  L+   + ++ +LL
Sbjct: 80  RGQVARFVLVAGIGIWVIQPAVILGVTAALDGLGVAHVGVVGAVAKTLAIGVAAVWNYLL 139

Query: 116 YIRFMTRRVY 125
           Y RF+ R  +
Sbjct: 140 YSRFVFRSRH 149


>gi|320457159|dbj|BAJ67780.1| conserved hypothetical protein [Bifidobacterium longum subsp.
           infantis ATCC 15697]
          Length = 186

 Score = 63.8 bits (154), Expect = 7e-09,   Method: Composition-based stats.
 Identities = 19/132 (14%), Positives = 46/132 (34%), Gaps = 13/132 (9%)

Query: 1   MKQCIIFIINIVVVFFIDVMGFFILM-KCGADPFYSRIFSIAVAFLVTWIPSRLFIFLKL 59
           ++Q + F I  V+ F ID     +L+         +   S  ++ +  ++ S  F+F   
Sbjct: 5   IEQLMKFGIVGVIAFVIDWGILNLLVGIFHMHNVLAATISFIISLIFNYLASMKFVFKHR 64

Query: 60  -RRKSFLETVRYGVMYFMLSILNYAFYVKLLLTFQGLQPL-----------LATVLSAVS 107
                ++E + + V   +   +N A              +           +  +++   
Sbjct: 65  DDMARWMEILIFVVGAVVGLFMNDAIIWISTYGMNHDAYVSQHAEYLLRTNIGKLVATAV 124

Query: 108 SMLFVFLLYIRF 119
            M++ FL+    
Sbjct: 125 VMIWNFLIRKWL 136



 Score = 35.6 bits (81), Expect = 2.2,   Method: Composition-based stats.
 Identities = 11/62 (17%), Positives = 34/62 (54%), Gaps = 1/62 (1%)

Query: 61  RKSFLETVRYGVMYFMLSILNYAFYVKLLLTFQGLQPLLATVLSAVSSMLFVFLLYIRFM 120
           RK   + +++G++  +  ++++      L+    +  +LA  +S + S++F +L  ++F+
Sbjct: 2   RKLIEQLMKFGIVGVIAFVIDWGILNL-LVGIFHMHNVLAATISFIISLIFNYLASMKFV 60

Query: 121 TR 122
            +
Sbjct: 61  FK 62


>gi|114328112|ref|YP_745269.1| hypothetical protein GbCGDNIH1_1448 [Granulibacter bethesdensis
           CGDNIH1]
 gi|114316286|gb|ABI62346.1| hypothetical protein GbCGDNIH1_1448 [Granulibacter bethesdensis
           CGDNIH1]
          Length = 149

 Score = 63.8 bits (154), Expect = 7e-09,   Method: Composition-based stats.
 Identities = 20/128 (15%), Positives = 48/128 (37%), Gaps = 9/128 (7%)

Query: 3   QCIIFIINIVVVFFIDVMGFFILMKCGADPFYSRIFSIAVAFLVTWIPSRLFIFL----- 57
           Q + F +  V+ F +D    +         +++ I +  VA    W+ +R++ F      
Sbjct: 23  QFLRFGMVGVMGFMVDTATVYASRYW-LGLYWAGILAYCVAASANWLVNRIWTFRNHAAT 81

Query: 58  -KLRRKSFLETVRYGVMYFMLSILNYAFYVKLLLTFQ--GLQPLLATVLSAVSSMLFVFL 114
                 +  +  ++     + ++LN   Y+ L+         P++     A+  +   + 
Sbjct: 82  DGKHAHAGKQWAKFLAANLVGAVLNRGTYMLLITIVPFCAAHPVVPLAAGAIMGLGVNYE 141

Query: 115 LYIRFMTR 122
           L  R + R
Sbjct: 142 LSRRVVFR 149


>gi|116747579|ref|YP_844266.1| glycosyl transferase family protein [Syntrophobacter fumaroxidans
           MPOB]
 gi|116696643|gb|ABK15831.1| glycosyl transferase, family 2 [Syntrophobacter fumaroxidans MPOB]
          Length = 393

 Score = 63.8 bits (154), Expect = 7e-09,   Method: Composition-based stats.
 Identities = 23/120 (19%), Positives = 51/120 (42%), Gaps = 3/120 (2%)

Query: 3   QCIIFIINIVVVFFIDVMGFFILMKCGADPFYSRIFSIAVAFLVTWIPSRLFIFLKL-RR 61
           Q +I+++   +    ++  F   +  G     S   +   A  + ++     +F    R 
Sbjct: 260 QFLIYLLIGGLSALFNLFLFLGTLALGWTAPLSAATAYVAAAGMNYLLCIALLFRHKARW 319

Query: 62  KSFLETVRYGVMYFMLSILNYAFYVKLLLTFQGLQPLLATVLSAVSSMLFVFLLYIRFMT 121
            S +E   Y ++  ++ +L+      LLL+  G+ P LA   ++V+ ++  FL    F+ 
Sbjct: 320 NSLMELAVYCLIVILVGVLDVGLTHVLLLS--GMAPWLAKSAASVAGLILNFLGRKYFVF 377



 Score = 35.3 bits (80), Expect = 2.8,   Method: Composition-based stats.
 Identities = 8/66 (12%), Positives = 31/66 (46%)

Query: 1   MKQCIIFIINIVVVFFIDVMGFFILMKCGADPFYSRIFSIAVAFLVTWIPSRLFIFLKLR 60
           + +  ++ + +++V  +DV    +L+  G  P+ ++  +     ++ ++  + F+F +  
Sbjct: 322 LMELAVYCLIVILVGVLDVGLTHVLLLSGMAPWLAKSAASVAGLILNFLGRKYFVFPQPS 381

Query: 61  RKSFLE 66
              +  
Sbjct: 382 AGPWKS 387


>gi|226364246|ref|YP_002782028.1| glycosyltransferase [Rhodococcus opacus B4]
 gi|226242735|dbj|BAH53083.1| putative glycosyltransferase [Rhodococcus opacus B4]
          Length = 417

 Score = 63.8 bits (154), Expect = 7e-09,   Method: Composition-based stats.
 Identities = 14/126 (11%), Positives = 40/126 (31%), Gaps = 6/126 (4%)

Query: 1   MKQCIIFIINIVVVFFIDVMGFFILMKCGADPFYSRIFSIAVAFLVTWIPSRLFIFLKLR 60
           + Q   F +  V    +     ++++       ++   S+ V  ++    +R F F    
Sbjct: 285 VGQMARFAVIGVAST-VAYALLYLVLHPVLGAQWANAVSLLVTAVLNTAANRAFTFGVRG 343

Query: 61  R----KSFLETVRYGVMYFMLSILNYAFYVKLLLTFQGLQPLLATVLSAVSSMLFVFLLY 116
                +  ++ +        L+  +                L   VL+ + + +  F+  
Sbjct: 344 SEGAARHQMQGLLVFAFGLFLTSGSLYVLHSAAPDASKHVELAVLVLANLVATISRFIAL 403

Query: 117 IRFMTR 122
             ++ R
Sbjct: 404 R-WVFR 408


>gi|238852813|ref|ZP_04643218.1| conserved hypothetical protein [Lactobacillus gasseri 202-4]
 gi|282852510|ref|ZP_06261852.1| GtrA-like protein [Lactobacillus gasseri 224-1]
 gi|311111328|ref|ZP_07712725.1| conserved hypothetical protein [Lactobacillus gasseri MV-22]
 gi|238834507|gb|EEQ26739.1| conserved hypothetical protein [Lactobacillus gasseri 202-4]
 gi|282556252|gb|EFB61872.1| GtrA-like protein [Lactobacillus gasseri 224-1]
 gi|311066482|gb|EFQ46822.1| conserved hypothetical protein [Lactobacillus gasseri MV-22]
          Length = 145

 Score = 63.8 bits (154), Expect = 7e-09,   Method: Composition-based stats.
 Identities = 19/128 (14%), Positives = 48/128 (37%), Gaps = 2/128 (1%)

Query: 1   MKQCIIFIINIVVVFFIDVMGFFILMKCGADPFYSRIFSIAVAFLVTWIPSRLFIFLKLR 60
           ++Q II+++  V+   +D   F +L         +   S +   +  +  +    F    
Sbjct: 13  LRQLIIYVLIGVLGLGVDFGIFALLTHFKMQVEVANFISSSCGLINNFFWNSFLNFKVHD 72

Query: 61  RKSFLETVRYGVMYFMLSILNYAFYVKLLLTFQGLQPLLATVLSAVSSMLFVFLLYIRFM 120
           +   +  V Y ++  + ++        + +T  G   L+   +S   + L  F++     
Sbjct: 73  K-LLIRFVSYYLVGQITTLFTTLCL-FIFVTQLGYNQLIVKAVSTFIATLIQFVINKLLT 130

Query: 121 TRRVYFIK 128
            R++   K
Sbjct: 131 FRKIKTTK 138


>gi|23465068|ref|NP_695671.1| hypothetical protein BL0476 [Bifidobacterium longum NCC2705]
 gi|23325678|gb|AAN24307.1| narrowly conserved hypothetical membrane protein [Bifidobacterium
           longum NCC2705]
          Length = 205

 Score = 63.8 bits (154), Expect = 7e-09,   Method: Composition-based stats.
 Identities = 18/132 (13%), Positives = 45/132 (34%), Gaps = 13/132 (9%)

Query: 1   MKQCIIFIINIVVVFFIDVMGFFILM-KCGADPFYSRIFSIAVAFLVTWIPSRLFIFLKL 59
           ++Q + F I  V+ F ID     +L+         +   S  ++ +  ++ S  F+F   
Sbjct: 24  IEQLMKFGIVGVIAFVIDWGILNLLVGIFHMHNVLAATVSFIISLIFNYLASMKFVFKHR 83

Query: 60  -RRKSFLETVRYGVMYFMLSILNYAFYVKLLLTFQGLQPL-----------LATVLSAVS 107
                ++E + +     +   +N A              +           +  +++   
Sbjct: 84  DDMARWMEILIFVAGAVVGLFMNDAIIWISTYGMNHDAYVSQHAEYLLRTNIGKLVATAV 143

Query: 108 SMLFVFLLYIRF 119
            M++ FL+    
Sbjct: 144 VMIWNFLIRKWL 155



 Score = 35.6 bits (81), Expect = 2.1,   Method: Composition-based stats.
 Identities = 11/62 (17%), Positives = 34/62 (54%), Gaps = 1/62 (1%)

Query: 61  RKSFLETVRYGVMYFMLSILNYAFYVKLLLTFQGLQPLLATVLSAVSSMLFVFLLYIRFM 120
           RK   + +++G++  +  ++++      L+    +  +LA  +S + S++F +L  ++F+
Sbjct: 21  RKLIEQLMKFGIVGVIAFVIDWGILNL-LVGIFHMHNVLAATVSFIISLIFNYLASMKFV 79

Query: 121 TR 122
            +
Sbjct: 80  FK 81


>gi|126466205|ref|YP_001041314.1| GtrA family protein [Staphylothermus marinus F1]
 gi|126015028|gb|ABN70406.1| GtrA family protein [Staphylothermus marinus F1]
          Length = 296

 Score = 63.8 bits (154), Expect = 7e-09,   Method: Composition-based stats.
 Identities = 17/133 (12%), Positives = 44/133 (33%), Gaps = 15/133 (11%)

Query: 3   QCIIFIINIVVVFFIDVMG---------FFILMKCGADPFYSRIFSIAVAFLVTWIPSRL 53
           + I F +  +  FFI+ +           + ++      F + I     +    +I   L
Sbjct: 162 RIIKFALVGLSGFFINYLTVAQVLSLLTTYSILYQTTSHFIASIMGFETSLTWNFILHEL 221

Query: 54  FIFLKLRRK-----SFLETVRYGVMYFMLSILNYAFYVKLLLTFQGLQPLLATVLSAVSS 108
           + F  L+            ++Y  +  + S +     V +L    G   L +  +  +  
Sbjct: 222 WTFRDLKLSKGLFARIKRWLKYH-VASIGSFITQTTSVTILSGIIGAPLLFSVAIGVMLG 280

Query: 109 MLFVFLLYIRFMT 121
            +  +++   +  
Sbjct: 281 FIVNYMIGRFYTW 293


>gi|317502356|ref|ZP_07960522.1| hypothetical protein HMPREF1026_02466 [Lachnospiraceae bacterium
           8_1_57FAA]
 gi|331089957|ref|ZP_08338848.1| hypothetical protein HMPREF1025_02431 [Lachnospiraceae bacterium
           3_1_46FAA]
 gi|316896229|gb|EFV18334.1| hypothetical protein HMPREF1026_02466 [Lachnospiraceae bacterium
           8_1_57FAA]
 gi|330403095|gb|EGG82658.1| hypothetical protein HMPREF1025_02431 [Lachnospiraceae bacterium
           3_1_46FAA]
          Length = 148

 Score = 63.8 bits (154), Expect = 8e-09,   Method: Composition-based stats.
 Identities = 15/121 (12%), Positives = 48/121 (39%), Gaps = 2/121 (1%)

Query: 2   KQCIIFIINIVVVFFIDVMGFFILMKCGADPFYSRIFSIAVAFLVTWIPSRLFIFLKLRR 61
           K+ + +II   +   ++ M + + +        S   +   A +  ++ +R ++F   RR
Sbjct: 8   KELLTYIITGGITTGVNYMLYGLFLFFHVPYIASNSIAWTGAVIAAYVLNRKWVFRSNRR 67

Query: 62  KSFLETVRYGVMYFMLSILNYAFYVKLLLTFQGLQPLLATVLSAVSSMLFVFLLYIRFMT 121
               E   +  + F+  ++         +    L  + + ++ +V +++  + L    + 
Sbjct: 68  -IPEEFFSFAALRFITLLVENVLLWLA-VDQLSLSLIGSKLIVSVVTVIGNYALCKYRVF 125

Query: 122 R 122
           +
Sbjct: 126 K 126


>gi|300362502|ref|ZP_07058678.1| conserved hypothetical protein [Lactobacillus gasseri JV-V03]
 gi|300353493|gb|EFJ69365.1| conserved hypothetical protein [Lactobacillus gasseri JV-V03]
          Length = 145

 Score = 63.8 bits (154), Expect = 8e-09,   Method: Composition-based stats.
 Identities = 19/128 (14%), Positives = 48/128 (37%), Gaps = 2/128 (1%)

Query: 1   MKQCIIFIINIVVVFFIDVMGFFILMKCGADPFYSRIFSIAVAFLVTWIPSRLFIFLKLR 60
           ++Q II+++  V+   +D   F +L         +   S +   +  +  +    F    
Sbjct: 13  LRQLIIYVLIGVLGLGVDFGIFALLTHFKMQVEVANFISSSCGLINNFFWNSFLNFKVHD 72

Query: 61  RKSFLETVRYGVMYFMLSILNYAFYVKLLLTFQGLQPLLATVLSAVSSMLFVFLLYIRFM 120
           +   +  V Y ++  + ++        + +T  G   L+   +S   + L  F++     
Sbjct: 73  K-LLIRFVSYYLVGQITTLFTTLCL-FIFVTQLGYNQLIVKAVSTFIATLIQFVINKLLT 130

Query: 121 TRRVYFIK 128
            R++   K
Sbjct: 131 FRKIKTTK 138


>gi|284992731|ref|YP_003411285.1| GtrA family protein [Geodermatophilus obscurus DSM 43160]
 gi|284065976|gb|ADB76914.1| GtrA family protein [Geodermatophilus obscurus DSM 43160]
          Length = 151

 Score = 63.8 bits (154), Expect = 8e-09,   Method: Composition-based stats.
 Identities = 21/126 (16%), Positives = 44/126 (34%), Gaps = 5/126 (3%)

Query: 1   MKQCIIFIINIVVVFFIDVMGFFILM-KCGADPFYSRIFSIAVAFLVTWIPSRLFIFLKL 59
           ++    F +   + F I+V  F +L    G+    ++  +  VA  V +   R + F   
Sbjct: 19  VRHLGAFGVVGGIGFVIEVGLFQLLYGHLGSGAVMAKAVATVVAMTVAFFGHRHWSFAHR 78

Query: 60  RRKSF-LETVRYGVMYFMLSILNYAFYVKLLLTFQGLQPLL---ATVLSAVSSMLFVFLL 115
            R  F  E   +  +  +  +L                      A ++S     +  +L+
Sbjct: 79  ARTGFKREYPMFLAINGLTLLLGLGIVAFARYGLDLTSAWALQGANLVSIAVGTVVRYLM 138

Query: 116 YIRFMT 121
           Y R++ 
Sbjct: 139 YRRWVF 144


>gi|152996671|ref|YP_001341506.1| GtrA family protein [Marinomonas sp. MWYL1]
 gi|150837595|gb|ABR71571.1| GtrA family protein [Marinomonas sp. MWYL1]
          Length = 146

 Score = 63.8 bits (154), Expect = 8e-09,   Method: Composition-based stats.
 Identities = 20/134 (14%), Positives = 46/134 (34%), Gaps = 17/134 (12%)

Query: 4   CIIFIINIVVVFFIDVMGFFILMKCGADPFYSRIFSIAVAFLVTWIPSRLFIFLK----- 58
            + F I     F +D+    +L+        +R  +  VA    W  +R   F       
Sbjct: 9   FVRFAIVGGAGFLVDLTCM-LLLSIWLPHLVARGIAFWVAASSNWWWNRTITFTDPKQEK 67

Query: 59  ---LRRKSFLETVRYGVMYFMLSILNYAFYVKLLLTFQ--------GLQPLLATVLSAVS 107
               ++ + L+ +++     +  + N+  Y+ L+             L P LA +   + 
Sbjct: 68  ASNSKKAAALQWIQFLGSSVIAFVPNWGCYLILMSQPPATSNSTLIILWPYLAMIPGILI 127

Query: 108 SMLFVFLLYIRFMT 121
            M+  +     ++ 
Sbjct: 128 GMMLNYAFSRFWVF 141


>gi|220913372|ref|YP_002488681.1| glycosyl transferase family 2 [Arthrobacter chlorophenolicus A6]
 gi|219860250|gb|ACL40592.1| glycosyl transferase family 2 [Arthrobacter chlorophenolicus A6]
          Length = 412

 Score = 63.8 bits (154), Expect = 8e-09,   Method: Composition-based stats.
 Identities = 18/124 (14%), Positives = 45/124 (36%), Gaps = 5/124 (4%)

Query: 3   QCIIFIINIVVVFFIDVMGFFILMKCGADPFYSRIFSIAVAFLVTWIPSRLFIFLKLRRK 62
           Q + F +  V          +++++       +   ++ +  +     +R F F      
Sbjct: 269 QVLRFGLVGVASTLA-FALLYLVLQGPFGAQEANFLALLLTAVGNTAANRKFTFGISGPA 327

Query: 63  SFL-ETVRYGVMYFMLSILNYAFYVKLLLTFQGLQP---LLATVLSAVSSMLFVFLLYIR 118
            FL + ++  +++ +   +  +  + L        P   LL    + V S L  F+L   
Sbjct: 328 RFLTQQIQGLIVFLLAWSVTSSSLLVLHAMHPDAAPNVELLILTAANVLSTLMRFVLLRL 387

Query: 119 FMTR 122
           ++ R
Sbjct: 388 WVFR 391


>gi|72162947|ref|YP_290604.1| hypothetical protein Tfu_2548 [Thermobifida fusca YX]
 gi|71916679|gb|AAZ56581.1| conserved hypothetical protein [Thermobifida fusca YX]
          Length = 155

 Score = 63.8 bits (154), Expect = 8e-09,   Method: Composition-based stats.
 Identities = 18/133 (13%), Positives = 43/133 (32%), Gaps = 6/133 (4%)

Query: 1   MKQCIIFIINIVVVFFIDVMGFFILMK-CGADPFYSRIFSIAVAFLVTWIPSRLFIFLKL 59
           + +   F +   V +   ++   +     G      +      A +V ++ +R + F   
Sbjct: 15  IHELAKFGVVGAVAYVTQLVATNVFWYALGLPELVGQALGTVCATVVAFLGNRFWTFRHR 74

Query: 60  RRKSFL-ETVRYGVMYFMLSILNYAFYVKLL----LTFQGLQPLLATVLSAVSSMLFVFL 114
                L   V +  +  +   +  A     +    L     + +   V+      LF F 
Sbjct: 75  SHGHLLWSYVMFFGLNAVGLGIQVACLWFTIAVLGLDGPLARNIAGNVVGVGLGTLFRFW 134

Query: 115 LYIRFMTRRVYFI 127
            Y R++ R  + +
Sbjct: 135 SYRRWVFRAPHRV 147


>gi|298249462|ref|ZP_06973266.1| GtrA family protein [Ktedonobacter racemifer DSM 44963]
 gi|297547466|gb|EFH81333.1| GtrA family protein [Ktedonobacter racemifer DSM 44963]
          Length = 169

 Score = 63.8 bits (154), Expect = 8e-09,   Method: Composition-based stats.
 Identities = 19/130 (14%), Positives = 45/130 (34%), Gaps = 11/130 (8%)

Query: 3   QCIIFIINIVVVFFIDVMGFFILMKC---GADPFYS--RIFSIAVAFLVTWIPSRLFIFL 57
           Q + F     +   +D++    L+     G+    +     +  V    +++ ++ + F 
Sbjct: 38  QLLRFSAVGGLNTVLDLLVLNALLLLRPTGSSWLIALYTAIAYCVGATNSFLLNKNWTFT 97

Query: 58  KLRRKSFLETVRYGVMYFMLSILNYAFYVK------LLLTFQGLQPLLATVLSAVSSMLF 111
             +  ++ E  R+G+   +    N  F           +T       L+  L+  S  L 
Sbjct: 98  HRQPTTWRELKRFGLATLLGLSWNSLFTWLASMVAHPFVTNTLAWTDLSKGLAIASGTLL 157

Query: 112 VFLLYIRFMT 121
            FL    ++ 
Sbjct: 158 SFLAMRLWVF 167


>gi|329945524|ref|ZP_08293264.1| glycosyltransferase, group 2 family protein [Actinomyces sp. oral
           taxon 170 str. F0386]
 gi|328528879|gb|EGF55821.1| glycosyltransferase, group 2 family protein [Actinomyces sp. oral
           taxon 170 str. F0386]
          Length = 387

 Score = 63.8 bits (154), Expect = 8e-09,   Method: Composition-based stats.
 Identities = 20/119 (16%), Positives = 45/119 (37%), Gaps = 3/119 (2%)

Query: 4   CIIFIINIVVVFFIDVMGFFILMKCGADPFYSRIFSIAVAFLVTWIPSRLFIFLKLRRKS 63
            + F    +  F ID +G  ++     +   + + +  ++    +  +R  IF   R   
Sbjct: 269 LLRFTGASLASFGIDWLGVMVIFAMTGNLLAAVVGARLISGTANFFMNRR-IFKARRGTV 327

Query: 64  FLETVRYGVMYFMLSILNYAFYVKLLLTFQGLQPLLATVLSAVSSMLFVFLLYIRFMTR 122
               VRY ++   L   +Y       LT  G+   +A V+   +  +  ++   R + +
Sbjct: 328 ARTAVRYVILAVSLMAASYIALKA--LTAIGVPLGIAKVVGDGAIYVASYVAQRRLVFK 384


>gi|329941089|ref|ZP_08290368.1| cell surface polysaccharide biosynthesis protein [Streptomyces
           griseoaurantiacus M045]
 gi|329299620|gb|EGG43519.1| cell surface polysaccharide biosynthesis protein [Streptomyces
           griseoaurantiacus M045]
          Length = 169

 Score = 63.8 bits (154), Expect = 8e-09,   Method: Composition-based stats.
 Identities = 15/126 (11%), Positives = 39/126 (30%), Gaps = 5/126 (3%)

Query: 2   KQCIIFIINIVVVFFIDVMGFFILMKCGADPFY-SRIFSIAVAFLVTWIPSRLFIFLKLR 60
           ++   F         ++++ F ++          + + +  VA    ++  R F +    
Sbjct: 18  REVAKFGAVGGAGLLVNLLVFNLVRHTTDLQVVRASVIATIVAIAFNYVGFRYFAYRDRD 77

Query: 61  RK-SFLETVRYGVMYFMLSILNYAFYVKLLLTFQGLQPLLATV---LSAVSSMLFVFLLY 116
           +     E   + +      ++           F     L + +   L    + LF F  Y
Sbjct: 78  KSGRTKELSLFLLFSAAGLVIENGVLYVATYGFGWDSSLQSNIFKFLGIGIATLFRFWSY 137

Query: 117 IRFMTR 122
             ++ R
Sbjct: 138 RTWVFR 143


>gi|302544865|ref|ZP_07297207.1| putative integral membrane protein [Streptomyces hygroscopicus ATCC
           53653]
 gi|302462483|gb|EFL25576.1| putative integral membrane protein [Streptomyces himastatinicus
           ATCC 53653]
          Length = 178

 Score = 63.8 bits (154), Expect = 8e-09,   Method: Composition-based stats.
 Identities = 17/110 (15%), Positives = 34/110 (30%), Gaps = 5/110 (4%)

Query: 18  DVMGFFILMKCGADPFY-SRIFSIAVAFLVTWIPSRLFIFLKLRR-KSFLETVRYGVMYF 75
           ++  F ++      P   + I +  VA    ++  R F +    +     E   + +   
Sbjct: 35  NLAVFNLVRSVTELPVVRASIVATVVATCFNYLGYRYFTYRDRDKQGRTKELSLFLLFSA 94

Query: 76  MLSILNYAFYVKLLLTFQGLQPLLA---TVLSAVSSMLFVFLLYIRFMTR 122
           +  I+           F     L +     L      LF F  Y  ++ R
Sbjct: 95  IGLIIENGVLYTATYGFGWDSSLASNVFKFLGIGIGTLFRFWSYRTWVFR 144


>gi|260437218|ref|ZP_05791034.1| GtrA family protein [Butyrivibrio crossotus DSM 2876]
 gi|292810531|gb|EFF69736.1| GtrA family protein [Butyrivibrio crossotus DSM 2876]
          Length = 358

 Score = 63.8 bits (154), Expect = 8e-09,   Method: Composition-based stats.
 Identities = 18/129 (13%), Positives = 46/129 (35%), Gaps = 10/129 (7%)

Query: 4   CIIFIINIVVVFFIDVMGFFILMKCGADP-------FYSRIFSIAVAFLVTWIPSRLFIF 56
            + +II  ++ F ID+  F  L                + + +  ++ L  +  +R  +F
Sbjct: 224 ILKYIIGSLLSFIIDMGLFTALQFIFGKYISKSVTILVATVVARIISSLFNYFYNRNAVF 283

Query: 57  LKLRRKSFLETVRYGVMYFMLSILNYAFYVKLLLTFQGLQPLLA--TVLSAVSSMLFVFL 114
            +   K      RY ++      ++Y     L       + + +   +L  +   +  F 
Sbjct: 284 -ESDEKVGKTMGRYYILCVCQMGVSYGLVDLLSYVSHASKIITSVIKLLVDICLFIISFQ 342

Query: 115 LYIRFMTRR 123
           +  R++  +
Sbjct: 343 IQRRWVFNK 351


>gi|227877300|ref|ZP_03995373.1| conserved hypothetical protein [Lactobacillus crispatus JV-V01]
 gi|256842862|ref|ZP_05548350.1| conserved hypothetical protein [Lactobacillus crispatus 125-2-CHN]
 gi|256848764|ref|ZP_05554198.1| conserved hypothetical protein [Lactobacillus crispatus MV-1A-US]
 gi|262045828|ref|ZP_06018792.1| conserved hypothetical protein [Lactobacillus crispatus MV-3A-US]
 gi|293381696|ref|ZP_06627677.1| GtrA-like protein [Lactobacillus crispatus 214-1]
 gi|312977619|ref|ZP_07789366.1| conserved hypothetical protein [Lactobacillus crispatus CTV-05]
 gi|227863156|gb|EEJ70602.1| conserved hypothetical protein [Lactobacillus crispatus JV-V01]
 gi|256614282|gb|EEU19483.1| conserved hypothetical protein [Lactobacillus crispatus 125-2-CHN]
 gi|256714303|gb|EEU29290.1| conserved hypothetical protein [Lactobacillus crispatus MV-1A-US]
 gi|260573787|gb|EEX30343.1| conserved hypothetical protein [Lactobacillus crispatus MV-3A-US]
 gi|290921743|gb|EFD98764.1| GtrA-like protein [Lactobacillus crispatus 214-1]
 gi|310895358|gb|EFQ44425.1| conserved hypothetical protein [Lactobacillus crispatus CTV-05]
          Length = 139

 Score = 63.8 bits (154), Expect = 8e-09,   Method: Composition-based stats.
 Identities = 17/123 (13%), Positives = 47/123 (38%), Gaps = 2/123 (1%)

Query: 3   QCIIFIINIVVVFFIDVMGFFILMKCGADPFYSRIFSIAVAFLVTWIPSRLFIFLKLRRK 62
           Q + +++  V+   +D   + IL     +   + I S     +  ++ +    F    R 
Sbjct: 15  QLVKYVLIGVLGLVVDFGIYTILTHFKMNVEIANIISSTCGIINNFLWNSYTNFKVHDR- 73

Query: 63  SFLETVRYGVMYFMLSILNYAFYVKLLLTFQGLQPLLATVLSAVSSMLFVFLLYIRFMTR 122
             L  + Y ++  + ++      + + +T  G   L+  +++   + L  F++      R
Sbjct: 74  MILRFISYFIVGQITTVFT-TVSLFIFVTKLGYPHLIVKIVATFVATLIQFVINKVVTFR 132

Query: 123 RVY 125
           +  
Sbjct: 133 KAK 135


>gi|312797454|ref|YP_004030376.1| hypothetical protein RBRH_03111 [Burkholderia rhizoxinica HKI 454]
 gi|312169229|emb|CBW76232.1| unnamed protein product [Burkholderia rhizoxinica HKI 454]
          Length = 142

 Score = 63.8 bits (154), Expect = 8e-09,   Method: Composition-based stats.
 Identities = 28/124 (22%), Positives = 47/124 (37%), Gaps = 3/124 (2%)

Query: 3   QCIIFIINIVVVFFIDVMGFFILMKCGADPFYSRIFSIAVAFLVTWIPSRLFIFLKLR-R 61
           Q   F I  +  F +D    ++++  G   F  R  S  VA  VTW  +R F F   +  
Sbjct: 15  QFFRFAIAGIAGFIVDAGLLWLMLWIGLGYFAGRAVSFLVAVWVTWQLNRQFTFSGKQYE 74

Query: 62  KSFLETVRYGVMYFMLSILNYAFYVKLLLTFQ--GLQPLLATVLSAVSSMLFVFLLYIRF 119
             + E  RY         +NYA Y  ++L        P +     +++ +   F     +
Sbjct: 75  SVWREWWRYLTAMLAGGCVNYAAYSAVVLNLPPRVFVPYIGVAAGSLAGLAVNFASARWW 134

Query: 120 MTRR 123
           +  R
Sbjct: 135 VFYR 138


>gi|262037862|ref|ZP_06011294.1| GtrA family protein [Leptotrichia goodfellowii F0264]
 gi|261748105|gb|EEY35512.1| GtrA family protein [Leptotrichia goodfellowii F0264]
          Length = 132

 Score = 63.8 bits (154), Expect = 9e-09,   Method: Composition-based stats.
 Identities = 20/121 (16%), Positives = 49/121 (40%), Gaps = 3/121 (2%)

Query: 3   QCIIFIINIVVVFFIDVMGFFILMKCGADPFYSRIFSIAVAFLVTWIPSRLFIFLKLRRK 62
           + + F++        D + + +LM  G D   ++  S     +V +I ++ + F      
Sbjct: 11  EILKFLVGGGSAVVTDFIAYKLLMNFGMDRNSAKTISFICGSIVGFIINKYWTFKSSIFS 70

Query: 63  SFLETVRYGVMYFMLSILNYAFYVKLLLTFQGLQPLLATVLSAVSSMLFVFLLYIRFMTR 122
              E  +Y ++Y + + +N      ++L  +    L A + +   S +  FL     + +
Sbjct: 71  -LKEIFKYTILYIVTAFINSLVNKYVMLAVK--HELFAFLCATGVSTILNFLGQKFLIFK 127

Query: 123 R 123
           +
Sbjct: 128 K 128


>gi|291562713|emb|CBL41529.1| Predicted membrane protein [butyrate-producing bacterium SS3/4]
          Length = 161

 Score = 63.4 bits (153), Expect = 9e-09,   Method: Composition-based stats.
 Identities = 19/124 (15%), Positives = 49/124 (39%), Gaps = 5/124 (4%)

Query: 2   KQCIIFIINIVVVFFIDVMGFFILMK-CGADPFYSRIFSIAVAFLVTWIPSRLFIFLKLR 60
           ++ I ++I  V+   ID     +L      DP  ++  +   A L  ++ ++ ++F    
Sbjct: 33  REGIAYLIFGVLTTVIDYAISNLLYYIWKMDPVPAQTIAWVAAVLFAFVTNKWWVFESHT 92

Query: 61  R---KSFLETVRYGVMYFMLSILNYAFYVKLLLTFQGLQPLLATVLSAVSSMLFVFLLYI 117
               K + E V + +      + N A     ++    ++  L  +L +V  ++  ++   
Sbjct: 93  LNPGKVWREFVSFVLCRVATFLFNLAALFV-MVDLMKMEFFLCKLLISVVVVILNYVFSK 151

Query: 118 RFMT 121
             + 
Sbjct: 152 ILIF 155



 Score = 34.1 bits (77), Expect = 7.1,   Method: Composition-based stats.
 Identities = 12/65 (18%), Positives = 30/65 (46%), Gaps = 1/65 (1%)

Query: 57  LKLRRKSFLETVRYGVMYFMLSILNYAFYVKLLLTFQGLQPLLATVLSAVSSMLFVFLLY 116
            K +     E + Y +   + ++++YA     L     + P+ A  ++ V+++LF F+  
Sbjct: 25  GKRKSGLAREGIAYLIFGVLTTVIDYAISNL-LYYIWKMDPVPAQTIAWVAAVLFAFVTN 83

Query: 117 IRFMT 121
             ++ 
Sbjct: 84  KWWVF 88


>gi|119962513|ref|YP_948251.1| GtrA-like family protein [Arthrobacter aurescens TC1]
 gi|119949372|gb|ABM08283.1| putative membrane protein, GtrA-like family [Arthrobacter aurescens
           TC1]
          Length = 161

 Score = 63.4 bits (153), Expect = 9e-09,   Method: Composition-based stats.
 Identities = 21/131 (16%), Positives = 44/131 (33%), Gaps = 5/131 (3%)

Query: 1   MKQCIIFIINIVVVFFIDVMGFFILMKCGADPFYSRIFSIAVAFLVTWIPSRLFIF---- 56
           ++Q + F    VV     +  + +L         +   ++ V  L+    +R   F    
Sbjct: 32  VRQLLRFTGVGVVCTASSLAIYALLRPWIDPQL-ANAVALIVTSLMNTALNRRLTFKITG 90

Query: 57  LKLRRKSFLETVRYGVMYFMLSILNYAFYVKLLLTFQGLQPLLATVLSAVSSMLFVFLLY 116
            K R +  L  V   V+  +++  +              + L  T L+   +    F L 
Sbjct: 91  RKKRTQDHLSGVIVIVIALIITGGSLGVLHLFRPEATVTEELWTTTLAGFLATAVRFTLL 150

Query: 117 IRFMTRRVYFI 127
             ++ RR   +
Sbjct: 151 RHWIFRRARHM 161


>gi|302528957|ref|ZP_07281299.1| glycosyl transferase [Streptomyces sp. AA4]
 gi|302437852|gb|EFL09668.1| glycosyl transferase [Streptomyces sp. AA4]
          Length = 421

 Score = 63.4 bits (153), Expect = 9e-09,   Method: Composition-based stats.
 Identities = 18/125 (14%), Positives = 42/125 (33%), Gaps = 6/125 (4%)

Query: 1   MKQCIIFIINIVVVFFIDVMGFFILMKCGADPFYSRIFSIAVAFLVTWIPSRLFIFLKLR 60
           +KQ + F    V    +  +  F+L++       +   ++ V  +     +R   F    
Sbjct: 288 VKQLVRFAAVGVAST-VAYLLLFLLLRTMVGAQAANFTALLVTAIANTAVNRRVTFGVRG 346

Query: 61  RKSFL----ETVRYGVMYFMLSILNYAFYVKLLLTFQGLQPLLATVLSAVSSMLFVFLLY 116
           R        E +    +   L+  + A           L      V++ +++ +  FLL 
Sbjct: 347 RAGAGRHQFEGLLVFGLGLALTSGSLALLNHATHPGLVL-ETTVLVVANLAATVLRFLLL 405

Query: 117 IRFMT 121
             ++ 
Sbjct: 406 RGWVF 410


>gi|295692665|ref|YP_003601275.1| dolichyl-phosphate beta-d-mannosyltransferase [Lactobacillus
           crispatus ST1]
 gi|295030771|emb|CBL50250.1| Dolichyl-phosphate beta-D-mannosyltransferase [Lactobacillus
           crispatus ST1]
          Length = 139

 Score = 63.4 bits (153), Expect = 9e-09,   Method: Composition-based stats.
 Identities = 19/123 (15%), Positives = 48/123 (39%), Gaps = 2/123 (1%)

Query: 3   QCIIFIINIVVVFFIDVMGFFILMKCGADPFYSRIFSIAVAFLVTWIPSRLFIFLKLRRK 62
           Q + +++  V+   +D   + IL     +   + I S     +  ++ +    F    R 
Sbjct: 15  QLVKYVLIGVLGLVVDFGIYTILTHFKMNVEIANIISSTCGIINNFLWNSYTNFKVHDR- 73

Query: 63  SFLETVRYGVMYFMLSILNYAFYVKLLLTFQGLQPLLATVLSAVSSMLFVFLLYIRFMTR 122
             L  + Y ++  + ++      + + +T  G   L+  V++   + L  F++      R
Sbjct: 74  MILRFISYFIVGQITTVFT-TISLFVFVTKLGYPHLMVKVIATFMATLIQFVINKVVTFR 132

Query: 123 RVY 125
           +V 
Sbjct: 133 KVK 135


>gi|298241344|ref|ZP_06965151.1| GtrA family protein [Ktedonobacter racemifer DSM 44963]
 gi|297554398|gb|EFH88262.1| GtrA family protein [Ktedonobacter racemifer DSM 44963]
          Length = 184

 Score = 63.4 bits (153), Expect = 9e-09,   Method: Composition-based stats.
 Identities = 17/130 (13%), Positives = 44/130 (33%), Gaps = 11/130 (8%)

Query: 3   QCIIFIINIVVVFFIDVMGFFILMKCGADP-----FYSRIFSIAVAFLVTWIPSRLFIFL 57
           Q   + +  V    IDV+   IL+ C               +       ++  ++ + F 
Sbjct: 46  QWFRYCLVGVANTLIDVLVLNILLWCFPTTQVHILVIYNSLAYIGGAASSFFLNKYWTFG 105

Query: 58  KLRRKSFLETVRYGVMYFMLSILNYAFYVK------LLLTFQGLQPLLATVLSAVSSMLF 111
             +R +  E  R+ +   +  + +              L    L    + +L+ V++ + 
Sbjct: 106 HKQRPTTQEVRRFLLNMLLEILSSNGLLWLIGNALHPFLANAMLWGNASKLLAVVANTVL 165

Query: 112 VFLLYIRFMT 121
            +L+   ++ 
Sbjct: 166 SYLILRFWVF 175


>gi|229106018|ref|ZP_04236639.1| GtrA [Bacillus cereus Rock3-28]
 gi|228677413|gb|EEL31669.1| GtrA [Bacillus cereus Rock3-28]
          Length = 127

 Score = 63.4 bits (153), Expect = 1e-08,   Method: Composition-based stats.
 Identities = 15/121 (12%), Positives = 49/121 (40%), Gaps = 2/121 (1%)

Query: 1   MKQCIIFIINIVVVFFIDVMGFFILMKCGADPFYSRIFSIAVAFLVTWIPSRLFIFLKLR 60
           M++ + F +  +    I ++ F IL+K G +   +   +  +    ++  ++ ++F    
Sbjct: 1   MEKLLKFGLVGIFNTLITIISFGILVKLGMNYLVANTIAYLIGVANSYYWNKNWVFKPNN 60

Query: 61  RKSFLETVRYGVMYFMLSILNYAFYVKLLLTFQGLQPLLATVLSAVSSMLFVFLLYIRFM 120
           + + +   ++  +  ++   N      +L+        +A + +    M+  F+L   + 
Sbjct: 61  KSTSM-FFKFLTVNLIVLAFNTLCL-FILVDKLTFNAFIAQIFAIGVGMVINFILNKIWT 118

Query: 121 T 121
            
Sbjct: 119 F 119


>gi|315654202|ref|ZP_07907110.1| conserved hypothetical protein [Mobiluncus curtisii ATCC 51333]
 gi|315491237|gb|EFU80854.1| conserved hypothetical protein [Mobiluncus curtisii ATCC 51333]
          Length = 147

 Score = 63.4 bits (153), Expect = 1e-08,   Method: Composition-based stats.
 Identities = 23/119 (19%), Positives = 47/119 (39%), Gaps = 1/119 (0%)

Query: 2   KQCIIFIINIVVVFFIDVMGFFILMKC-GADPFYSRIFSIAVAFLVTWIPSRLFIFLKLR 60
           +Q I F I  ++ FFID   F +L K  G     + + S  V+    +  S  ++F    
Sbjct: 21  RQIIGFGIVGLLAFFIDYALFALLYKFVGIHYLIAAVISFCVSLAFNYAASMRYVFRHKS 80

Query: 61  RKSFLETVRYGVMYFMLSILNYAFYVKLLLTFQGLQPLLATVLSAVSSMLFVFLLYIRF 119
             +    V    +  ++ +      + +      ++PL+  +L+ V    + F+    F
Sbjct: 81  DMTRRREVVLFFVGAVIGLGINEIMLYVGDVVFCIEPLITKILATVVVAAWNFVTRKIF 139


>gi|325264427|ref|ZP_08131158.1| cell wall teichoic acid glycosylation protein GtcA [Clostridium sp.
           D5]
 gi|324030498|gb|EGB91782.1| cell wall teichoic acid glycosylation protein GtcA [Clostridium sp.
           D5]
          Length = 133

 Score = 63.4 bits (153), Expect = 1e-08,   Method: Composition-based stats.
 Identities = 19/122 (15%), Positives = 57/122 (46%), Gaps = 2/122 (1%)

Query: 2   KQCIIFIINIVVVFFIDVMGFFILMKCGADPFYSRIFSIAVAFLVTWIPSRLFIFLKLRR 61
           K+ +++ ++     F++ + +FIL+K   +   +   + A A +  ++ +R  +F   R+
Sbjct: 8   KELVLYCLSGGATTFVNYLIYFILLKTHVEYLAANTLAWAGAVVTAYLLNRRLVF-HSRK 66

Query: 62  KSFLETVRYGVMYFMLSILNYAFYVKLLLTFQGLQPLLATVLSAVSSMLFVFLLYIRFMT 121
               E   +  + F+  +      + + +   G+ PL + ++ +V ++L  ++L    + 
Sbjct: 67  HILQEFCSFVFLRFLTLLAEN-ILLWIAVDSLGILPLPSKIMVSVITVLSNYVLCKYKIF 125

Query: 122 RR 123
            +
Sbjct: 126 HK 127


>gi|241207226|ref|YP_002978322.1| GtrA family protein [Rhizobium leguminosarum bv. trifolii WSM1325]
 gi|240861116|gb|ACS58783.1| GtrA family protein [Rhizobium leguminosarum bv. trifolii WSM1325]
          Length = 125

 Score = 63.4 bits (153), Expect = 1e-08,   Method: Composition-based stats.
 Identities = 44/123 (35%), Positives = 66/123 (53%), Gaps = 1/123 (0%)

Query: 1   MKQCIIFIINIVVVFFIDVMGFFILMKCGA-DPFYSRIFSIAVAFLVTWIPSRLFIFLKL 59
           M++ I FII   + F +D      L+      PF +R+ +IA A   TW  +R F F + 
Sbjct: 1   MRKLIRFIIAGGIGFLVDAGILSALLHLTPLGPFLARLVAIAFAMAATWAFNRSFTFDRS 60

Query: 60  RRKSFLETVRYGVMYFMLSILNYAFYVKLLLTFQGLQPLLATVLSAVSSMLFVFLLYIRF 119
            R    E  RYG +    +++NY  Y  LLL+   LQPL A V+++++SM+F F  Y RF
Sbjct: 61  GRSLAAEGFRYGSVGVTAALVNYGLYSALLLSLPALQPLAAMVIASIASMIFSFFGYSRF 120

Query: 120 MTR 122
           + R
Sbjct: 121 VFR 123


>gi|213691104|ref|YP_002321690.1| GtrA family protein [Bifidobacterium longum subsp. infantis ATCC
           15697]
 gi|213522565|gb|ACJ51312.1| GtrA family protein [Bifidobacterium longum subsp. infantis ATCC
           15697]
          Length = 205

 Score = 63.4 bits (153), Expect = 1e-08,   Method: Composition-based stats.
 Identities = 19/132 (14%), Positives = 46/132 (34%), Gaps = 13/132 (9%)

Query: 1   MKQCIIFIINIVVVFFIDVMGFFILM-KCGADPFYSRIFSIAVAFLVTWIPSRLFIFLKL 59
           ++Q + F I  V+ F ID     +L+         +   S  ++ +  ++ S  F+F   
Sbjct: 24  IEQLMKFGIVGVIAFVIDWGILNLLVGIFHMHNVLAATISFIISLIFNYLASMKFVFKHR 83

Query: 60  -RRKSFLETVRYGVMYFMLSILNYAFYVKLLLTFQGLQPL-----------LATVLSAVS 107
                ++E + + V   +   +N A              +           +  +++   
Sbjct: 84  DDMARWMEILIFVVGAVVGLFMNDAIIWISTYGMNHDAYVSQHAEYLLRTNIGKLVATAV 143

Query: 108 SMLFVFLLYIRF 119
            M++ FL+    
Sbjct: 144 VMIWNFLIRKWL 155



 Score = 35.3 bits (80), Expect = 2.7,   Method: Composition-based stats.
 Identities = 11/62 (17%), Positives = 34/62 (54%), Gaps = 1/62 (1%)

Query: 61  RKSFLETVRYGVMYFMLSILNYAFYVKLLLTFQGLQPLLATVLSAVSSMLFVFLLYIRFM 120
           RK   + +++G++  +  ++++      L+    +  +LA  +S + S++F +L  ++F+
Sbjct: 21  RKLIEQLMKFGIVGVIAFVIDWGILNL-LVGIFHMHNVLAATISFIISLIFNYLASMKFV 79

Query: 121 TR 122
            +
Sbjct: 80  FK 81


>gi|302535688|ref|ZP_07288030.1| glycosyl transferase [Streptomyces sp. C]
 gi|302444583|gb|EFL16399.1| glycosyl transferase [Streptomyces sp. C]
          Length = 422

 Score = 63.4 bits (153), Expect = 1e-08,   Method: Composition-based stats.
 Identities = 19/133 (14%), Positives = 49/133 (36%), Gaps = 7/133 (5%)

Query: 2   KQCIIFIINIVVVFFIDVMGFFILMKCGADPFYSRIFSIAVAFLVTWIPSRLFIFLKLRR 61
           +Q + F +  V+     +   + L + GA P  +   ++ ++ +     +R   F    R
Sbjct: 287 RQLLGFCVVGVLSTLCYLA-LYSLFRLGAGPQAANAAALLLSAVANTAANRRLTFGVRGR 345

Query: 62  KSFL----ETVRYGVMYFMLSILNYAFYVKLLLTFQGLQPLLATVLSAVSSMLFVFLLYI 117
              +    + +    +   L+  + A              L   + + +++ +  FLL+ 
Sbjct: 346 DRAVRHQAQGLVVFAIGLALTSGSLAALDAAAANPAHSTELAVLITANLAATVLRFLLFR 405

Query: 118 RFMT--RRVYFIK 128
            ++   RR   +K
Sbjct: 406 AWVFPERRTTPVK 418


>gi|319442689|ref|ZP_07991845.1| hypothetical protein CvarD4_13087 [Corynebacterium variabile DSM
           44702]
          Length = 151

 Score = 63.4 bits (153), Expect = 1e-08,   Method: Composition-based stats.
 Identities = 19/128 (14%), Positives = 44/128 (34%), Gaps = 8/128 (6%)

Query: 3   QCIIFIINIVVVFFIDVMGFFILMKCGADPFYSRIFSIAVAFLVTWIPSRLFIFLKLRRK 62
           Q   FI   VV   +D    ++L   G     S+     +  L  +  +R + F      
Sbjct: 26  QLFRFICTGVVGAVVDFGSTYLLSLVGLSHAGSKTVGFILGTLTAYFINRRWTFQAA--P 83

Query: 63  SFLETVRYGVMYFMLSILNYAFYVKLLLTFQG------LQPLLATVLSAVSSMLFVFLLY 116
           S    V     Y +  ++    ++  +   +           ++ V++  ++ +  F++ 
Sbjct: 84  SRKRFVATMCSYLLTYLVQLGLFLVCIPWLEDHGFSDFWTQAISFVIAQGTATVLNFIIQ 143

Query: 117 IRFMTRRV 124
              + R V
Sbjct: 144 RWVIFRVV 151


>gi|153005811|ref|YP_001380136.1| GtrA family protein [Anaeromyxobacter sp. Fw109-5]
 gi|152029384|gb|ABS27152.1| GtrA family protein [Anaeromyxobacter sp. Fw109-5]
          Length = 698

 Score = 63.4 bits (153), Expect = 1e-08,   Method: Composition-based stats.
 Identities = 14/131 (10%), Positives = 39/131 (29%), Gaps = 12/131 (9%)

Query: 3   QCIIFIINIVVVFFIDVMGFFILMK-CGADPFYSRIFSIAVAFLVTWIPSRLFIFLKLR- 60
           +   F +  +    +++    +           +   +I  + +  ++ +  F F   R 
Sbjct: 4   RVARFALVGLSGVLVNLAALHLFAAVLELQDVVASALAIETSIVTNFLLNDGFTFSDRRD 63

Query: 61  --RKSFLETVRYGVMYFMLSILNYAFYVKLLLTF--------QGLQPLLATVLSAVSSML 110
                    +RY  +     ++  A +V + +           G    +A       +  
Sbjct: 64  LGAGIVRRLLRYHAVCLAGGVIQLATFVLVAVALRRLLGRPELGALRYVAQSAGIGVAFA 123

Query: 111 FVFLLYIRFMT 121
             +L  +RF  
Sbjct: 124 VNYLGSLRFAW 134


>gi|125625375|dbj|BAF46770.1| hypothetical protein [Nocardia brasiliensis]
          Length = 174

 Score = 63.4 bits (153), Expect = 1e-08,   Method: Composition-based stats.
 Identities = 24/132 (18%), Positives = 54/132 (40%), Gaps = 11/132 (8%)

Query: 1   MKQCIIFIINIVVVFFIDVMGFFILMKCGADPFY------SRIFSIAVAFLVTWIPSRLF 54
           ++    F++   + F +D   + +L+  G           ++I +IAVA +VT+  ++ +
Sbjct: 31  LRTGGAFLVVGALGFLVDAGTYNLLVFWGGHGVLYHAPLPAKIIAIAVATVVTYFGNKWW 90

Query: 55  IF-LKLRRKSFLETVRYGVMYFMLSILNYAFY----VKLLLTFQGLQPLLATVLSAVSSM 109
            F  K       E + Y V   +   L           L L+      +  T++  + ++
Sbjct: 91  TFAHKKGGSPAREYLLYAVFNVIAIGLQLGCLGFSRYVLHLSTPLSDNISGTLIGQIVAV 150

Query: 110 LFVFLLYIRFMT 121
           +F +  Y +F+ 
Sbjct: 151 VFRYWAYDKFVF 162


>gi|320101711|ref|YP_004177302.1| GtrA family protein [Isosphaera pallida ATCC 43644]
 gi|319748993|gb|ADV60753.1| GtrA family protein [Isosphaera pallida ATCC 43644]
          Length = 213

 Score = 63.0 bits (152), Expect = 1e-08,   Method: Composition-based stats.
 Identities = 20/146 (13%), Positives = 41/146 (28%), Gaps = 21/146 (14%)

Query: 3   QCIIFIINIVVVFFIDVMGFFIL------------------MKCGADPFYSRIFSIAVAF 44
           +   F         ID+  + +                   +        +R  +I VA 
Sbjct: 63  RLAQFCAVGFSGMIIDLTCYAVFRAALETTWLGNRPSNLLGLGLPTSVVVARASAILVAL 122

Query: 45  LVTWIPSRLFIFLKLRR-KSFLETVRYGVMYFMLSILNYAFYVKLLLTFQGLQ--PLLAT 101
           +  +  +R   F    +     +   Y +   +   +++   V L       Q    LA 
Sbjct: 123 IWNFTLNRRVTFNDAPKTGLIRQFAAYALGNALAIAVSFGCSVALPARIPFFQDRLQLAA 182

Query: 102 VLSAVSSMLFVFLLYIRFMTRRVYFI 127
           V+  V S    F      + R+   +
Sbjct: 183 VVGIVVSTSISFSTSRWLVFRKTPSL 208


>gi|314923845|gb|EFS87676.1| conserved hypothetical protein [Propionibacterium acnes HL001PA1]
          Length = 219

 Score = 63.0 bits (152), Expect = 1e-08,   Method: Composition-based stats.
 Identities = 18/159 (11%), Positives = 49/159 (30%), Gaps = 36/159 (22%)

Query: 3   QCIIFIINIVVVFFIDVMGFFILMKCGADPFYSR--------------------IFSIAV 42
           + I F +     F ++++   I+ K      +++                    +    V
Sbjct: 35  EFIKFGVVGGSGFLVNIIVAIIMNKANGGTEHAQDILFNLAGTRWNFRFTSLVWLVGFVV 94

Query: 43  AFLVTWIPSRLFIFLKL-RRKSFLETVRYGVMYFMLSILNYAFYVKLLLTFQGLQ----- 96
           A +  +  +R + F +  RR  + E   +  +  + +I+     +        +      
Sbjct: 95  ANITNFQLNRSWTFKRKYRRGWWREFWPFFAVGSIAAIIGMFIKIFFTNPTSPIYLPEPW 154

Query: 97  ----------PLLATVLSAVSSMLFVFLLYIRFMTRRVY 125
                        + + + V +M   F++   +  R V 
Sbjct: 155 FNEGRGIQSREYWSQIFAIVVTMPINFVVNKLWTFRAVK 193


>gi|319946350|ref|ZP_08020588.1| GtrA family protein [Streptococcus australis ATCC 700641]
 gi|319747503|gb|EFV99758.1| GtrA family protein [Streptococcus australis ATCC 700641]
          Length = 366

 Score = 63.0 bits (152), Expect = 1e-08,   Method: Composition-based stats.
 Identities = 15/127 (11%), Positives = 44/127 (34%), Gaps = 8/127 (6%)

Query: 2   KQCIIFIINIVVVFFIDVMGFFILMKCGAD------PFYSRIFSIAVAFLVTWIPSRLFI 55
           K    F ++ +  F +D + +   +              +   +   + +  +  ++ F+
Sbjct: 232 KDMFKFALSSLSSFIVDYLVYAFFLFVMMAVPISLRILLANGIARVASSIFNYSTNKRFV 291

Query: 56  FLKLRRKSFLETVRYGVMYFMLSILNYAFYVKLLLTFQGLQPLLATVLSAVSSMLFVFLL 115
           F             Y  +  +   +     ++L  T  GL  LL+ V+  +   +  +L+
Sbjct: 292 FKNKD-SLARTGSGYLGLA-IGLFILDTLLIRLFYTSFGLHLLLSKVIVGLLLFVVSWLI 349

Query: 116 YIRFMTR 122
             + + +
Sbjct: 350 QKKIIFK 356


>gi|256785676|ref|ZP_05524107.1| integral membrane protein [Streptomyces lividans TK24]
 gi|289769569|ref|ZP_06528947.1| integral membrane protein [Streptomyces lividans TK24]
 gi|289699768|gb|EFD67197.1| integral membrane protein [Streptomyces lividans TK24]
          Length = 157

 Score = 63.0 bits (152), Expect = 1e-08,   Method: Composition-based stats.
 Identities = 16/127 (12%), Positives = 38/127 (29%), Gaps = 6/127 (4%)

Query: 2   KQCIIFIINIVVVFFIDVMGFFILMK-CGADPFYSRIFSIAVAFLVTWIPSRLFIFLKLR 60
           ++ + F    ++ + +D+  F  L    G DP  ++  S      V +  + L  +  L 
Sbjct: 6   RELLGFASAGLLAYAVDLGLFTCLRGPAGLDPLTAKALSFVAGCSVAYAGNALGTYRHLG 65

Query: 61  RKSFLET-VRYGVMYFMLSILNYAFYVKLLLTFQG----LQPLLATVLSAVSSMLFVFLL 115
           R   L     +  +    + +     V               +    +  +   +  F  
Sbjct: 66  RPRGLRPCAVFFAVNAAGAAVQLLCLVVSHYGLGLTSQRADTVSGAGVGMILGTILRFWG 125

Query: 116 YIRFMTR 122
               + R
Sbjct: 126 TRTLVFR 132


>gi|108801962|ref|YP_642159.1| GtrA-like protein [Mycobacterium sp. MCS]
 gi|119871114|ref|YP_941066.1| GtrA family protein [Mycobacterium sp. KMS]
 gi|126437943|ref|YP_001073634.1| GtrA family protein [Mycobacterium sp. JLS]
 gi|108772381|gb|ABG11103.1| GtrA-like protein [Mycobacterium sp. MCS]
 gi|119697203|gb|ABL94276.1| GtrA family protein [Mycobacterium sp. KMS]
 gi|126237743|gb|ABO01144.1| GtrA family protein [Mycobacterium sp. JLS]
          Length = 139

 Score = 63.0 bits (152), Expect = 1e-08,   Method: Composition-based stats.
 Identities = 15/122 (12%), Positives = 41/122 (33%), Gaps = 4/122 (3%)

Query: 3   QCIIFIINIVVVFFIDVMGFFILMKCGADPFYSRIFSIAVAFLVTWIPSRLFIFLKLRRK 62
           Q   F++       +D   + +L++ G     ++  S        ++ +R + F      
Sbjct: 10  QIWRFLLTGGFAAIVDFGLYVLLLEAGLHVNVAKTISFIAGTTTAYLINRRWTFQA--PP 67

Query: 63  SFLETVRYGVMYFMLSILNYAFYVKLL--LTFQGLQPLLATVLSAVSSMLFVFLLYIRFM 120
           S    +    +Y             L      +  +  +A V++  ++ +  F++    +
Sbjct: 68  SRARFLAVCALYATTYAAQVGINYILYTAWDDKSWRVPVAFVIAQGTATVINFVVQRAVI 127

Query: 121 TR 122
            R
Sbjct: 128 FR 129


>gi|21223221|ref|NP_629000.1| integral membrane protein [Streptomyces coelicolor A3(2)]
 gi|7649575|emb|CAB89064.1| putative integral membrane protein [Streptomyces coelicolor A3(2)]
          Length = 157

 Score = 63.0 bits (152), Expect = 1e-08,   Method: Composition-based stats.
 Identities = 15/127 (11%), Positives = 38/127 (29%), Gaps = 6/127 (4%)

Query: 2   KQCIIFIINIVVVFFIDVMGFFILMK-CGADPFYSRIFSIAVAFLVTWIPSRLFIFLKLR 60
           ++ + F    ++ + +D+  F  L    G DP  ++  S      V +  + L  +  L 
Sbjct: 6   RELLGFASAGLLAYAVDLGLFTCLRGPAGLDPLTAKALSFVAGCSVAYAGNALGTYRHLG 65

Query: 61  RKSFLET-VRYGVMYFMLSILNYAFYVKLLLTFQG----LQPLLATVLSAVSSMLFVFLL 115
           R   L     +  +    + +     +               +    +  +   +  F  
Sbjct: 66  RPRGLRPCAVFFAVNAAGAAVQLLCLIVSHYGLGLTSQRADTVSGAGVGMILGTILRFWG 125

Query: 116 YIRFMTR 122
               + R
Sbjct: 126 TRTLVFR 132


>gi|227487881|ref|ZP_03918197.1| conserved hypothetical protein [Corynebacterium glucuronolyticum
           ATCC 51867]
 gi|227542522|ref|ZP_03972571.1| conserved hypothetical protein [Corynebacterium glucuronolyticum
           ATCC 51866]
 gi|227092208|gb|EEI27520.1| conserved hypothetical protein [Corynebacterium glucuronolyticum
           ATCC 51867]
 gi|227181720|gb|EEI62692.1| conserved hypothetical protein [Corynebacterium glucuronolyticum
           ATCC 51866]
          Length = 177

 Score = 63.0 bits (152), Expect = 1e-08,   Method: Composition-based stats.
 Identities = 17/155 (10%), Positives = 47/155 (30%), Gaps = 33/155 (21%)

Query: 1   MKQCIIFIINIVVVFFIDVMGFFILMKCG---ADPFYSRI---------------FSIAV 42
           +++ + F I       ++    ++L + G    D   + +                +  V
Sbjct: 10  IREFLKFGIVGGSGTLVNFFVVWVLHRFGSLDQDQVVANLFGTPFNIRWYHVMITIAFLV 69

Query: 43  AFLVTWIPSRLFIFLKLRRKSFLETVRYGVMYFMLSILNYAFYVKLLL------------ 90
           A    +  +R + F       F    ++ +      +++      L+             
Sbjct: 70  ANTWNYQLNRFWTFKDKTVGWFRGYWKFLLTGIGALVVSQVVATLLMNPTSPIALPTHIF 129

Query: 91  ---TFQGLQPLLATVLSAVSSMLFVFLLYIRFMTR 122
              T    +   A  +S +++M   F++   +  R
Sbjct: 130 DDTTGFRTRVYWANAISVLAAMPINFIINKLWTFR 164


>gi|146296090|ref|YP_001179861.1| GtrA family protein [Caldicellulosiruptor saccharolyticus DSM 8903]
 gi|145409666|gb|ABP66670.1| GtrA family protein [Caldicellulosiruptor saccharolyticus DSM 8903]
          Length = 155

 Score = 63.0 bits (152), Expect = 1e-08,   Method: Composition-based stats.
 Identities = 19/124 (15%), Positives = 51/124 (41%), Gaps = 4/124 (3%)

Query: 3   QCIIFIINIVVVFFIDVMGFFILMK-CGADPFYSRIFSIAVAFLVTWIPSRLFIFLKLRR 61
           + + F I  V+   ID   FF+       +  +S++F      + +++ ++ + F    +
Sbjct: 25  ELVKFSIVGVINTTIDFAVFFVCYSILHFNSSFSQVFGYTAGMVNSFLMNKKWTFEDSTK 84

Query: 62  KS--FLETVRYGVMYFMLSILNYAFYVKLLLTFQGLQPLLATVLSAVSSMLFVFLLYIRF 119
                L+ V++     +  +L+        L       L+A +L+ + +    ++LY  +
Sbjct: 85  GRIIILKVVKFAFTNIISLLLSIVMIKLSRLYLSN-SILIAKILATLCAQGVNYILYKFW 143

Query: 120 MTRR 123
           +  +
Sbjct: 144 VFTK 147


>gi|240168560|ref|ZP_04747219.1| hypothetical protein MkanA1_04557 [Mycobacterium kansasii ATCC
           12478]
          Length = 145

 Score = 63.0 bits (152), Expect = 1e-08,   Method: Composition-based stats.
 Identities = 19/121 (15%), Positives = 45/121 (37%), Gaps = 1/121 (0%)

Query: 3   QCIIFIINIVVVFFIDVMGFFILMK-CGADPFYSRIFSIAVAFLVTWIPSRLFIFLKLRR 61
           Q + F++       +D   +  L K  G     S+  S+ V  +  ++ +R + F     
Sbjct: 23  QMVRFVVTGGFAAIVDFSVYVALYKGVGLQVDLSKFISVVVGTITAYLINRRWTFQASPS 82

Query: 62  KSFLETVRYGVMYFMLSILNYAFYVKLLLTFQGLQPLLATVLSAVSSMLFVFLLYIRFMT 121
           ++    V           +        LL ++G    +A V++  ++ +  F++    + 
Sbjct: 83  RARFAAVMGLYGVTFAVQVGLNHLCLALLHYRGWAIPVAFVIAQGTATVINFVVQRAVIF 142

Query: 122 R 122
           R
Sbjct: 143 R 143


>gi|229916088|ref|YP_002884734.1| glycosyl transferase family 2 [Exiguobacterium sp. AT1b]
 gi|229467517|gb|ACQ69289.1| glycosyl transferase family 2 [Exiguobacterium sp. AT1b]
          Length = 353

 Score = 63.0 bits (152), Expect = 1e-08,   Method: Composition-based stats.
 Identities = 15/128 (11%), Positives = 47/128 (36%), Gaps = 10/128 (7%)

Query: 2   KQCIIFIINIVVVFFIDVMGFFILMKC------GADPFYSRIFSIAVAFLVTWIPSRLFI 55
           +  +++ ++ V  F +DV  + + +              + + +  ++ L  ++ +R  +
Sbjct: 230 RMFLMYSLSSVASFLVDVGMYALFIYLLSPYFDTVHVVIATVIARVISSLFNYLINRKVV 289

Query: 56  FLKLRRKSFLETVRYGVMYFMLSILNYAFYVKLLLTFQGLQPLLATVLSAVSSMLFVFLL 115
           F    R+S  +     V+   +S L       L         ++  V+         + +
Sbjct: 290 FDSKARRSLPKYFSLVVLQMAVSALLVFLLFLLFRQG----EVILKVVVDSFLFFVSYYI 345

Query: 116 YIRFMTRR 123
             R++ ++
Sbjct: 346 QKRWIFKK 353


>gi|150388148|ref|YP_001318197.1| GtrA family protein [Alkaliphilus metalliredigens QYMF]
 gi|149948010|gb|ABR46538.1| GtrA family protein [Alkaliphilus metalliredigens QYMF]
          Length = 139

 Score = 63.0 bits (152), Expect = 1e-08,   Method: Composition-based stats.
 Identities = 19/127 (14%), Positives = 56/127 (44%), Gaps = 4/127 (3%)

Query: 1   MKQCIIFIINIVVVFFIDVMGFFILMKCGADPFYSRIFSIAVAFLVTWIPSRLFIF---L 57
           +K  + ++I  V+   ++++ + IL++ G     S   +  +A  V +  +R ++F   +
Sbjct: 5   LKHYMNYLIFGVLTTAVNLVIYTILIRFGLHYLISTTIAFILAVSVAFYTNRKWVFDSDV 64

Query: 58  KLRRKSFLETVRYGVMYFMLSILNYAFYVKLLLTFQGLQPLLATVLSAVSSMLFVFLLYI 117
           K ++    E   + V+       +  F + LL+    +  L++ ++     ++  + L  
Sbjct: 65  KEQKGLMKEMSTFFVVRIGTYFFDL-FGLILLIQLADMDELISKLIVNGGVIVLNYALSK 123

Query: 118 RFMTRRV 124
             + ++ 
Sbjct: 124 WVVFKKP 130


>gi|148273492|ref|YP_001223053.1| hypothetical protein CMM_2308 [Clavibacter michiganensis subsp.
           michiganensis NCPPB 382]
 gi|147831422|emb|CAN02381.1| putative membrane protein [Clavibacter michiganensis subsp.
           michiganensis NCPPB 382]
          Length = 159

 Score = 63.0 bits (152), Expect = 1e-08,   Method: Composition-based stats.
 Identities = 19/116 (16%), Positives = 44/116 (37%), Gaps = 4/116 (3%)

Query: 7   FIINIVVVFFIDVMGFFILM-KCGADPFYSRIFSIAVAFLVTWIPSRLFIFLKLRRKSFL 65
           ++    V F +D+    +     G     +   S     +V+++  R   F   +R  + 
Sbjct: 23  YLAVGGVAFVVDLGLLIVGRDLLGWPLAAASATSFWAGLVVSYVMQRFLTFRD-QRSDWH 81

Query: 66  ETVRYGVMYFMLSILNYAFYVKLLLTFQGLQPLLATVLSAVSSMLFVFLLYIRFMT 121
              +YGV+  + S+      +  L    GL  ++   +S   + L+ +  Y  ++ 
Sbjct: 82  SLWKYGVLVAVNSLAT--VLIIELFDRIGLGYIVGKFVSTAMTTLWNYAAYRFWVF 135


>gi|328907979|gb|EGG27739.1| GtrA-like protein [Propionibacterium sp. P08]
          Length = 204

 Score = 63.0 bits (152), Expect = 1e-08,   Method: Composition-based stats.
 Identities = 19/158 (12%), Positives = 48/158 (30%), Gaps = 36/158 (22%)

Query: 3   QCIIFIINIVVVFFIDVMGFFILMKCGADPFYSR--------------------IFSIAV 42
           + I F +     F ++V+   I+ K      +++                    +    V
Sbjct: 20  EFIKFGVVGGSGFLVNVVVAIIMNKANGGTEHAQDILFNLAGTRWNFRFTSLVWLVGFVV 79

Query: 43  AFLVTWIPSRLFIFLKL-RRKSFLETVRYGVMYFMLSILNYAFYVKLLLTFQGLQ----- 96
           A +  +  +R + F +  RR  + E   +  +  + +I+     +        +      
Sbjct: 80  ANITNFQLNRSWTFKRNYRRGWWREFWPFFAVGSVAAIIGMFIKIFFTNPTSPIYLPEPW 139

Query: 97  ----------PLLATVLSAVSSMLFVFLLYIRFMTRRV 124
                        + + + V +M   F +   +  R V
Sbjct: 140 FHEERGIQSREYWSQIFAIVVTMPINFAINKLWTFRTV 177


>gi|314966097|gb|EFT10196.1| conserved hypothetical protein [Propionibacterium acnes HL082PA2]
 gi|314981869|gb|EFT25962.1| conserved hypothetical protein [Propionibacterium acnes HL110PA3]
 gi|315090795|gb|EFT62771.1| conserved hypothetical protein [Propionibacterium acnes HL110PA4]
 gi|315094948|gb|EFT66924.1| conserved hypothetical protein [Propionibacterium acnes HL060PA1]
 gi|315104268|gb|EFT76244.1| conserved hypothetical protein [Propionibacterium acnes HL050PA2]
 gi|327328026|gb|EGE69795.1| hypothetical protein HMPREF9341_01078 [Propionibacterium acnes
           HL103PA1]
          Length = 219

 Score = 63.0 bits (152), Expect = 1e-08,   Method: Composition-based stats.
 Identities = 18/159 (11%), Positives = 49/159 (30%), Gaps = 36/159 (22%)

Query: 3   QCIIFIINIVVVFFIDVMGFFILMKCGADPFYSR--------------------IFSIAV 42
           + I F +     F ++++   I+ K      +++                    +    V
Sbjct: 35  EFIKFGVVGGSGFLVNIIVAIIMNKANGGTEHAQDILFNLAGTRWNFRFTSLVWLVGFVV 94

Query: 43  AFLVTWIPSRLFIFLKL-RRKSFLETVRYGVMYFMLSILNYAFYVKLLLTFQGLQ----- 96
           A +  +  +R + F +  RR  + E   +  +  + +I+     +        +      
Sbjct: 95  ANITNFQLNRSWTFKREYRRGWWREFWPFFAVGSIAAIIGMFIKIFFTNPTSPIYLPEPW 154

Query: 97  ----------PLLATVLSAVSSMLFVFLLYIRFMTRRVY 125
                        + + + V +M   F++   +  R V 
Sbjct: 155 FNEGRGIQSREYWSQIFAIVVTMPINFVVNKLWTFRAVK 193


>gi|313836651|gb|EFS74365.1| conserved hypothetical protein [Propionibacterium acnes HL037PA2]
 gi|314928159|gb|EFS91990.1| conserved hypothetical protein [Propionibacterium acnes HL044PA1]
 gi|314972157|gb|EFT16254.1| conserved hypothetical protein [Propionibacterium acnes HL037PA3]
          Length = 208

 Score = 63.0 bits (152), Expect = 1e-08,   Method: Composition-based stats.
 Identities = 19/158 (12%), Positives = 48/158 (30%), Gaps = 36/158 (22%)

Query: 3   QCIIFIINIVVVFFIDVMGFFILMKCGADPFYSR--------------------IFSIAV 42
           + I F +     F ++V+   I+ K      +++                    +    V
Sbjct: 24  EFIKFGVVGGSGFLVNVVVAIIMNKANGGTEHAQDILFNLAGTRWNFRFTSLVWLVGFVV 83

Query: 43  AFLVTWIPSRLFIFLKL-RRKSFLETVRYGVMYFMLSILNYAFYVKLLLTFQGLQ----- 96
           A +  +  +R + F +  RR  + E   +  +  + +I+     +        +      
Sbjct: 84  ANITNFQLNRSWTFKRNYRRGWWREFWPFFAVGSVAAIIGMFIKIFFTNPTSPIYLPEPW 143

Query: 97  ----------PLLATVLSAVSSMLFVFLLYIRFMTRRV 124
                        + + + V +M   F +   +  R V
Sbjct: 144 FHEERGIQSREYWSQIFAIVVTMPINFAINKLWTFRTV 181


>gi|271967656|ref|YP_003341852.1| cell wall biogenesis glycosyltransferase-like protein
           [Streptosporangium roseum DSM 43021]
 gi|270510831|gb|ACZ89109.1| Glycosyltransferase probably involved in cell wall biogenesis-like
           protein [Streptosporangium roseum DSM 43021]
          Length = 402

 Score = 63.0 bits (152), Expect = 1e-08,   Method: Composition-based stats.
 Identities = 21/124 (16%), Positives = 39/124 (31%), Gaps = 5/124 (4%)

Query: 2   KQCIIFIINIVVVFFIDVMGFFILMKCGADPFYSRIFSIAVAFLVTWIPSRLFIFLKLRR 61
           +Q   F +  V+     +  F  L         +   ++ +  +     +R F F    R
Sbjct: 270 RQLPSFAVIGVISTLAHLALFVTLR-LVVPAVVANGLALLITAVANTAANRRFTFGVTGR 328

Query: 62  KSFL----ETVRYGVMYFMLSILNYAFYVKLLLTFQGLQPLLATVLSAVSSMLFVFLLYI 117
              L    E     ++  +LS    A    L         + A V +   + L  FLL  
Sbjct: 329 AGALRHQLEGGLAFLIGLLLSTGGLALLGYLAPGASTAVEIAAVVAANALATLVRFLLLR 388

Query: 118 RFMT 121
            ++ 
Sbjct: 389 VWVF 392


>gi|226363364|ref|YP_002781146.1| hypothetical protein ROP_39540 [Rhodococcus opacus B4]
 gi|226241853|dbj|BAH52201.1| hypothetical membrane protein [Rhodococcus opacus B4]
          Length = 143

 Score = 63.0 bits (152), Expect = 1e-08,   Method: Composition-based stats.
 Identities = 16/123 (13%), Positives = 47/123 (38%), Gaps = 5/123 (4%)

Query: 3   QCIIFIINIVVVFFIDVMGFFILMKC-GADPFYSRIFSIAVAFLVTWIPSRLFIFLKLRR 61
           Q + F++   +   +D   +F+L +  G     ++  S        ++ +R + F     
Sbjct: 21  QIVRFVLTGGLSAIVDFGLYFLLFEVVGLPVNVAKSISFIAGTTTAYLINRRWTFKAEPS 80

Query: 62  KSFLETVRYGVMYFMLSILNYAFYVKLLLTFQ--GLQPLLATVLSAVSSMLFVFLLYIRF 119
           ++    V   ++Y +   +       +   F     +  LA V++  ++ +  F++    
Sbjct: 81  RA--RFVAVVILYAVTFAVQVGLNWVMYHAFPDEWWRLPLAFVIAQGTATVINFVVQRAV 138

Query: 120 MTR 122
           + +
Sbjct: 139 IFK 141


>gi|314968569|gb|EFT12667.1| conserved hypothetical protein [Propionibacterium acnes HL037PA1]
          Length = 219

 Score = 62.6 bits (151), Expect = 1e-08,   Method: Composition-based stats.
 Identities = 17/159 (10%), Positives = 49/159 (30%), Gaps = 36/159 (22%)

Query: 3   QCIIFIINIVVVFFIDVMGFFILMKCGADPFYSR--------------------IFSIAV 42
           + I F +     F ++++   I+ K      +++                    +    V
Sbjct: 35  EFIKFGVVGGSGFLVNIIVAIIMNKANGGTEHAQDILFNLAGTRWNFCFTSLVWLVGFVV 94

Query: 43  AFLVTWIPSRLFIFLKL-RRKSFLETVRYGVMYFMLSILNYAFYVKLLLTFQGLQ----- 96
           A +  +  +R + F +  RR  + E   +  +  + +I+     +        +      
Sbjct: 95  ANITNFQLNRSWTFKREYRRGWWREFWPFFAVGSIAAIIGMFIKIFFTNPTSPIYLPEPW 154

Query: 97  ----------PLLATVLSAVSSMLFVFLLYIRFMTRRVY 125
                        + + + + +M   F++   +  R V 
Sbjct: 155 FNEGRGIQSREYWSQIFAIIVTMPINFVVNKLWTFRAVK 193


>gi|327334310|gb|EGE76024.1| hypothetical protein HMPREF9344_01211 [Propionibacterium acnes
           HL097PA1]
          Length = 219

 Score = 62.6 bits (151), Expect = 2e-08,   Method: Composition-based stats.
 Identities = 18/159 (11%), Positives = 49/159 (30%), Gaps = 36/159 (22%)

Query: 3   QCIIFIINIVVVFFIDVMGFFILMKCGADPFYSR--------------------IFSIAV 42
           + I F +     F ++++   I+ K      +++                    +    V
Sbjct: 35  EFIKFGVVGGSGFLVNIIVAIIMNKANGGTEHAQDILFNLAGTRWNFRFTSLVWLVGFVV 94

Query: 43  AFLVTWIPSRLFIFLKL-RRKSFLETVRYGVMYFMLSILNYAFYVKLLLTFQGLQ----- 96
           A +  +  +R + F +  RR  + E   +  +  + +I+     V        +      
Sbjct: 95  ANITNFQLNRSWTFKREYRRGWWREFWPFFAVGSIAAIIGMFIKVFFTNPTSPIYLPEPW 154

Query: 97  ----------PLLATVLSAVSSMLFVFLLYIRFMTRRVY 125
                        + + + + +M   F++   +  R V 
Sbjct: 155 FNEGRGIQSREYWSQIFAIIVTMPINFVVNKLWTFRAVK 193


>gi|118619989|ref|YP_908321.1| hypothetical protein MUL_4968 [Mycobacterium ulcerans Agy99]
 gi|118572099|gb|ABL06850.1| conserved hypothetical membrane protein [Mycobacterium ulcerans
           Agy99]
          Length = 146

 Score = 62.6 bits (151), Expect = 2e-08,   Method: Composition-based stats.
 Identities = 21/122 (17%), Positives = 45/122 (36%), Gaps = 1/122 (0%)

Query: 3   QCIIFIINIVVVFFIDVMGFFILMKC-GADPFYSRIFSIAVAFLVTWIPSRLFIFLKLRR 61
           Q I FI+       +D   + +L K  G     S+  S+ +  +  ++ +R + F     
Sbjct: 24  QMIRFIVTGGFAAIVDFSVYVVLYKVVGLQVDLSKFISVVIGTITAYLINRRWTFQAAPC 83

Query: 62  KSFLETVRYGVMYFMLSILNYAFYVKLLLTFQGLQPLLATVLSAVSSMLFVFLLYIRFMT 121
            +    V           +        L+ ++G    +A V++   S +  F++    + 
Sbjct: 84  GARFAAVMALYGVTFAVQVGINHLCLALMHYRGWAIPVAFVIAQAVSTVINFVVQRAVIF 143

Query: 122 RR 123
           RR
Sbjct: 144 RR 145


>gi|222084545|ref|YP_002543074.1| hypothetical protein Arad_0461 [Agrobacterium radiobacter K84]
 gi|221721993|gb|ACM25149.1| conserved hypothetical membrane protein [Agrobacterium radiobacter
           K84]
          Length = 128

 Score = 62.6 bits (151), Expect = 2e-08,   Method: Composition-based stats.
 Identities = 41/123 (33%), Positives = 63/123 (51%), Gaps = 1/123 (0%)

Query: 1   MKQCIIFIINIVVVFFIDVMGFFILMKCG-ADPFYSRIFSIAVAFLVTWIPSRLFIFLKL 59
           MK+ + F+I   V F +D     +L+      PF  R  SI  A L TW  +R F F + 
Sbjct: 1   MKKLLRFLIAGGVGFVVDAGVLHLLLWYTPFGPFVGRAVSIPSALLATWFLNRNFTFGRS 60

Query: 60  RRKSFLETVRYGVMYFMLSILNYAFYVKLLLTFQGLQPLLATVLSAVSSMLFVFLLYIRF 119
            R    E  RYG +    ++LNYA +  LL+    L+P++A +L++ ++  F F  Y RF
Sbjct: 61  GRSLAAEGFRYGSVGLTSAVLNYALFSSLLVAEPSLRPIIALILASAAATAFSFFGYSRF 120

Query: 120 MTR 122
           + R
Sbjct: 121 VFR 123


>gi|297527110|ref|YP_003669134.1| GtrA family protein [Staphylothermus hellenicus DSM 12710]
 gi|297256026|gb|ADI32235.1| GtrA family protein [Staphylothermus hellenicus DSM 12710]
          Length = 299

 Score = 62.6 bits (151), Expect = 2e-08,   Method: Composition-based stats.
 Identities = 17/133 (12%), Positives = 43/133 (32%), Gaps = 15/133 (11%)

Query: 3   QCIIFIINIVVVFFIDVM---------GFFILMKCGADPFYSRIFSIAVAFLVTWIPSRL 53
           + I F +  +  FFI+ +           + ++      F + I     +    +I   L
Sbjct: 161 RIIKFGLVGLSGFFINYLSVAYVLGLLTTYNILYQTTTHFLASIIGFETSLTWNFILHEL 220

Query: 54  FIFLKLRRK-----SFLETVRYGVMYFMLSILNYAFYVKLLLTFQGLQPLLATVLSAVSS 108
           + F  L+            ++Y  +  + S +     V +L    G   L +     +  
Sbjct: 221 WTFRDLKLSKRLFARIKRWLKYH-VASIGSFITQTTSVTILSGIMGAPLLCSVATGVMFG 279

Query: 109 MLFVFLLYIRFMT 121
            +  +++   +  
Sbjct: 280 FIVNYMIGRFYTW 292


>gi|326790811|ref|YP_004308632.1| GtrA family protein [Clostridium lentocellum DSM 5427]
 gi|326541575|gb|ADZ83434.1| GtrA family protein [Clostridium lentocellum DSM 5427]
          Length = 136

 Score = 62.6 bits (151), Expect = 2e-08,   Method: Composition-based stats.
 Identities = 19/122 (15%), Positives = 48/122 (39%), Gaps = 2/122 (1%)

Query: 2   KQCIIFIINIVVVFFIDVMGFFILMKCGADPFYSRIFSIAVAFLVTWIPSRLFIFLKLRR 61
           +Q I FII  V    I ++ +++++  G     + IF      L  +  +R ++F   + 
Sbjct: 16  RQFIRFIIVGVSNLTISLVTYYLMLYLGVYYQIANIFGFVFGSLNGYFWNRNWVFKIKQN 75

Query: 62  KSFLETVRYGVMYFMLSILNYAFYVKLLLTFQGLQPLLATVLSAVSSMLFVFLLYIRFMT 121
                 +++   Y    IL+        +   G+  ++A  ++   +    ++L   +  
Sbjct: 76  SII-SILKFYSTYLGTWILSTILLWLE-IEIIGISEMIAPFINIFITTPLNYVLNKYWTF 133

Query: 122 RR 123
            +
Sbjct: 134 EK 135


>gi|282854592|ref|ZP_06263927.1| conserved hypothetical protein [Propionibacterium acnes J139]
 gi|282582174|gb|EFB87556.1| conserved hypothetical protein [Propionibacterium acnes J139]
          Length = 204

 Score = 62.6 bits (151), Expect = 2e-08,   Method: Composition-based stats.
 Identities = 18/159 (11%), Positives = 49/159 (30%), Gaps = 36/159 (22%)

Query: 3   QCIIFIINIVVVFFIDVMGFFILMKCGADPFYSR--------------------IFSIAV 42
           + I F +     F ++++   I+ K      +++                    +    V
Sbjct: 20  EFIKFGVVGGSGFLVNIIVAIIMNKANGGTEHAQDILFNLAGTRWNFRFTSLVWLVGFVV 79

Query: 43  AFLVTWIPSRLFIFLKL-RRKSFLETVRYGVMYFMLSILNYAFYVKLLLTFQGLQ----- 96
           A +  +  +R + F +  RR  + E   +  +  + +I+     +        +      
Sbjct: 80  ANITNFQLNRSWTFKREYRRGWWREFWPFFAVGSIAAIIGMFIKIFFTNPTSPIYLPEPW 139

Query: 97  ----------PLLATVLSAVSSMLFVFLLYIRFMTRRVY 125
                        + + + V +M   F++   +  R V 
Sbjct: 140 FNEGRGIQSREYWSQIFAIVVTMPINFVVNKLWTFRAVK 178


>gi|229164379|ref|ZP_04292309.1| GtrA [Bacillus cereus R309803]
 gi|228619122|gb|EEK76018.1| GtrA [Bacillus cereus R309803]
          Length = 127

 Score = 62.6 bits (151), Expect = 2e-08,   Method: Composition-based stats.
 Identities = 16/121 (13%), Positives = 51/121 (42%), Gaps = 2/121 (1%)

Query: 1   MKQCIIFIINIVVVFFIDVMGFFILMKCGADPFYSRIFSIAVAFLVTWIPSRLFIFLKLR 60
           M++ + F +  +    I ++ F+IL+K G +   +   +  +    ++  ++ ++F    
Sbjct: 1   MEKLLKFGLVGIFNTLITIISFWILLKFGMNYLIANTIAYLIGVANSYYWNKNWVFKPNN 60

Query: 61  RKSFLETVRYGVMYFMLSILNYAFYVKLLLTFQGLQPLLATVLSAVSSMLFVFLLYIRFM 120
           + + +   ++  +  ++   N      +L+       L+A + +    M+  F+L   + 
Sbjct: 61  KSTSM-FFKFLTVNLIVLAFNTLCL-FILVDKLTFNALIAQIFAIGVGMVINFVLNKIWT 118

Query: 121 T 121
            
Sbjct: 119 F 119


>gi|209519605|ref|ZP_03268396.1| GtrA family protein [Burkholderia sp. H160]
 gi|209499959|gb|EEA00024.1| GtrA family protein [Burkholderia sp. H160]
          Length = 135

 Score = 62.6 bits (151), Expect = 2e-08,   Method: Composition-based stats.
 Identities = 21/122 (17%), Positives = 49/122 (40%), Gaps = 4/122 (3%)

Query: 1   MKQCIIFIINIVVVFFIDVMGFFILMKCGADPFYSRIFSIAVAFLVTWIPSRLFIFLKLR 60
           ++Q I +++   +   I  +  FI+   GA P  + +   A+   +++  +  F F    
Sbjct: 14  LRQFIKYLLVGGLNTAISAVIIFIVQAAGAIPVVANVTGYAIGVALSFALNSKFTFKTAA 73

Query: 61  RKSFLETVRYGVMYFMLSILNYAFYVKLLLTFQGLQPLLATVLSAVSSMLFVFLLYIRFM 120
            +     +R+ ++  +  + N A  + +L       P LA +      ++  FL    + 
Sbjct: 74  TRHT--AIRFLIVVLISYLANLATMLSVLHLTH--APYLAQLCGIPVYVIVGFLGNRYWA 129

Query: 121 TR 122
            R
Sbjct: 130 MR 131



 Score = 34.1 bits (77), Expect = 7.0,   Method: Composition-based stats.
 Identities = 9/57 (15%), Positives = 28/57 (49%)

Query: 5   IIFIINIVVVFFIDVMGFFILMKCGADPFYSRIFSIAVAFLVTWIPSRLFIFLKLRR 61
           I F+I +++ +  ++     ++     P+ +++  I V  +V ++ +R +   +  R
Sbjct: 79  IRFLIVVLISYLANLATMLSVLHLTHAPYLAQLCGIPVYVIVGFLGNRYWAMRERTR 135


>gi|16082563|ref|NP_394319.1| hypothetical protein Ta0860m [Thermoplasma acidophilum DSM 1728]
          Length = 312

 Score = 62.6 bits (151), Expect = 2e-08,   Method: Composition-based stats.
 Identities = 15/129 (11%), Positives = 43/129 (33%), Gaps = 8/129 (6%)

Query: 6   IFIINIVVVFFIDVMGFFILMKCGADPFYSRIFSIAVAFLVTWIPSRLFIFLKLR----- 60
            ++I       ++     +L        ++  F+I  +    ++ +  + F         
Sbjct: 187 KYMIVGTTGILLNEFMLKMLSY-HLPLTFADAFAIETSITSNFLMNEYWTFNNRDVTKGV 245

Query: 61  RKSFLETVRYGVMYFMLSILNYAFYVKLLLTFQGLQPLLATVLSAVSSMLFVFLLYIRFM 120
           +  F     + +   +   +N   +    L   G++ L A ++    + L  +L+  R +
Sbjct: 246 KGFFRRMGFHNLTSLIGLGINLGIFTA--LVDTGMEMLAANLIGIAVAFLSRYLMSSRIV 303

Query: 121 TRRVYFIKK 129
                  K+
Sbjct: 304 WHGPTKTKE 312


>gi|310286741|ref|YP_003937999.1| GtrA family protein [Bifidobacterium bifidum S17]
 gi|311063639|ref|YP_003970364.1| hypothetical protein BBPR_0198 [Bifidobacterium bifidum PRL2010]
 gi|309250677|gb|ADO52425.1| GtrA family protein [Bifidobacterium bifidum S17]
 gi|310865958|gb|ADP35327.1| Conserved hypothetical membrane spanning protein with GtrA-like
           domain [Bifidobacterium bifidum PRL2010]
          Length = 177

 Score = 62.6 bits (151), Expect = 2e-08,   Method: Composition-based stats.
 Identities = 22/127 (17%), Positives = 43/127 (33%), Gaps = 12/127 (9%)

Query: 5   IIFIINIVVVFFIDVMGFFILMKCGADPFYSRIFSIAVAFLVTWIPSRLFIFLKL-RRKS 63
           + F I  VV F ID     IL+        +   S  V+ +  ++ S  F+F        
Sbjct: 1   MKFGIVGVVAFIIDWGLMNILLMTHMHNVLATSISFFVSLIFNYLASMKFVFKHRPDMAR 60

Query: 64  FLETVRYGVMYFMLSILNYAFYVKLLLTFQG-----------LQPLLATVLSAVSSMLFV 112
           ++E   + V   +   +N A                      L   +  +++ V  M++ 
Sbjct: 61  WMEIAIFFVAALIGWFMNEAIVWTSTSWMPHDSMYSMHTKYVLWTNVGKLVATVVVMIWN 120

Query: 113 FLLYIRF 119
           F++    
Sbjct: 121 FVIRKWL 127


>gi|50842927|ref|YP_056154.1| GtrA-like protein [Propionibacterium acnes KPA171202]
 gi|50840529|gb|AAT83196.1| conserved GtrA-like protein [Propionibacterium acnes KPA171202]
 gi|313763653|gb|EFS35017.1| conserved hypothetical protein [Propionibacterium acnes HL013PA1]
 gi|313773591|gb|EFS39557.1| conserved hypothetical protein [Propionibacterium acnes HL074PA1]
 gi|313801434|gb|EFS42685.1| conserved hypothetical protein [Propionibacterium acnes HL110PA2]
 gi|313807886|gb|EFS46367.1| conserved hypothetical protein [Propionibacterium acnes HL087PA2]
 gi|313811643|gb|EFS49357.1| conserved hypothetical protein [Propionibacterium acnes HL083PA1]
 gi|313813548|gb|EFS51262.1| conserved hypothetical protein [Propionibacterium acnes HL025PA1]
 gi|313816830|gb|EFS54544.1| conserved hypothetical protein [Propionibacterium acnes HL059PA1]
 gi|313819671|gb|EFS57385.1| conserved hypothetical protein [Propionibacterium acnes HL046PA2]
 gi|313822223|gb|EFS59937.1| conserved hypothetical protein [Propionibacterium acnes HL036PA1]
 gi|313823544|gb|EFS61258.1| conserved hypothetical protein [Propionibacterium acnes HL036PA2]
 gi|313825871|gb|EFS63585.1| conserved hypothetical protein [Propionibacterium acnes HL063PA1]
 gi|313831384|gb|EFS69098.1| conserved hypothetical protein [Propionibacterium acnes HL007PA1]
 gi|313834996|gb|EFS72710.1| conserved hypothetical protein [Propionibacterium acnes HL056PA1]
 gi|313839846|gb|EFS77560.1| conserved hypothetical protein [Propionibacterium acnes HL086PA1]
 gi|314914655|gb|EFS78486.1| conserved hypothetical protein [Propionibacterium acnes HL005PA4]
 gi|314919232|gb|EFS83063.1| conserved hypothetical protein [Propionibacterium acnes HL050PA1]
 gi|314924617|gb|EFS88448.1| conserved hypothetical protein [Propionibacterium acnes HL036PA3]
 gi|314930536|gb|EFS94367.1| conserved hypothetical protein [Propionibacterium acnes HL067PA1]
 gi|314954304|gb|EFS98710.1| conserved hypothetical protein [Propionibacterium acnes HL027PA1]
 gi|314957417|gb|EFT01520.1| conserved hypothetical protein [Propionibacterium acnes HL002PA1]
 gi|314962019|gb|EFT06120.1| conserved hypothetical protein [Propionibacterium acnes HL002PA2]
 gi|314963599|gb|EFT07699.1| conserved hypothetical protein [Propionibacterium acnes HL082PA1]
 gi|314974259|gb|EFT18355.1| conserved hypothetical protein [Propionibacterium acnes HL053PA1]
 gi|314976736|gb|EFT20831.1| conserved hypothetical protein [Propionibacterium acnes HL045PA1]
 gi|314978886|gb|EFT22980.1| conserved hypothetical protein [Propionibacterium acnes HL072PA2]
 gi|314984438|gb|EFT28530.1| conserved hypothetical protein [Propionibacterium acnes HL005PA1]
 gi|314990814|gb|EFT34905.1| conserved hypothetical protein [Propionibacterium acnes HL005PA3]
 gi|315079453|gb|EFT51446.1| conserved hypothetical protein [Propionibacterium acnes HL053PA2]
 gi|315081320|gb|EFT53296.1| conserved hypothetical protein [Propionibacterium acnes HL078PA1]
 gi|315083521|gb|EFT55497.1| conserved hypothetical protein [Propionibacterium acnes HL027PA2]
 gi|315087201|gb|EFT59177.1| conserved hypothetical protein [Propionibacterium acnes HL002PA3]
 gi|315089375|gb|EFT61351.1| conserved hypothetical protein [Propionibacterium acnes HL072PA1]
 gi|315095399|gb|EFT67375.1| conserved hypothetical protein [Propionibacterium acnes HL038PA1]
 gi|315099280|gb|EFT71256.1| conserved hypothetical protein [Propionibacterium acnes HL059PA2]
 gi|315100486|gb|EFT72462.1| conserved hypothetical protein [Propionibacterium acnes HL046PA1]
 gi|315106736|gb|EFT78712.1| conserved hypothetical protein [Propionibacterium acnes HL030PA1]
 gi|327328340|gb|EGE70102.1| hypothetical protein HMPREF9338_01357 [Propionibacterium acnes
           HL096PA2]
 gi|327329795|gb|EGE71551.1| hypothetical protein HMPREF9337_01859 [Propionibacterium acnes
           HL096PA3]
 gi|327444124|gb|EGE90778.1| hypothetical protein HMPREF9571_02255 [Propionibacterium acnes
           HL043PA2]
 gi|327444997|gb|EGE91651.1| hypothetical protein HMPREF9570_02059 [Propionibacterium acnes
           HL043PA1]
 gi|327446480|gb|EGE93134.1| hypothetical protein HMPREF9568_01062 [Propionibacterium acnes
           HL013PA2]
 gi|327451934|gb|EGE98588.1| hypothetical protein HMPREF9584_02140 [Propionibacterium acnes
           HL092PA1]
 gi|327455031|gb|EGF01686.1| hypothetical protein HMPREF9581_01219 [Propionibacterium acnes
           HL087PA3]
 gi|327457681|gb|EGF04336.1| hypothetical protein HMPREF9586_00257 [Propionibacterium acnes
           HL083PA2]
 gi|328752236|gb|EGF65852.1| hypothetical protein HMPREF9563_02505 [Propionibacterium acnes
           HL020PA1]
 gi|328755137|gb|EGF68753.1| hypothetical protein HMPREF9579_01164 [Propionibacterium acnes
           HL087PA1]
 gi|328758085|gb|EGF71701.1| hypothetical protein HMPREF9588_01024 [Propionibacterium acnes
           HL025PA2]
 gi|328760091|gb|EGF73670.1| hypothetical protein HMPREF9343_02150 [Propionibacterium acnes
           HL099PA1]
 gi|332675865|gb|AEE72681.1| conserved GtrA-like protein [Propionibacterium acnes 266]
          Length = 219

 Score = 62.6 bits (151), Expect = 2e-08,   Method: Composition-based stats.
 Identities = 17/159 (10%), Positives = 49/159 (30%), Gaps = 36/159 (22%)

Query: 3   QCIIFIINIVVVFFIDVMGFFILMKCGADPFYSR--------------------IFSIAV 42
           + I F +     F ++++   I+ K      +++                    +    V
Sbjct: 35  EFIKFGVVGGSGFLVNIIVAIIMNKANGGTEHAQDILFNLAGTRWNFRFTSLVWLVGFVV 94

Query: 43  AFLVTWIPSRLFIFLKL-RRKSFLETVRYGVMYFMLSILNYAFYVKLLLTFQGLQ----- 96
           A +  +  +R + F +  RR  + E   +  +  + +I+     +        +      
Sbjct: 95  ANITNFQLNRSWTFKREYRRGWWREFWPFFAVGSIAAIIGMFIKIFFTNPTSPIYLPEPW 154

Query: 97  ----------PLLATVLSAVSSMLFVFLLYIRFMTRRVY 125
                        + + + + +M   F++   +  R V 
Sbjct: 155 FNEGRGIQSREYWSQIFAIIVTMPINFVVNKLWTFRAVK 193


>gi|54027295|ref|YP_121537.1| putative glycosyltransferase [Nocardia farcinica IFM 10152]
 gi|54018803|dbj|BAD60173.1| putative glycosyltransferase [Nocardia farcinica IFM 10152]
          Length = 420

 Score = 62.6 bits (151), Expect = 2e-08,   Method: Composition-based stats.
 Identities = 16/126 (12%), Positives = 43/126 (34%), Gaps = 6/126 (4%)

Query: 1   MKQCIIFIINIVVVFFIDVMGFFILMKCGADPFYSRIFSIAVAFLVTWIPSRLFIFLKLR 60
           + Q + F I  V+      M  +++++  A    +   ++ +  +     +R F F    
Sbjct: 280 VGQVVRFAIIGVLSTLA-YMLLYLVLQPVAGAQGANFLALLLTAIANTAANRAFTFGVRG 338

Query: 61  RKSFL----ETVRYGVMYFMLSILNYAFYVKLLLTFQGLQPLLATVLSAVSSMLFVFLLY 116
               L    + +       +++  +     +          L+  V + + + L  FL  
Sbjct: 339 PGRVLTHQFQGLLIFGFGLLVTSGSLFALHRWAPAAPVHVELVVLVTANLVATLARFLGL 398

Query: 117 IRFMTR 122
             ++ R
Sbjct: 399 R-WVFR 403


>gi|153953292|ref|YP_001394057.1| hypothetical protein CKL_0655 [Clostridium kluyveri DSM 555]
 gi|146346173|gb|EDK32709.1| Conserved hypothetical protein [Clostridium kluyveri DSM 555]
          Length = 143

 Score = 62.6 bits (151), Expect = 2e-08,   Method: Composition-based stats.
 Identities = 19/124 (15%), Positives = 47/124 (37%), Gaps = 4/124 (3%)

Query: 1   MKQCIIFIINIVVVFFIDVMGFFIL-MKCGADPFYSRIFSIAVAFLVTWIPSRLFIF--L 57
           +K    F    V+   +D   F I     G     S++       + ++I ++ + F   
Sbjct: 20  LKCISRFSATGVLNTLVDFCVFTICESLFGIHYALSQVLGYGFGIINSFIMNKKWTFESK 79

Query: 58  KLRRKSFLETVRYGVMYFMLSILNYAFYVKLLLTFQGLQPLLATVLSAVSSMLFVFLLYI 117
              +K + E +++ V+      +        L+    +   ++ V+  + + +  FLLY 
Sbjct: 80  ASNKKVYHELIQFIVVNVCSLTITVVCMKL-LVNNFSINIYISKVIVTLIAQVVNFLLYK 138

Query: 118 RFMT 121
            ++ 
Sbjct: 139 LWVF 142


>gi|139439001|ref|ZP_01772461.1| Hypothetical protein COLAER_01467 [Collinsella aerofaciens ATCC
           25986]
 gi|133775712|gb|EBA39532.1| Hypothetical protein COLAER_01467 [Collinsella aerofaciens ATCC
           25986]
          Length = 131

 Score = 62.6 bits (151), Expect = 2e-08,   Method: Composition-based stats.
 Identities = 21/121 (17%), Positives = 46/121 (38%), Gaps = 3/121 (2%)

Query: 1   MKQCIIFIINIVVVFFIDVMGFFILMK-CGADPFYSRIFSIAVAFLVTWIPSRLFIFLKL 59
           + Q + F +  V+   ID     +L    G +   +      ++ +  ++ S  ++F   
Sbjct: 5   LAQIMKFGVVGVIATVIDFGIMNLLHYGLGLNILIANTSGFIISLIFNYLASMKYVFAHK 64

Query: 60  -RRKSFLETVRYGVMYFMLSILNYAFYVKLLLTFQGLQPLLATVLSAVSSMLFVFLLYIR 118
                  E + + V+  +   LN    V  L    GL+  +A + +    M++ F+    
Sbjct: 65  EGMSRRREFIIFVVLSVIGLALNDGI-VLTLNAGLGLEANIAKICATALVMVYNFVTRKI 123

Query: 119 F 119
           F
Sbjct: 124 F 124


>gi|154496999|ref|ZP_02035695.1| hypothetical protein BACCAP_01292 [Bacteroides capillosus ATCC
           29799]
 gi|150273398|gb|EDN00526.1| hypothetical protein BACCAP_01292 [Bacteroides capillosus ATCC
           29799]
          Length = 160

 Score = 62.6 bits (151), Expect = 2e-08,   Method: Composition-based stats.
 Identities = 28/147 (19%), Positives = 57/147 (38%), Gaps = 25/147 (17%)

Query: 1   MKQCIIFIINIVVVFFIDVMGFFILMKCGA---------------DPFYSRIFSIAVAFL 45
           +K+ I F +  V+   +D + F++L +                   P+ S   S  VA +
Sbjct: 14  LKRFIKFGLIGVLNTLVDFVVFYLLNRFVIKSGPTVVLLGVTIVAGPYISNAISYVVANI 73

Query: 46  VTWIPSRLFIFLKLRRKSFLETVRYGVMYFMLSILNYAFYVKLLLTF----------QGL 95
            ++I ++ + F K    +  E  RY V      I++       +  F           GL
Sbjct: 74  HSFIWNKFWTFQKKEPLTRREVGRYVVTSCGFLIISSIGLSIFMSFFKLPAFAAVIPAGL 133

Query: 96  QPLLATVLSAVSSMLFVFLLYIRFMTR 122
            PL A + +   +M + +L+   ++ +
Sbjct: 134 IPLAAKIPNTCVTMFYNYLMNKFWVFK 160


>gi|304570491|ref|YP_001262.2| dolichyl-phosphate mannose synthase [Leptospira interrogans serovar
           Copenhageni str. Fiocruz L1-130]
          Length = 351

 Score = 62.6 bits (151), Expect = 2e-08,   Method: Composition-based stats.
 Identities = 25/118 (21%), Positives = 45/118 (38%), Gaps = 2/118 (1%)

Query: 4   CIIFIINIVVVFFIDVMGFFILMKCGADPFYSRIFSIAVAFLVTWIPSRLFIFLKLRRKS 63
              F  + ++   ID   F I+    ++   S IFS  VA    +  ++ F+F       
Sbjct: 229 FFRFAFSSMLTSAIDFCVFTIVYLSVSNLLTSIIFSRTVAGTFNFFVNKRFVFRDPG-GV 287

Query: 64  FLETVRYGVMYFMLSILNYAFYVKLLLTFQGLQPLLATVLSAVSSMLFVFLLYIRFMT 121
            +E V+Y  +   L +L +      L +  G   ++A V       L  F +   F+ 
Sbjct: 288 AVEFVKYAFLVSGLGLLAFTAIRY-LHSMHGWNVIVAKVFVETIFFLVSFAIQREFVF 344


>gi|212639067|ref|YP_002315587.1| hypothetical protein Aflv_1232 [Anoxybacillus flavithermus WK1]
 gi|212560547|gb|ACJ33602.1| Predicted membrane protein [Anoxybacillus flavithermus WK1]
          Length = 131

 Score = 62.6 bits (151), Expect = 2e-08,   Method: Composition-based stats.
 Identities = 19/118 (16%), Positives = 47/118 (39%), Gaps = 4/118 (3%)

Query: 4   CIIFIINIVVVFFIDVMGFFILMKCGADPFYSRIFSIAVAFLVTWIPSRLFIFLKLRRKS 63
              FI+  V   F+D + FF L+       ++++F  +   + ++I +R + F  +    
Sbjct: 9   LFRFIVVGVSNTFVDFLLFFSLIALHVPYMWAQMFGYSAGVINSYIWNRAWTFRSVG-GV 67

Query: 64  FLETVRYGVMYFMLSILNYAFYVKLLLTFQGLQPLLATVLSAVSSMLFVFLLYIRFMT 121
             + VR+  +     I+           F  +   L  +++ +S M   ++    ++ 
Sbjct: 68  KKQFVRFLAVNLCSLIVTIMMLHGFREMFPIV---LNKMIATISGMAINWIGSRMWVF 122


>gi|258517201|ref|YP_003193423.1| GtrA family protein [Desulfotomaculum acetoxidans DSM 771]
 gi|257780906|gb|ACV64800.1| GtrA family protein [Desulfotomaculum acetoxidans DSM 771]
          Length = 139

 Score = 62.6 bits (151), Expect = 2e-08,   Method: Composition-based stats.
 Identities = 17/119 (14%), Positives = 51/119 (42%), Gaps = 1/119 (0%)

Query: 3   QCIIFIINIVVVFFIDVMGFFILMKCGADPFYSRIFSIAVAFLVTWIPSRLFIFLKLRRK 62
           Q I F I  V+   I  + ++IL+    +   S I S ++  + +++ ++ ++F+K    
Sbjct: 9   QFIKFSIVGVINTIISFILYYILISININYLISSILSYSIGMINSFLLNKYWVFIKKSTT 68

Query: 63  SFLETVRYGVMYFMLSILNYAFYVKLLLTFQGLQPLLATVLSAVSSMLFVFLLYIRFMT 121
                +++ ++      +N +  + + ++   +  LL+     +  ++  F     +  
Sbjct: 69  HKHYFIKFIIVNIFTLSIN-SMLLYIFVSKFNINLLLSQFFVTLLVLMINFWGNKFWTF 126


>gi|289426406|ref|ZP_06428149.1| conserved hypothetical protein [Propionibacterium acnes SK187]
 gi|289427752|ref|ZP_06429463.1| conserved hypothetical protein [Propionibacterium acnes J165]
 gi|295130985|ref|YP_003581648.1| hypothetical protein HMPREF0675_4502 [Propionibacterium acnes
           SK137]
 gi|289153134|gb|EFD01852.1| conserved hypothetical protein [Propionibacterium acnes SK187]
 gi|289159016|gb|EFD07209.1| conserved hypothetical protein [Propionibacterium acnes J165]
 gi|291375745|gb|ADD99599.1| conserved hypothetical protein [Propionibacterium acnes SK137]
          Length = 204

 Score = 62.6 bits (151), Expect = 2e-08,   Method: Composition-based stats.
 Identities = 17/159 (10%), Positives = 49/159 (30%), Gaps = 36/159 (22%)

Query: 3   QCIIFIINIVVVFFIDVMGFFILMKCGADPFYSR--------------------IFSIAV 42
           + I F +     F ++++   I+ K      +++                    +    V
Sbjct: 20  EFIKFGVVGGSGFLVNIIVAIIMNKANGGTEHAQDILFNLAGTRWNFRFTSLVWLVGFVV 79

Query: 43  AFLVTWIPSRLFIFLKL-RRKSFLETVRYGVMYFMLSILNYAFYVKLLLTFQGLQ----- 96
           A +  +  +R + F +  RR  + E   +  +  + +I+     +        +      
Sbjct: 80  ANITNFQLNRSWTFKREYRRGWWREFWPFFAVGSIAAIIGMFIKIFFTNPTSPIYLPEPW 139

Query: 97  ----------PLLATVLSAVSSMLFVFLLYIRFMTRRVY 125
                        + + + + +M   F++   +  R V 
Sbjct: 140 FNEGRGIQSREYWSQIFAIIVTMPINFVVNKLWTFRAVK 178


>gi|319785552|ref|YP_004145028.1| GtrA family protein [Mesorhizobium ciceri biovar biserrulae
           WSM1271]
 gi|317171440|gb|ADV14978.1| GtrA family protein [Mesorhizobium ciceri biovar biserrulae
           WSM1271]
          Length = 157

 Score = 62.6 bits (151), Expect = 2e-08,   Method: Composition-based stats.
 Identities = 15/119 (12%), Positives = 39/119 (32%), Gaps = 1/119 (0%)

Query: 3   QCIIFIINIVVVFFIDVMGFFILMKCGADPFYSRIFSIAVAFLVTWIPSRLFIFLKLRRK 62
           + + F    ++   +        +  G     +     A   ++ +  +R + F +    
Sbjct: 13  RMLRFGAVGLLNTALGYAVILAGLALGLGDILANATGYAAGLVLGFFLNRQWTFSRADGF 72

Query: 63  SFLETVRYGVMYFMLSILNYAFYVKLLLTFQGLQPLLATVLSAVSSMLFVFLLYIRFMT 121
                +RYG ++ +   +N A  +          PL+  +       +  +L   RF+ 
Sbjct: 73  KPGTALRYGGVFLVAYSINLAVVIAARSAGIVENPLV-HLAGICVYSVVFYLGSARFVF 130


>gi|313829551|gb|EFS67265.1| conserved hypothetical protein [Propionibacterium acnes HL063PA2]
 gi|315109079|gb|EFT81055.1| conserved hypothetical protein [Propionibacterium acnes HL030PA2]
          Length = 219

 Score = 62.6 bits (151), Expect = 2e-08,   Method: Composition-based stats.
 Identities = 17/159 (10%), Positives = 48/159 (30%), Gaps = 36/159 (22%)

Query: 3   QCIIFIINIVVVFFIDVMGFFILMKCGADPFYSR--------------------IFSIAV 42
           + I F +     F ++++   I+ K      +++                    +    V
Sbjct: 35  EFIKFGVVGGSGFLVNIIVAIIMNKANGGTEHAQDILFNLAGTRWNFRFTSLVWLVGFVV 94

Query: 43  AFLVTWIPSRLFIF-LKLRRKSFLETVRYGVMYFMLSILNYAFYVKLLLTFQGLQ----- 96
           A +  +  +R + F    RR  + E   +  +  + +I+     +        +      
Sbjct: 95  ANITNFQLNRSWTFKRGYRRGWWREFWPFFAVGSIAAIIGMFIKIFFTNPTSPIYLPEPW 154

Query: 97  ----------PLLATVLSAVSSMLFVFLLYIRFMTRRVY 125
                        + + + + +M   F++   +  R V 
Sbjct: 155 FNEGRGIQSREYWSQIFAIIVTMPINFVVNKLWTFRAVK 193


>gi|290962588|ref|YP_003493770.1| sugar translocase [Streptomyces scabiei 87.22]
 gi|260652114|emb|CBG75246.1| putative sugar translocase [Streptomyces scabiei 87.22]
          Length = 202

 Score = 62.6 bits (151), Expect = 2e-08,   Method: Composition-based stats.
 Identities = 13/120 (10%), Positives = 43/120 (35%), Gaps = 4/120 (3%)

Query: 3   QCIIFIINIVVVFFIDVMGFFILMKCGADPFYSRIFSIAVAFLVTWIPSRLFIFLKLRRK 62
           Q   F +  VV   +    + + +        + + + A++   ++  +  F +    R 
Sbjct: 82  QIAAFAVVGVVNTAVYYGLYLLFLHW-MPYLGAHVLAFALSMTGSFFLNARFTY--RTRP 138

Query: 63  SFLETVRYGVMYFMLSILNYAFYVKLLLTFQGLQPLLATVLSAVSSMLFVFLLYIRFMTR 122
           +  + + + +      +L        ++         A +L++ +++   F++    M R
Sbjct: 139 TLRKFLLFPLTNATNFLLTTTGVYV-IVDVLHAGNRFAPLLASGAAVPVTFVVSRSIMLR 197


>gi|210608734|ref|ZP_03287980.1| hypothetical protein CLONEX_00159 [Clostridium nexile DSM 1787]
 gi|210152910|gb|EEA83916.1| hypothetical protein CLONEX_00159 [Clostridium nexile DSM 1787]
          Length = 130

 Score = 62.6 bits (151), Expect = 2e-08,   Method: Composition-based stats.
 Identities = 18/124 (14%), Positives = 50/124 (40%), Gaps = 1/124 (0%)

Query: 1   MKQCIIFIINIVVVFFIDVMGFFILMK-CGADPFYSRIFSIAVAFLVTWIPSRLFIFLKL 59
           +KQ + F +     F ID      L +    +   S   S AV+ +  ++ S  ++F   
Sbjct: 5   IKQIMKFGVVGGSAFVIDYGIMIFLTEVFHINYLISSGISFAVSVIFNYVMSVKWVFEVE 64

Query: 60  RRKSFLETVRYGVMYFMLSILNYAFYVKLLLTFQGLQPLLATVLSAVSSMLFVFLLYIRF 119
             +   +     V+  ++ +      + L +    +  +++ + + +  M++ F+    F
Sbjct: 65  ENRDKKQEFALFVVLSIIGLGINQLIMWLAVEKFRVFYMISKIGATIVVMVYNFVTRKLF 124

Query: 120 MTRR 123
           + ++
Sbjct: 125 LEKK 128


>gi|309801844|ref|ZP_07695961.1| GtrA-like protein [Bifidobacterium dentium JCVIHMP022]
 gi|308221496|gb|EFO77791.1| GtrA-like protein [Bifidobacterium dentium JCVIHMP022]
          Length = 194

 Score = 62.2 bits (150), Expect = 2e-08,   Method: Composition-based stats.
 Identities = 17/132 (12%), Positives = 43/132 (32%), Gaps = 13/132 (9%)

Query: 1   MKQCIIFIINIVVVFFIDVMGFFILMK-CGADPFYSRIFSIAVAFLVTWIPSRLFIFLKL 59
           ++Q + F +  V+ F ID     +L+         +   S  ++ +  +  S   +F   
Sbjct: 13  IEQLMKFGLVGVIAFVIDWGILNLLVGVFHMHNVIAATISFIISLIFNYTASMKLVFKPR 72

Query: 60  -RRKSFLETVRYGVMYFMLSILNYAFYVKLLLTFQGLQPL-----------LATVLSAVS 107
                ++E + + V   +  ++N A              +           +  + +   
Sbjct: 73  DDMARWMEILIFVVGAVIGLLMNDALIWVSTYGMNHDAFVTQHTEYLIRTNVGKLFATAV 132

Query: 108 SMLFVFLLYIRF 119
            M++ FL     
Sbjct: 133 VMVWNFLTRKWL 144



 Score = 35.3 bits (80), Expect = 2.6,   Method: Composition-based stats.
 Identities = 8/62 (12%), Positives = 32/62 (51%), Gaps = 1/62 (1%)

Query: 61  RKSFLETVRYGVMYFMLSILNYAFYVKLLLTFQGLQPLLATVLSAVSSMLFVFLLYIRFM 120
           RK   + +++G++  +  ++++      L+    +  ++A  +S + S++F +   ++ +
Sbjct: 10  RKLIEQLMKFGLVGVIAFVIDWGILNL-LVGVFHMHNVIAATISFIISLIFNYTASMKLV 68

Query: 121 TR 122
            +
Sbjct: 69  FK 70


>gi|323357396|ref|YP_004223792.1| hypothetical protein MTES_0948 [Microbacterium testaceum StLB037]
 gi|323273767|dbj|BAJ73912.1| predicted membrane protein [Microbacterium testaceum StLB037]
          Length = 160

 Score = 62.2 bits (150), Expect = 2e-08,   Method: Composition-based stats.
 Identities = 20/126 (15%), Positives = 48/126 (38%), Gaps = 8/126 (6%)

Query: 6   IFIINIVVVFFIDVMGFFILMKCGADPFYSRIFSIAVAFLVTWIPSRLFIFLKLRRKSF- 64
            F+I   +   I+V  F +L+  G  P  +++ +  +A +  ++ +R + F    R    
Sbjct: 19  RFLIVGAISTAIEVAAFNLLLLAGFGPVAAKVIASLIALVNAYVGNRQWAFRSRSRAGAG 78

Query: 65  LETVRYGVMYFMLSILNYAFYVKLLLTFQGLQ-------PLLATVLSAVSSMLFVFLLYI 117
            + VR+ ++  + + +        +     L          +  + S  +  +  F LY 
Sbjct: 79  RQMVRFLIVNAVCTAIGAGSVWLGVQALNALFGDAGPAGLNIVNLASIAAVTVIRFFLYH 138

Query: 118 RFMTRR 123
             +  R
Sbjct: 139 YVVFPR 144


>gi|302874420|ref|YP_003843053.1| GtrA family protein [Clostridium cellulovorans 743B]
 gi|307690974|ref|ZP_07633420.1| GtrA family protein [Clostridium cellulovorans 743B]
 gi|302577277|gb|ADL51289.1| GtrA family protein [Clostridium cellulovorans 743B]
          Length = 123

 Score = 62.2 bits (150), Expect = 2e-08,   Method: Composition-based stats.
 Identities = 20/125 (16%), Positives = 52/125 (41%), Gaps = 2/125 (1%)

Query: 1   MKQCIIFIINIVVVFFIDVMGFFILMKCGADPFYSRIFSIAVAFLVTWIPSRLFIFLKLR 60
           M Q + F +  V    I ++ + IL+  G +   + I    V  + ++I ++ ++F    
Sbjct: 1   MVQMMKFALVGVSNTAISLIVYNILVVLGVNYMLANIIGYCVGVINSFIWNKNWVFKSNE 60

Query: 61  RKSFLETVRYGVMYFMLSILNYAFYVKLLLTFQGLQPLLATVLSAVSSMLFVFLLYIRFM 120
             S +   ++  +  +  ++    ++ + +   G    ++ + S V  M   +LL   + 
Sbjct: 61  NSSAI-IFKFVAVNILTLVVT-TMFLYIFVDILGYSKFISQIFSTVVGMGINYLLNKIWT 118

Query: 121 TRRVY 125
            + V 
Sbjct: 119 FKEVK 123


>gi|149279411|ref|ZP_01885542.1| glycosyl transferase, group 2 [Pedobacter sp. BAL39]
 gi|149229937|gb|EDM35325.1| glycosyl transferase, group 2 [Pedobacter sp. BAL39]
          Length = 135

 Score = 62.2 bits (150), Expect = 2e-08,   Method: Composition-based stats.
 Identities = 20/120 (16%), Positives = 41/120 (34%), Gaps = 2/120 (1%)

Query: 3   QCIIFIINIVVVFFIDVMGFFILM-KCGADPFYSRIFSIAVAFLVTWIPSRLFIFLKLRR 61
           + + F I       +D    ++   K     + +      VA    ++ +RL+ F +   
Sbjct: 16  KLLKFGIVGFAGLIVDFSVTYLCKEKLKIHKYVASSMGFTVATGTNYLMNRLWTFNQHDP 75

Query: 62  KSFLETVRYGVMYFMLSILNYAFYVKLLLTFQGLQPLLATVLSAVSSMLFVFLLYIRFMT 121
            S ++  +Y V+  +   L+ A     L         LA   + V   L+ F     +  
Sbjct: 76  ASMIQFSKYFVICLVGLALSNALIYL-LNDRLKWNFYLAKACAIVIVSLWNFFANYLYTF 134


>gi|313884779|ref|ZP_07818533.1| GtrA-like protein [Eremococcus coleocola ACS-139-V-Col8]
 gi|312619978|gb|EFR31413.1| GtrA-like protein [Eremococcus coleocola ACS-139-V-Col8]
          Length = 185

 Score = 62.2 bits (150), Expect = 2e-08,   Method: Composition-based stats.
 Identities = 25/122 (20%), Positives = 49/122 (40%), Gaps = 4/122 (3%)

Query: 1   MKQCIIFIINIVVVFFIDVMGF-FILMKCGADPFYSRIFSIAVAFLVTWIPSRLFIFLKL 59
           +KQ + F I  V+   ID   F FI    G     + + + +++ +  +  S  ++F   
Sbjct: 55  IKQIMDFAIVGVIATVIDYTIFVFIYNLLGWHYNVATVIAFSLSTIFNYWASMKYVFKSK 114

Query: 60  --RRKSFLETVRYGVMYFMLSILNYAFYVKLLLTFQGLQPLLATVLSAVSSMLFVFLLYI 117
             +     E + +  +  +  ILN       + T Q + P +A +L     M+F F+   
Sbjct: 115 YAKEDRHREFMIFVGLSIIGLILNVVLMRFSVETLQII-PNIAKILVTGVVMVFNFVTRK 173

Query: 118 RF 119
             
Sbjct: 174 LL 175


>gi|317132016|ref|YP_004091330.1| glycosyl transferase family 2 [Ethanoligenens harbinense YUAN-3]
 gi|315469995|gb|ADU26599.1| glycosyl transferase family 2 [Ethanoligenens harbinense YUAN-3]
          Length = 343

 Score = 62.2 bits (150), Expect = 2e-08,   Method: Composition-based stats.
 Identities = 20/120 (16%), Positives = 44/120 (36%), Gaps = 3/120 (2%)

Query: 5   IIFIINIVVVFFIDVMGFFILMKCGADPFYSRIFSIAVAFLVTWIPSRLFIFLKL--RRK 62
           + F ++ +     D +  F+        F   + + A +  V +I +R  +F      +K
Sbjct: 220 LRFCMSSIAAAVADYVLLFVFQWLTHSLFLGVVLARASSSAVQYILNRSLVFHSRLTNKK 279

Query: 63  SFLETVRYGVMYFMLSILNYAFYVKLLLTFQGLQPLLATVLSAVSSMLFVFLLYIRFMTR 122
                V+Y ++   L  LNY      L     +  L A +++ +      +L     + +
Sbjct: 280 PPHRAVQYYLLVTGLLFLNYLILKV-LTGPLHIWLLWAKIVTELILFFVSYLAQRLLVFK 338


>gi|24215409|ref|NP_712890.1| dolichyl-phosphate mannose synthase [Leptospira interrogans serovar
           Lai str. 56601]
 gi|24196528|gb|AAN49908.1| dolichyl-phosphate mannose synthase [Leptospira interrogans serovar
           Lai str. 56601]
          Length = 351

 Score = 62.2 bits (150), Expect = 2e-08,   Method: Composition-based stats.
 Identities = 24/118 (20%), Positives = 45/118 (38%), Gaps = 2/118 (1%)

Query: 4   CIIFIINIVVVFFIDVMGFFILMKCGADPFYSRIFSIAVAFLVTWIPSRLFIFLKLRRKS 63
              F  + ++   ID   F ++    ++   S IFS  VA    +  ++ F+F       
Sbjct: 229 FFRFAFSSMLTSAIDFCVFTVVYLSVSNLLTSIIFSRTVAGTFNFFVNKRFVFRDPG-GV 287

Query: 64  FLETVRYGVMYFMLSILNYAFYVKLLLTFQGLQPLLATVLSAVSSMLFVFLLYIRFMT 121
            +E V+Y  +   L +L +      L +  G   ++A V       L  F +   F+ 
Sbjct: 288 AVEFVKYAFLVSGLGLLAFTAIRY-LHSMHGWNVIVAKVFVETIFFLVSFAIQREFVF 344


>gi|218289378|ref|ZP_03493612.1| GtrA family protein [Alicyclobacillus acidocaldarius LAA1]
 gi|218240484|gb|EED07665.1| GtrA family protein [Alicyclobacillus acidocaldarius LAA1]
          Length = 143

 Score = 62.2 bits (150), Expect = 2e-08,   Method: Composition-based stats.
 Identities = 19/122 (15%), Positives = 45/122 (36%), Gaps = 4/122 (3%)

Query: 2   KQCIIFIINIVVVFFIDVMGFFILMKC-GADPFYSRIFSIAVAFLVTWIPSRLFIFLKLR 60
           +Q ++F    V+   +D   FF L          +++ S A   + ++  +R   F    
Sbjct: 12  RQVLVFAAVGVLNTAVDTGVFFALGALCHVASAVAQVVSYACGMVNSFAWNRGVTFRA-G 70

Query: 61  RKSFLETVRYGVMYFMLSILNYAFYVKLLLTFQGLQPLLATVLSAVSSMLFVFLLYIRFM 120
              + E  R+ ++  +      +     LL+  G   + A  +  + +    F+    ++
Sbjct: 71  AFRWGEVARFALVNGVSL--TASAVSMGLLSRAGWPLVAAKAVVTMGTWSLNFVGSKWWV 128

Query: 121 TR 122
            R
Sbjct: 129 WR 130


>gi|56551397|ref|YP_162236.1| GtrA family protein [Zymomonas mobilis subsp. mobilis ZM4]
 gi|260752991|ref|YP_003225884.1| GtrA family protein [Zymomonas mobilis subsp. mobilis NCIMB 11163]
 gi|56542971|gb|AAV89125.1| GtrA family protein [Zymomonas mobilis subsp. mobilis ZM4]
 gi|258552354|gb|ACV75300.1| GtrA family protein [Zymomonas mobilis subsp. mobilis NCIMB 11163]
          Length = 150

 Score = 62.2 bits (150), Expect = 2e-08,   Method: Composition-based stats.
 Identities = 24/125 (19%), Positives = 49/125 (39%), Gaps = 4/125 (3%)

Query: 1   MKQCIIFIINIVVVFFIDVMGFFILMKCGAD-PFYSRIFSIAVAFLVTWIPSRLFIFLKL 59
           + Q I F +      F++   +++  K G   P +S      VA +V ++    F F   
Sbjct: 21  LGQVIRFGLTGGFTTFLNAAIYYVGAKWGHMAPLFSNFIGYLVAMIVGYLLHNYFSFRGH 80

Query: 60  R--RKSFLETVRYGVMYFMLSILNYAFYVKLLLTFQGLQPLLATVLSAVSSMLFVFLLYI 117
               + +   +R+ +   +   LN +F+V  ++ +  L            + L  F L  
Sbjct: 81  GCQDRHWQLFLRFCLASLLGLGLN-SFWVGCMVNYLHLMKWTPLPFMVFVTPLVSFWLNR 139

Query: 118 RFMTR 122
           R++ R
Sbjct: 140 RWVFR 144


>gi|224282295|ref|ZP_03645617.1| hypothetical protein BbifN4_00534 [Bifidobacterium bifidum NCIMB
           41171]
          Length = 177

 Score = 62.2 bits (150), Expect = 2e-08,   Method: Composition-based stats.
 Identities = 22/127 (17%), Positives = 43/127 (33%), Gaps = 12/127 (9%)

Query: 5   IIFIINIVVVFFIDVMGFFILMKCGADPFYSRIFSIAVAFLVTWIPSRLFIFLKL-RRKS 63
           + F I  VV F ID     IL+        +   S  V+ +  ++ S  F+F        
Sbjct: 1   MKFGIVGVVAFIIDWGLMNILLMTHMHNVLATSISFFVSLIFNYLASMKFVFKHRPDMAR 60

Query: 64  FLETVRYGVMYFMLSILNYAFYVKLLLTFQG-----------LQPLLATVLSAVSSMLFV 112
           ++E   + V   +   +N A                      L   +  +++ V  M++ 
Sbjct: 61  WMEITIFFVAALIGWFMNEAIVWTSTSWMPHDSMYSMHTRYVLWTNVGKLVATVVVMIWN 120

Query: 113 FLLYIRF 119
           F++    
Sbjct: 121 FVIRKWL 127


>gi|312138246|ref|YP_004005582.1| gtra-like glycosyl transferase [Rhodococcus equi 103S]
 gi|311887585|emb|CBH46897.1| putative GtrA-like glycosyl transferase [Rhodococcus equi 103S]
          Length = 412

 Score = 62.2 bits (150), Expect = 2e-08,   Method: Composition-based stats.
 Identities = 18/126 (14%), Positives = 45/126 (35%), Gaps = 6/126 (4%)

Query: 1   MKQCIIFIINIVVVFFIDVMGFFILMKCGADPFYSRIFSIAVAFLVTWIPSRLFIFLKLR 60
           + Q + F +  V    +     ++  +      ++   ++ V  +     +R F F    
Sbjct: 280 LGQLVRFAVVGVAST-VAYALLYLAFQESVGAQWANALALLVTAVANTAANRAFTFGVRG 338

Query: 61  RKSFLET-VRYGVMYFMLSILNYAFYVKLLLTFQGLQP---LLATVLSAVSSMLFVFLLY 116
           R+      ++  V++     +     V L     G  P   L+  V++ + + L  F+  
Sbjct: 339 RRGAARHQLQGLVVFAFGLAITSGSLVALHRLTPGASPHLELVVLVVANLVATLSRFVGL 398

Query: 117 IRFMTR 122
             ++ R
Sbjct: 399 R-WVFR 403


>gi|229020657|ref|ZP_04177388.1| GtrA [Bacillus cereus AH1273]
 gi|229026869|ref|ZP_04183194.1| GtrA [Bacillus cereus AH1272]
 gi|228734421|gb|EEL85090.1| GtrA [Bacillus cereus AH1272]
 gi|228740630|gb|EEL90897.1| GtrA [Bacillus cereus AH1273]
          Length = 126

 Score = 62.2 bits (150), Expect = 2e-08,   Method: Composition-based stats.
 Identities = 16/121 (13%), Positives = 51/121 (42%), Gaps = 2/121 (1%)

Query: 1   MKQCIIFIINIVVVFFIDVMGFFILMKCGADPFYSRIFSIAVAFLVTWIPSRLFIFLKLR 60
           M++ + F +  V    I ++ + IL+K G +   +   S ++    ++  ++ ++F    
Sbjct: 1   MEKFLKFGLVGVANTLITIISYVILVKLGMNYLAANTLSYSIGVANSYYWNKNWVFQSNG 60

Query: 61  RKSFLETVRYGVMYFMLSILNYAFYVKLLLTFQGLQPLLATVLSAVSSMLFVFLLYIRFM 120
           +   +  +++  +  ++   N      +L++   +   +A + +    M+  F L   + 
Sbjct: 61  KDLSI-FIKFLTVNLIVLAFNTLIL-FILVSKISINEFIAQIFAIGIGMMINFFLNKAWT 118

Query: 121 T 121
            
Sbjct: 119 F 119


>gi|325069085|ref|ZP_08127758.1| glycosyl transferase [Actinomyces oris K20]
          Length = 327

 Score = 62.2 bits (150), Expect = 3e-08,   Method: Composition-based stats.
 Identities = 23/119 (19%), Positives = 45/119 (37%), Gaps = 3/119 (2%)

Query: 4   CIIFIINIVVVFFIDVMGFFILMKCGADPFYSRIFSIAVAFLVTWIPSRLFIFLKLRRKS 63
            + F+   +  F ID +G  ++         + + +  V+    +  +R  +F   R   
Sbjct: 209 LLRFMGASLASFGIDWLGVMVIFAMTGSLLAAVVGARLVSGTANFFMNRR-VFRARRGTV 267

Query: 64  FLETVRYGVMYFMLSILNYAFYVKLLLTFQGLQPLLATVLSAVSSMLFVFLLYIRFMTR 122
               VRY V+   L   +Y       LT  G+   +A VL   +  +  ++   R + R
Sbjct: 268 VRTAVRYAVLAVSLLAASYLMLKA--LTAVGIPLGIAKVLGDGAIYVASYVAQRRLVFR 324


>gi|326803989|ref|YP_004321807.1| glycosyltransferase, group 2 family protein [Aerococcus urinae
           ACS-120-V-Col10a]
 gi|326650487|gb|AEA00670.1| glycosyltransferase, group 2 family protein [Aerococcus urinae
           ACS-120-V-Col10a]
          Length = 361

 Score = 61.8 bits (149), Expect = 3e-08,   Method: Composition-based stats.
 Identities = 14/125 (11%), Positives = 43/125 (34%), Gaps = 9/125 (7%)

Query: 4   CIIFIINIVVVFFIDVMGFFILMKCGAD------PFYSRIFSIAVAFLVTWIPSRLFIFL 57
              +I++ V  F +D++ F +              + + I +  ++ +  +  +R  +F 
Sbjct: 238 FWKYILSSVSSFVVDILLFHLFSVLLPHAASTLTIYLATIIARTISSVFNYTLNRFLVFK 297

Query: 58  KLRRKSFLETVRYGVMYFMLSILNYAFYVKLLLTFQGLQPLLATVLSAVSSMLFVFLLYI 117
           +  +      ++Y  +  +   L+      +    Q     +  V       L  + +  
Sbjct: 298 QESK---QSFIKYVSLVIVQMFLSGGLVSLISTVIQSKATTIIKVFVDSLLFLLSYFIQK 354

Query: 118 RFMTR 122
            F+ +
Sbjct: 355 HFIFK 359



 Score = 34.9 bits (79), Expect = 3.6,   Method: Composition-based stats.
 Identities = 7/61 (11%), Positives = 22/61 (36%), Gaps = 4/61 (6%)

Query: 67  TVRYGVMYFMLSILNYAFYVKLLLTFQGLQ----PLLATVLSAVSSMLFVFLLYIRFMTR 122
             +Y +      +++   +    +            LAT+++   S +F + L    + +
Sbjct: 238 FWKYILSSVSSFVVDILLFHLFSVLLPHAASTLTIYLATIIARTISSVFNYTLNRFLVFK 297

Query: 123 R 123
           +
Sbjct: 298 Q 298


>gi|297544396|ref|YP_003676698.1| GtrA family protein [Thermoanaerobacter mathranii subsp. mathranii
           str. A3]
 gi|296842171|gb|ADH60687.1| GtrA family protein [Thermoanaerobacter mathranii subsp. mathranii
           str. A3]
          Length = 139

 Score = 61.8 bits (149), Expect = 3e-08,   Method: Composition-based stats.
 Identities = 21/124 (16%), Positives = 50/124 (40%), Gaps = 4/124 (3%)

Query: 1   MKQCIIFIINIVVVFFIDVMGFFILMKC-GADPFYSRIFSIAVAFLVTWIPSRLFIF--L 57
           +K    F    +    ID   F +  K  G +  +S+    +   + +++ +R + F   
Sbjct: 16  LKHISRFGTVGITNTLIDFFVFTVFYKIIGVNYVFSQAIGYSCGVINSFVLNRKWTFEVK 75

Query: 58  KLRRKSFLETVRYGVMYFMLSILNYAFYVKLLLTFQGLQPLLATVLSAVSSMLFVFLLYI 117
               K F E V++ V   +  ++     +  L+    L   ++ ++  + + +  FLLY 
Sbjct: 76  NANNKIFWEFVKFLVSNLISLVITM-LTIDYLVKNLQLNVYISKIIVTLIAQVINFLLYK 134

Query: 118 RFMT 121
            ++ 
Sbjct: 135 LWVF 138


>gi|254470444|ref|ZP_05083848.1| hypothetical conserved membrane protein [Pseudovibrio sp. JE062]
 gi|211960755|gb|EEA95951.1| hypothetical conserved membrane protein [Pseudovibrio sp. JE062]
          Length = 132

 Score = 61.8 bits (149), Expect = 3e-08,   Method: Composition-based stats.
 Identities = 32/121 (26%), Positives = 54/121 (44%), Gaps = 2/121 (1%)

Query: 3   QCIIFIINIVVVFFIDVMGFFILMK-CGADPFYSRIFSIAVAFLVTWIPSRLFIFLKLRR 61
           Q I F +       +D+       +  G DP  +RI SI VA    W  +R+F F     
Sbjct: 12  QFIRFGMVGGSGLVVDLAALAFFWQVVGLDPLIARILSIWVAMTNNWFWNRVFTFRSEG- 70

Query: 62  KSFLETVRYGVMYFMLSILNYAFYVKLLLTFQGLQPLLATVLSAVSSMLFVFLLYIRFMT 121
               E  R+ ++  + +++NY+ Y  L+    G    LA +L+ + SM F F+L   +  
Sbjct: 71  SPLGEYFRFVLVNSVGAVINYSTYGALITLIDGFSTYLAVILATLVSMTFNFVLSKIYAF 130

Query: 122 R 122
           +
Sbjct: 131 K 131


>gi|172041629|ref|YP_001801343.1| hypothetical protein cur_1950 [Corynebacterium urealyticum DSM
           7109]
 gi|171852933|emb|CAQ05909.1| putative membrane protein [Corynebacterium urealyticum DSM 7109]
          Length = 194

 Score = 61.8 bits (149), Expect = 3e-08,   Method: Composition-based stats.
 Identities = 20/130 (15%), Positives = 46/130 (35%), Gaps = 11/130 (8%)

Query: 2   KQCIIFIINIVVVFFIDVMGFFILMKC-GADPFYSRIFSIAVAFLVTWIPSRLFIFLKLR 60
           +Q   FI+   +   +D     I     G     ++     +  L  ++ +R + F    
Sbjct: 66  QQIFRFILTGGLSAIVDFGSTAIFTFLFGFSDTVAKTIGFILGTLTAYMINRRWTFNAA- 124

Query: 61  RKSFLETVRYGVMYFMLSILNYAFYVKLLL--------TFQGLQPLLATVLSAVSSMLFV 112
             S    V   + Y +  ++    Y  LL+            +  L++ V++  ++ +  
Sbjct: 125 -PSTKRFVITMITYALTFVVQVGLYKPLLIPLLESQTAFSPLVVRLISFVIAQGTATVLN 183

Query: 113 FLLYIRFMTR 122
           FL+    + R
Sbjct: 184 FLIQRFVIFR 193


>gi|298245150|ref|ZP_06968956.1| GtrA family protein [Ktedonobacter racemifer DSM 44963]
 gi|297552631|gb|EFH86496.1| GtrA family protein [Ktedonobacter racemifer DSM 44963]
          Length = 201

 Score = 61.8 bits (149), Expect = 3e-08,   Method: Composition-based stats.
 Identities = 18/136 (13%), Positives = 52/136 (38%), Gaps = 12/136 (8%)

Query: 1   MKQCIIFIINIVVVFFIDVMGFFILMKC-------GADPFYSRIFSIAVAFLVTWIPSRL 53
           +++   +++       ++++ + I+                + + +  ++ +  +IP+  
Sbjct: 62  LQRLSSYVVIGGFAAVVNLIVYSIVYHFVPVPGPDTVHLVVAFLCATEISIMANFIPNDY 121

Query: 54  FIFLK----LRRKSFLETVRYGVMYFMLSILNYAFYVKLLLTFQGLQPLLATVLSAVSSM 109
           F F       +R      +R+ +     SIL +   +  L+    + PL A   + +  +
Sbjct: 122 FTFRHVAGGRQRSWLQRGLRFHLTCISGSILTFLIQM-SLIYLVHVWPLFAQASALIIVL 180

Query: 110 LFVFLLYIRFMTRRVY 125
            + F ++  F  R V 
Sbjct: 181 FYNFTIHHLFTYRHVK 196


>gi|145221771|ref|YP_001132449.1| GtrA family protein [Mycobacterium gilvum PYR-GCK]
 gi|315446493|ref|YP_004079372.1| hypothetical protein Mspyr1_50080 [Mycobacterium sp. Spyr1]
 gi|145214257|gb|ABP43661.1| GtrA family protein [Mycobacterium gilvum PYR-GCK]
 gi|315264796|gb|ADU01538.1| predicted membrane protein [Mycobacterium sp. Spyr1]
          Length = 133

 Score = 61.8 bits (149), Expect = 3e-08,   Method: Composition-based stats.
 Identities = 17/122 (13%), Positives = 44/122 (36%), Gaps = 4/122 (3%)

Query: 3   QCIIFIINIVVVFFIDVMGFFILMKCGADPFYSRIFSIAVAFLVTWIPSRLFIFLKLRRK 62
           Q   F+I   +   +D   +  L+  G     ++  S        ++ +R + F     K
Sbjct: 10  QIWRFLITGGLSAIVDFGLYVALLAAGLHVNIAKTISFIAGTTTAYLINRRWTFQAPPSK 69

Query: 63  SFLETVRYGVMYFMLSILNYAFYVKLLLTFQG--LQPLLATVLSAVSSMLFVFLLYIRFM 120
           +    +   V+Y +   +         + F     +  +A V++  ++ +  F++    +
Sbjct: 70  A--RFIAVCVLYGLTYAVQVGINYVFYMEFDDKPWRVPVAFVIAQGTATVINFIVQRAVI 127

Query: 121 TR 122
            R
Sbjct: 128 FR 129


>gi|260460578|ref|ZP_05808829.1| GtrA family protein [Mesorhizobium opportunistum WSM2075]
 gi|259033683|gb|EEW34943.1| GtrA family protein [Mesorhizobium opportunistum WSM2075]
          Length = 136

 Score = 61.8 bits (149), Expect = 3e-08,   Method: Composition-based stats.
 Identities = 23/117 (19%), Positives = 53/117 (45%), Gaps = 3/117 (2%)

Query: 3   QCIIFIINIVVVFFIDVMGFFILMKCGADPFYSRIFSIAVAFLVTWIPSRLFIF-LKLRR 61
           + + F I  +V   ID+ GFF+L+K    P  + I S ++A + +++ +  + F      
Sbjct: 14  KIVRFAIVGLVNTAIDLAGFFLLLKLHVPPLPANIVSWSIAVVFSFVANGFWSFERNRAI 73

Query: 62  KSFLETVRYGVMYFMLSILNYAFYVKLLLTFQGLQPLLATVLSAVSSMLFVFLLYIR 118
           +     +R+  +  ++S+   +  + LL    G+ P  A +   + + +  F+    
Sbjct: 74  RLHDAFLRFVSLGALISLGVSSLSIALLAGIAGVWP--AKIGGVIVAAVLNFIAARW 128


>gi|269986862|gb|EEZ93139.1| glycosyl transferase family 2 [Candidatus Parvarchaeum acidiphilum
           ARMAN-4]
          Length = 334

 Score = 61.8 bits (149), Expect = 3e-08,   Method: Composition-based stats.
 Identities = 15/119 (12%), Positives = 41/119 (34%), Gaps = 5/119 (4%)

Query: 3   QCIIFIINIVVVFFIDVMGFFILMKCGADPFYSRIFSIAVAFLVTWIPSRLFIFLKLRRK 62
           + + F     +   ++    F+        +   + S     +  ++ +  F F   R K
Sbjct: 215 RVLKFAFVGFIGLLVNEFIAFLF-HPYIPIYIDFLISAEFGVISNFLLNHFFTFR-RRTK 272

Query: 63  SFLETVRYGVMYFMLSILNYAFYVKLLLTFQGLQPLLATVLSAVSSMLFVFLLYIRFMT 121
           +     RY  +  +   ++        L    ++ L+A  +  + +  F ++L  +F  
Sbjct: 273 AITAFPRYNFVALIGISIDVVI---ATLLSFRIEYLIANFIGIIVAFAFNYVLSEKFAW 328



 Score = 33.7 bits (76), Expect = 7.9,   Method: Composition-based stats.
 Identities = 11/59 (18%), Positives = 23/59 (38%), Gaps = 1/59 (1%)

Query: 4   CIIFIINIVVVFFIDVMGFFILMKCGADPFYSRIFSIAVAFLVTWIPSRLFIFLKLRRK 62
              +    ++   IDV+   +L     +   +    I VAF   ++ S  F ++   +K
Sbjct: 277 FPRYNFVALIGISIDVVIATLLS-FRIEYLIANFIGIIVAFAFNYVLSEKFAWVVHEKK 334


>gi|148259095|ref|YP_001233222.1| GtrA family protein [Acidiphilium cryptum JF-5]
 gi|326402246|ref|YP_004282327.1| putative GtrA family protein [Acidiphilium multivorum AIU301]
 gi|146400776|gb|ABQ29303.1| GtrA family protein [Acidiphilium cryptum JF-5]
 gi|325049107|dbj|BAJ79445.1| putative GtrA family protein [Acidiphilium multivorum AIU301]
          Length = 146

 Score = 61.8 bits (149), Expect = 3e-08,   Method: Composition-based stats.
 Identities = 25/122 (20%), Positives = 52/122 (42%), Gaps = 4/122 (3%)

Query: 3   QCIIFIINIVVVFFIDVMGFFILMKCGADPFYSRIFSIAVAFLVTWIPSRLFIFLKL-RR 61
           + + F +  V    +D+   + L+      + + + +  +A    W+  RL+ F    +R
Sbjct: 25  ELLRFGLVGVFGLLVDIAAVYALIP-SLGLYGAGMAAYLIAASCNWVLHRLWTFRARAQR 83

Query: 62  KSFLETVRYGVMYFMLSILNYAFYVKLLLTF--QGLQPLLATVLSAVSSMLFVFLLYIRF 119
            +  + +R+ ++     ++N   Y  L+ +F      P+LA    A S  L  FLL  R 
Sbjct: 84  PAHTQWLRFLMVNLAGFMVNRGAYSALIASFVLPRHYPVLAVAAGAASGFLINFLLSRRL 143

Query: 120 MT 121
           + 
Sbjct: 144 VF 145


>gi|307293913|ref|ZP_07573757.1| GtrA family protein [Sphingobium chlorophenolicum L-1]
 gi|306880064|gb|EFN11281.1| GtrA family protein [Sphingobium chlorophenolicum L-1]
          Length = 158

 Score = 61.8 bits (149), Expect = 3e-08,   Method: Composition-based stats.
 Identities = 17/129 (13%), Positives = 47/129 (36%), Gaps = 7/129 (5%)

Query: 2   KQCIIFIINIVVVFFIDVMGFFILMKCGADPFYSRIFSIAVAFLVTWIPSRLFIFLKLRR 61
           +Q +IF I   +   +++   ++L         +   +  +     +I +R F+F     
Sbjct: 24  RQLVIFTITGGIAATVNIAVRWMLSWFLFYEL-AVSIAYFLGMTTAFILARAFVFGASDG 82

Query: 62  KSFLETVRYGVMYFMLSILNYAF------YVKLLLTFQGLQPLLATVLSAVSSMLFVFLL 115
           +   E  R+ ++     ++           +   +     +  +A ++  VS +L  F  
Sbjct: 83  RWINEFGRFALVNLASFLMVMGVSVGLARLLFPAIGLHWHREDIAHIIGVVSPILLSFYA 142

Query: 116 YIRFMTRRV 124
           +  F  ++ 
Sbjct: 143 HKYFSFKKP 151


>gi|306821305|ref|ZP_07454915.1| GtrA family protein [Eubacterium yurii subsp. margaretiae ATCC
           43715]
 gi|304550646|gb|EFM38627.1| GtrA family protein [Eubacterium yurii subsp. margaretiae ATCC
           43715]
          Length = 352

 Score = 61.8 bits (149), Expect = 3e-08,   Method: Composition-based stats.
 Identities = 20/134 (14%), Positives = 53/134 (39%), Gaps = 8/134 (5%)

Query: 2   KQCIIFIINIVVVFFIDVMGFFILMKCG------ADPFYSRIFSIAVAFLVTWIPSRLFI 55
           K+ + F  + ++ F +D   + I +              S I +  ++ +V +  +R ++
Sbjct: 218 KEILKFSASSLICFCLDFSLYLIFLSTTGGLGTLNSVRLSNISARIISAVVNFTLNRKYV 277

Query: 56  FLKLRRKSFLETVRYGVMYFMLSILNYAFYVKLLLTFQGLQPLLATVLSAVSSMLFVFLL 115
           F       F   ++Y ++   +  +N A     L+ +  +   LA +++ +S       +
Sbjct: 278 FK-SNSDVFQAGIKYILLCMFILTINTAML-GFLVEYVNIDKSLAKIITELSLFSLSMAI 335

Query: 116 YIRFMTRRVYFIKK 129
               + ++    KK
Sbjct: 336 QKMMIFKKNPITKK 349


>gi|257791000|ref|YP_003181606.1| GtrA family protein [Eggerthella lenta DSM 2243]
 gi|257474897|gb|ACV55217.1| GtrA family protein [Eggerthella lenta DSM 2243]
          Length = 139

 Score = 61.8 bits (149), Expect = 3e-08,   Method: Composition-based stats.
 Identities = 21/121 (17%), Positives = 45/121 (37%), Gaps = 3/121 (2%)

Query: 1   MKQCIIFIINIVVVFFIDVMGFFILMK-CGADPFYSRIFSIAVAFLVTWIPSRLFIFLKL 59
           + Q + F +  V+ F ID     +L +  G +   S   S   + +  +  S  ++F   
Sbjct: 5   VAQIMKFGVVGVIAFVIDYGLLALLTEAFGVNYLVSATISFTASVVFNYAASMRYVFTHK 64

Query: 60  -RRKSFLETVRYGVMYFMLSILNYAFYVKLLLTFQGLQPLLATVLSAVSSMLFVFLLYIR 118
                  E   + V+  +   +N        + F G+  L+  + +    M++ F+    
Sbjct: 65  EGMSRRREFAIFVVLSVIGLGINNGCMWAG-VEFLGIHYLIVKIGATFIVMVWNFVTRKI 123

Query: 119 F 119
           F
Sbjct: 124 F 124


>gi|300857031|ref|YP_003782015.1| GtrA-like protein [Clostridium ljungdahlii DSM 13528]
 gi|300437146|gb|ADK16913.1| GtrA-like protein [Clostridium ljungdahlii DSM 13528]
          Length = 129

 Score = 61.8 bits (149), Expect = 3e-08,   Method: Composition-based stats.
 Identities = 20/126 (15%), Positives = 53/126 (42%), Gaps = 2/126 (1%)

Query: 1   MKQCIIFIINIVVVFFIDVMGFFILMK-CGADPFYSRIFSIAVAFLVTWIPSRLFIFLKL 59
           M + I F I  V    I ++ F++  K    +   S + S ++  L ++I ++ + F   
Sbjct: 1   MIKLIKFCIVGVANTTITLLSFYLFNKILLINYLLSTVVSYSIGMLNSYILNKEWTFCDK 60

Query: 60  RRKSFLETVRYGVMYFMLSILNYAFYVKLLLTFQGLQPLLATVLSAVSSMLFVFLLYIRF 119
            ++  L+ + + ++  +   LN       L++   +   L+ V +   S++  ++     
Sbjct: 61  DKRIVLQLIEFTMVNGVSLSLNLIIMHL-LVSKLYVDTFLSQVFATGFSIISNYIGSKFI 119

Query: 120 MTRRVY 125
           +   + 
Sbjct: 120 VFHSIN 125


>gi|21224686|ref|NP_630465.1| sugar transferase [Streptomyces coelicolor A3(2)]
 gi|3395543|emb|CAA20162.1| putative sugar transferase [Streptomyces coelicolor A3(2)]
          Length = 478

 Score = 61.8 bits (149), Expect = 3e-08,   Method: Composition-based stats.
 Identities = 16/117 (13%), Positives = 42/117 (35%), Gaps = 4/117 (3%)

Query: 2   KQCIIFIINIVVVFFIDVMGFFILMKCGADPFYSRIFSIAVAFLVTWIPSRLFIFLKLRR 61
           +Q + F+    V   + +  F  L         +      V+ L +++ +         R
Sbjct: 333 RQFVTFVAIGFVNTAVYLGLFAALNNW-IPYLVAHALGYTVSVLCSFLLNSYIT--CRTR 389

Query: 62  KSFLETVRYGVMYFMLSILNYAFYVKLLLTFQGLQPLLATVLSAVSSMLFVFLLYIR 118
            ++   +RY +      +++ A      ++  G+   +A +++ V      F+L   
Sbjct: 390 PTWRALIRYPLSSIFNLVVSGALLYVA-VSQLGMDKNVAALVAGVVVTPVSFVLARW 445


>gi|218678055|ref|ZP_03525952.1| putative transmembrane protein [Rhizobium etli CIAT 894]
          Length = 125

 Score = 61.8 bits (149), Expect = 3e-08,   Method: Composition-based stats.
 Identities = 44/123 (35%), Positives = 68/123 (55%), Gaps = 1/123 (0%)

Query: 1   MKQCIIFIINIVVVFFIDVMGFFILMKCGA-DPFYSRIFSIAVAFLVTWIPSRLFIFLKL 59
           M++ I F I   + F +D     IL++     PF +R+ +IA+A   TW  +R F F + 
Sbjct: 1   MRKLIRFAIAGGIGFLVDAGILSILLELTPLGPFLARLIAIALAMAATWAFNRSFTFDRS 60

Query: 60  RRKSFLETVRYGVMYFMLSILNYAFYVKLLLTFQGLQPLLATVLSAVSSMLFVFLLYIRF 119
            R    E  RYG +    +++NY  Y  LLL+   LQPL A V+++++SM+F F  Y RF
Sbjct: 61  GRSLAAEGFRYGSVGVTAALVNYGLYSALLLSLPALQPLAAMVIASIASMVFSFFGYSRF 120

Query: 120 MTR 122
           + R
Sbjct: 121 VFR 123


>gi|163791383|ref|ZP_02185794.1| Dolichol-phosphate mannosyltransferase [Carnobacterium sp. AT7]
 gi|159873353|gb|EDP67446.1| Dolichol-phosphate mannosyltransferase [Carnobacterium sp. AT7]
          Length = 350

 Score = 61.8 bits (149), Expect = 3e-08,   Method: Composition-based stats.
 Identities = 17/126 (13%), Positives = 49/126 (38%), Gaps = 8/126 (6%)

Query: 4   CIIFIINIVVVFFIDVMGFFILMKC-----GADPFYSRIFSIAVAFLVTWIPSRLFIFLK 58
            I ++ + V  FFID+  F +++             +   + +++ L  ++ +   +F  
Sbjct: 226 FIKYLFSSVFSFFIDISIFSLIIYFIGESNFQAITIASYIARSISSLFNYLVNNYIVFK- 284

Query: 59  LRRKSFLETVRYGVMYFMLSILNYAFYVKLLLTFQGLQPLLATVLSAVSSMLFVFLLYIR 118
               S    ++Y  +  + + ++  F   +        P L  V+  +   +  F +  +
Sbjct: 285 --NGSSNSFIKYYGLVIIQTFISSLFVSLVHNVLMDFNPTLVKVVIDLLLFVISFYVQKK 342

Query: 119 FMTRRV 124
           ++  +V
Sbjct: 343 WVFHKV 348


>gi|317488285|ref|ZP_07946851.1| GtrA-like protein [Eggerthella sp. 1_3_56FAA]
 gi|325830885|ref|ZP_08164269.1| GtrA-like protein [Eggerthella sp. HGA1]
 gi|316912625|gb|EFV34168.1| GtrA-like protein [Eggerthella sp. 1_3_56FAA]
 gi|325487292|gb|EGC89735.1| GtrA-like protein [Eggerthella sp. HGA1]
          Length = 139

 Score = 61.8 bits (149), Expect = 3e-08,   Method: Composition-based stats.
 Identities = 22/121 (18%), Positives = 45/121 (37%), Gaps = 3/121 (2%)

Query: 1   MKQCIIFIINIVVVFFIDVMGFFILMK-CGADPFYSRIFSIAVAFLVTWIPSRLFIFLKL 59
           + Q + F +  V+ F ID     +L +  G +   S   S   + +  +  S  ++F   
Sbjct: 5   VAQIMKFGVVGVIAFVIDYGLLALLTEAFGVNYLVSATISFTASVVFNYAASMRYVFTHK 64

Query: 60  -RRKSFLETVRYGVMYFMLSILNYAFYVKLLLTFQGLQPLLATVLSAVSSMLFVFLLYIR 118
                  E   + V+  +   LN        + F G+  L+  + +    M++ F+    
Sbjct: 65  EGMSRRREFAIFVVLSVIGLGLNNGCMWAG-VEFLGIHYLIVKIGATFIVMVWNFVTRKI 123

Query: 119 F 119
           F
Sbjct: 124 F 124


>gi|229099861|ref|ZP_04230785.1| GtrA [Bacillus cereus Rock3-29]
 gi|229118923|ref|ZP_04248270.1| GtrA [Bacillus cereus Rock1-3]
 gi|228664579|gb|EEL20074.1| GtrA [Bacillus cereus Rock1-3]
 gi|228683607|gb|EEL37561.1| GtrA [Bacillus cereus Rock3-29]
          Length = 128

 Score = 61.8 bits (149), Expect = 3e-08,   Method: Composition-based stats.
 Identities = 17/121 (14%), Positives = 48/121 (39%), Gaps = 2/121 (1%)

Query: 1   MKQCIIFIINIVVVFFIDVMGFFILMKCGADPFYSRIFSIAVAFLVTWIPSRLFIFLKLR 60
           M++ + F +  +    I ++ F IL+K G +   +   +  +    ++  ++ ++F    
Sbjct: 2   MEKLLKFGLVGIFNTLITIISFGILVKLGMNYLVANTIAYLIGVANSYYWNKNWVFK-PN 60

Query: 61  RKSFLETVRYGVMYFMLSILNYAFYVKLLLTFQGLQPLLATVLSAVSSMLFVFLLYIRFM 120
            KS     ++  +  ++   N      +L+        +A + +    M+  F+L   + 
Sbjct: 61  NKSMSMFFKFLTVNLIVLAFNTLCL-FILVDKLTFNAFIAQIFAIGVGMVINFILNKIWT 119

Query: 121 T 121
            
Sbjct: 120 F 120


>gi|326792848|ref|YP_004310669.1| GtrA family protein [Clostridium lentocellum DSM 5427]
 gi|326543612|gb|ADZ85471.1| GtrA family protein [Clostridium lentocellum DSM 5427]
          Length = 134

 Score = 61.5 bits (148), Expect = 3e-08,   Method: Composition-based stats.
 Identities = 17/120 (14%), Positives = 49/120 (40%), Gaps = 1/120 (0%)

Query: 3   QCIIFIINIVVVFFIDVMGFFILMKCGADPFYSRIFSIAVAFLVTWIPSRLFIFLKLRRK 62
           Q + F I  +    I +  ++IL+  G +   +      +  +  +  +  ++F K +  
Sbjct: 16  QFVKFGIVGLSNTLISLAAYYILIYIGVNYIMANAIGFVLGTINAYYWNNKYVFKKTQEG 75

Query: 63  SFLETVRYGVMYFMLSILNYAFYVKLLLTFQGLQPLLATVLSAVSSMLFVFLLYIRFMTR 122
           +    ++    Y M  +L     + LL+   G+   +A +++ + ++   F +   +  +
Sbjct: 76  NIKPFLKSFTGYGMTFLLG-TICLVLLVQVLGVSEFIAPIINMLITIPINFFINKFWAFK 134


>gi|328955323|ref|YP_004372656.1| GtrA family protein [Coriobacterium glomerans PW2]
 gi|328455647|gb|AEB06841.1| GtrA family protein [Coriobacterium glomerans PW2]
          Length = 139

 Score = 61.5 bits (148), Expect = 3e-08,   Method: Composition-based stats.
 Identities = 21/119 (17%), Positives = 41/119 (34%), Gaps = 3/119 (2%)

Query: 3   QCIIFIINIVVVFFIDVMGFFILMKC-GADPFYSRIFSIAVAFLVTWIPSRLFIFLKL-R 60
           Q + F +  V+ F ID      L +  G  P  S   S  V+ +  ++ S  ++F     
Sbjct: 7   QIMKFGVVGVIAFGIDYAILVFLTEVYGIPPVLSATISFTVSVIFNYLASMRYVFRHRPG 66

Query: 61  RKSFLETVRYGVMYFMLSILNYAFYVKLLLTFQGLQPLLATVLSAVSSMLFVFLLYIRF 119
                E V + V+  +   +N A           +   +  + +    M++ F      
Sbjct: 67  MSRRREFVIFVVLSALGLGINDAMMWAGTA-LALIDYRIVKIAATAVVMVWNFATRKIL 124


>gi|297568366|ref|YP_003689710.1| GtrA family protein [Desulfurivibrio alkaliphilus AHT2]
 gi|296924281|gb|ADH85091.1| GtrA family protein [Desulfurivibrio alkaliphilus AHT2]
          Length = 141

 Score = 61.5 bits (148), Expect = 3e-08,   Method: Composition-based stats.
 Identities = 13/124 (10%), Positives = 41/124 (33%), Gaps = 5/124 (4%)

Query: 1   MKQCIIFIINIVVVFFIDVMGFFILMK-CGADPFYSRIFSIAVAFLVTWIPSRLFIFLKL 59
           + Q ++F    ++   +      +L++     P  + +       L  +  +    F   
Sbjct: 17  ISQFVLFSSVGIIGTSVHFFILIVLVQLLAVSPVTASMAGFTGGALTNYFLNYHVTFRCR 76

Query: 60  RRKSFLETVRYGVMYFMLSILNYAFYVKLLLTFQGLQPLLATVLSAVSSMLFVFLLYIRF 119
                    ++  +  +   LN       ++    +  L++ VL+    +++ F     +
Sbjct: 77  -NPHLEALPKFLSVSLVGLCLNTLIMALAVIW---MHYLISQVLATACVLVWNFFCNRHW 132

Query: 120 MTRR 123
             R+
Sbjct: 133 TFRK 136


>gi|258544020|ref|ZP_05704254.1| conserved hypothetical protein [Cardiobacterium hominis ATCC 15826]
 gi|258520734|gb|EEV89593.1| conserved hypothetical protein [Cardiobacterium hominis ATCC 15826]
          Length = 154

 Score = 61.5 bits (148), Expect = 3e-08,   Method: Composition-based stats.
 Identities = 17/121 (14%), Positives = 36/121 (29%), Gaps = 1/121 (0%)

Query: 2   KQCIIFIINIVVVFFIDVMGFFILMK-CGADPFYSRIFSIAVAFLVTWIPSRLFIFLKLR 60
           KQ   F++       +      + ++     P  + + + AVAF V++       F    
Sbjct: 8   KQGGYFLLVGATAAAVHFAVLALAVEGAHVPPLSANLIAFAVAFCVSFAGHYRLTFRHSG 67

Query: 61  RKSFLETVRYGVMYFMLSILNYAFYVKLLLTFQGLQPLLATVLSAVSSMLFVFLLYIRFM 120
                  +R+  +       N A +   L        L       ++   F F+    + 
Sbjct: 68  AHWRDSVLRWLAVSLTGFAANQALFALGLAWLGAAYYLPLWFAVTLAVTAFSFIAGKYWA 127

Query: 121 T 121
            
Sbjct: 128 F 128


>gi|167039972|ref|YP_001662957.1| GtrA family protein [Thermoanaerobacter sp. X514]
 gi|300914062|ref|ZP_07131378.1| GtrA family protein [Thermoanaerobacter sp. X561]
 gi|307724705|ref|YP_003904456.1| GtrA family protein [Thermoanaerobacter sp. X513]
 gi|166854212|gb|ABY92621.1| GtrA family protein [Thermoanaerobacter sp. X514]
 gi|300888997|gb|EFK84143.1| GtrA family protein [Thermoanaerobacter sp. X561]
 gi|307581766|gb|ADN55165.1| GtrA family protein [Thermoanaerobacter sp. X513]
          Length = 139

 Score = 61.5 bits (148), Expect = 3e-08,   Method: Composition-based stats.
 Identities = 21/124 (16%), Positives = 50/124 (40%), Gaps = 4/124 (3%)

Query: 1   MKQCIIFIINIVVVFFIDVMGFFILMKC-GADPFYSRIFSIAVAFLVTWIPSRLFIF--L 57
           +K    F    +    ID   F +  K  G +  +S+    +   + +++ +R + F   
Sbjct: 16  LKHISRFGTVGITNTLIDFFVFTVFYKIIGVNYVFSQAIGYSCGVINSFVLNRKWTFEVK 75

Query: 58  KLRRKSFLETVRYGVMYFMLSILNYAFYVKLLLTFQGLQPLLATVLSAVSSMLFVFLLYI 117
               K F E V++ V   +  ++     +  L+    L   ++ ++  + + +  FLLY 
Sbjct: 76  NANSKIFWEFVKFLVSNLISLVITM-LTIDYLVKNLQLNVYISKIIVTLIAQVINFLLYK 134

Query: 118 RFMT 121
            ++ 
Sbjct: 135 LWVF 138


>gi|49479001|ref|YP_039421.1| GtrA family membrane protein [Bacillus thuringiensis serovar
           konkukian str. 97-27]
 gi|49330557|gb|AAT61203.1| membrane protein, GtrA family [Bacillus thuringiensis serovar
           konkukian str. 97-27]
          Length = 127

 Score = 61.5 bits (148), Expect = 3e-08,   Method: Composition-based stats.
 Identities = 17/121 (14%), Positives = 52/121 (42%), Gaps = 2/121 (1%)

Query: 1   MKQCIIFIINIVVVFFIDVMGFFILMKCGADPFYSRIFSIAVAFLVTWIPSRLFIFLKLR 60
           M++ + F +  +    I ++ F+IL+K G +   +   +  +    ++  ++ ++F    
Sbjct: 1   MEKLLKFGLVGIFNTLITIISFWILLKFGMNYLIANTIAYLLGVANSYYWNKNWVFKSNN 60

Query: 61  RKSFLETVRYGVMYFMLSILNYAFYVKLLLTFQGLQPLLATVLSAVSSMLFVFLLYIRFM 120
           + + +   ++  +  ++   N      +L+    L  L+A + +    M+  F+L   + 
Sbjct: 61  KSTSM-FFKFLTVNLIVYAFNTLCL-FILVGKIALNALIAQIFAIGVGMVINFVLNKIWT 118

Query: 121 T 121
            
Sbjct: 119 F 119


>gi|269796540|ref|YP_003315995.1| glycosyl transferase [Sanguibacter keddieii DSM 10542]
 gi|269098725|gb|ACZ23161.1| glycosyl transferase [Sanguibacter keddieii DSM 10542]
          Length = 377

 Score = 61.5 bits (148), Expect = 3e-08,   Method: Composition-based stats.
 Identities = 25/127 (19%), Positives = 53/127 (41%), Gaps = 3/127 (2%)

Query: 4   CIIFIINIVVVFFIDVMGFFILMKCGADPFYSRIFSIAVAFLVTWIPSRLFIFL-KLRRK 62
            + F +  +  F +D +   +L         S + + A++  V +  +R  +F     + 
Sbjct: 219 LLRFCLASLAAFVVDTVALLVLHAVTGSLLGSVVGARALSSAVNFTTNRRLVFTSGRDKP 278

Query: 63  SFLETVRYGVMYFMLSILNYAFYVKLLLTFQGLQPLLATVLSAVSSMLFVFLLYIRFMTR 122
                V+Y  +  +L   NYA  +   LT  G+  L A VL+ ++  +  + L  R +  
Sbjct: 279 VAAAAVQYYAVVALLLAGNYALLLA--LTSAGVALLPAKVLTELTLFVLGYELQRRVVFA 336

Query: 123 RVYFIKK 129
           R   +++
Sbjct: 337 RPERLRR 343


>gi|220905434|ref|YP_002480746.1| GtrA family protein [Desulfovibrio desulfuricans subsp.
           desulfuricans str. ATCC 27774]
 gi|219869733|gb|ACL50068.1| GtrA family protein [Desulfovibrio desulfuricans subsp.
           desulfuricans str. ATCC 27774]
          Length = 173

 Score = 61.5 bits (148), Expect = 3e-08,   Method: Composition-based stats.
 Identities = 20/127 (15%), Positives = 43/127 (33%), Gaps = 7/127 (5%)

Query: 2   KQCIIFIINIVVVFFIDVMG-FFILMKCGADPFYSRIFSIAVAFLVTWIPSRLFIFL--- 57
           ++ + F +          +   F +   G         + A++F V+++   L+ F    
Sbjct: 23  RRWVRFGMVGGAATLTYALLGLFFVSIPGIPVLAGNALAYALSFAVSYLGQCLWTFRAGG 82

Query: 58  -KLRRKSFLETVRYGVMYFMLSILNYAFYVKLLLTFQGLQPLLATVLSAVSSMLFVFLLY 116
                       R+     +   LN A     +L   GL   LA   + +   + V+ L 
Sbjct: 83  TGRGLSHRGMLPRFAATQTLGLGLNSAI--IWVLMRLGLGYELAMPAAVLLVPVLVYFLC 140

Query: 117 IRFMTRR 123
             ++ R+
Sbjct: 141 KYWVFRQ 147


>gi|241761043|ref|ZP_04759132.1| GtrA family protein [Zymomonas mobilis subsp. mobilis ATCC 10988]
 gi|241374662|gb|EER64123.1| GtrA family protein [Zymomonas mobilis subsp. mobilis ATCC 10988]
          Length = 148

 Score = 61.5 bits (148), Expect = 4e-08,   Method: Composition-based stats.
 Identities = 24/125 (19%), Positives = 49/125 (39%), Gaps = 4/125 (3%)

Query: 1   MKQCIIFIINIVVVFFIDVMGFFILMKCGAD-PFYSRIFSIAVAFLVTWIPSRLFIFLKL 59
           + Q I F +      F++   +++  K G   P +S      VA +V ++    F F   
Sbjct: 21  LGQVIRFGLTGGFTTFLNAAIYYVGAKWGHMAPLFSNFIGYLVAMIVGYLLHNYFSFRGH 80

Query: 60  R--RKSFLETVRYGVMYFMLSILNYAFYVKLLLTFQGLQPLLATVLSAVSSMLFVFLLYI 117
               + +   +R+ +   +   LN +F+V  ++ +  L            + L  F L  
Sbjct: 81  GCQDRHWQLFLRFCLASLLGLGLN-SFWVGCMVNYLHLMKWTPLPFMVFVTPLVSFWLNR 139

Query: 118 RFMTR 122
           R++ R
Sbjct: 140 RWVFR 144


>gi|323357545|ref|YP_004223941.1| glycosyltransferase [Microbacterium testaceum StLB037]
 gi|323273916|dbj|BAJ74061.1| glycosyltransferase [Microbacterium testaceum StLB037]
          Length = 376

 Score = 61.5 bits (148), Expect = 4e-08,   Method: Composition-based stats.
 Identities = 13/122 (10%), Positives = 45/122 (36%), Gaps = 4/122 (3%)

Query: 3   QCIIFIINIVVVFFIDVMGFFILMKCGADPFYSRIFSIAVAFLVTWIPSRLFIFLKLRRK 62
           +   F +   +    ++   + L   G     + + +  +  +  +I     +F  +R++
Sbjct: 232 RMSAFAVVGGLGAVANLAIMWGLQTLGVQYLVAAVIASVLTIIANFIALEYLVFADMRQE 291

Query: 63  S---FLETVRYGVMYFMLSILNYAFYVKLLLTFQGLQPLLATVLSAVSSMLFVFLLYIRF 119
           S       ++      + +I+        L+    +Q +LA  ++ + + +  F+ +   
Sbjct: 292 SGLMRHRFIKSFTFNGIEAIVRIPVIWL-LVNEAHIQSVLAAAITLLVAFVVRFVFHALV 350

Query: 120 MT 121
           + 
Sbjct: 351 VY 352


>gi|13472705|ref|NP_104272.1| hypothetical protein mll3086 [Mesorhizobium loti MAFF303099]
 gi|14023452|dbj|BAB50058.1| mll3086 [Mesorhizobium loti MAFF303099]
          Length = 136

 Score = 61.5 bits (148), Expect = 4e-08,   Method: Composition-based stats.
 Identities = 22/117 (18%), Positives = 53/117 (45%), Gaps = 3/117 (2%)

Query: 3   QCIIFIINIVVVFFIDVMGFFILMKCGADPFYSRIFSIAVAFLVTWIPSRLFIFLKLRR- 61
           + I F I  +    ID+ GFF+L+K    P  + + S ++A + +++ +  + F + +  
Sbjct: 14  KIIRFAIVGLANTAIDLAGFFLLLKLHVPPLPANVISWSIAVIFSFVANGFWSFERNQAI 73

Query: 62  KSFLETVRYGVMYFMLSILNYAFYVKLLLTFQGLQPLLATVLSAVSSMLFVFLLYIR 118
           +     +R+  +  ++S+   +  + L     G+ P  A +   + + +  FL    
Sbjct: 74  RLHDAFLRFVSLGALISLGVSSLSIALFAGIAGVWP--AKIGGVIVAAVLNFLAARW 128


>gi|228988661|ref|ZP_04148747.1| GtrA [Bacillus thuringiensis serovar tochigiensis BGSC 4Y1]
 gi|228771112|gb|EEM19592.1| GtrA [Bacillus thuringiensis serovar tochigiensis BGSC 4Y1]
          Length = 127

 Score = 61.5 bits (148), Expect = 4e-08,   Method: Composition-based stats.
 Identities = 17/121 (14%), Positives = 51/121 (42%), Gaps = 2/121 (1%)

Query: 1   MKQCIIFIINIVVVFFIDVMGFFILMKCGADPFYSRIFSIAVAFLVTWIPSRLFIFLKLR 60
           M++ + F +  +    I ++ F+IL+K G +   +   +  +    ++  ++ ++F    
Sbjct: 1   MEKLLKFGLVGIFNTLITIISFWILLKFGMNYLIANTIAYLIGVANSYYWNKNWVFKPNN 60

Query: 61  RKSFLETVRYGVMYFMLSILNYAFYVKLLLTFQGLQPLLATVLSAVSSMLFVFLLYIRFM 120
           + S +   ++  +  ++   N      +L+       L+A + +    M+  F+L   + 
Sbjct: 61  KSSSM-FFKFLTVNLIVLAFNTLCL-FILVNKFTFNALIAQIFAIGVGMVINFVLNKIWT 118

Query: 121 T 121
            
Sbjct: 119 F 119


>gi|297154432|gb|ADI04144.1| putative sugar translocase [Streptomyces bingchenggensis BCW-1]
          Length = 247

 Score = 61.5 bits (148), Expect = 4e-08,   Method: Composition-based stats.
 Identities = 12/119 (10%), Positives = 45/119 (37%), Gaps = 4/119 (3%)

Query: 1   MKQCIIFIINIVVVFFIDVMGFFILMKCGADPFYSRIFSIAVAFLVTWIPSRLFIFLKLR 60
           + Q + F +  VV        + + ++       + + + A++ + +++ +  F +    
Sbjct: 2   LGQVVRFGLVGVVNTATYYGMYLLFLRW-LPYLVAHVAAFALSTVGSFLLNCWFTY--RT 58

Query: 61  RKSFLETVRYGVMYFMLSILNYAFYVKLLLTFQGLQPLLATVLSAVSSMLFVFLLYIRF 119
           R ++ + + + +      ++        L+         A +++A  ++   F+L    
Sbjct: 59  RPTWRKFLLFPLTTAANFVITTGGVYV-LVDLLHTGDRAAPLMAAAVAVPITFVLSRTI 116


>gi|307330551|ref|ZP_07609692.1| GtrA family protein [Streptomyces violaceusniger Tu 4113]
 gi|306883800|gb|EFN14845.1| GtrA family protein [Streptomyces violaceusniger Tu 4113]
          Length = 175

 Score = 61.5 bits (148), Expect = 4e-08,   Method: Composition-based stats.
 Identities = 16/110 (14%), Positives = 34/110 (30%), Gaps = 5/110 (4%)

Query: 18  DVMGFFILMKCGADPFY-SRIFSIAVAFLVTWIPSRLFIFLKLRR-KSFLETVRYGVMYF 75
           ++  F ++      P   + + +  VA    ++  R F +    +     E   + +   
Sbjct: 35  NLAVFNLVRSATELPVVRASVVATVVATGFNYVGYRYFTYRDRDKQGRTKELSLFLLFSA 94

Query: 76  MLSILNYAFYVKLLLTFQGLQPLLA---TVLSAVSSMLFVFLLYIRFMTR 122
           +  I+           F     L +     L      LF F  Y  ++ R
Sbjct: 95  IGLIIENGVLYAATYGFGWDSSLQSNVFKFLGIGLGTLFRFWSYRTWVFR 144


>gi|257065009|ref|YP_003144681.1| predicted membrane protein [Slackia heliotrinireducens DSM 20476]
 gi|256792662|gb|ACV23332.1| predicted membrane protein [Slackia heliotrinireducens DSM 20476]
          Length = 164

 Score = 61.5 bits (148), Expect = 4e-08,   Method: Composition-based stats.
 Identities = 21/122 (17%), Positives = 48/122 (39%), Gaps = 3/122 (2%)

Query: 1   MKQCIIFIINIVVVFFIDVMGFFILM-KCGADPFYSRIFSIAVAFLVTWIPSRLFIFLKL 59
           ++Q + F    V  F +D +   +L+ + G     +   S  ++ + ++  S  F++ + 
Sbjct: 5   IRQFLRFSAVGVSAFALDYVLLLVLVERLGMQYLLAATLSFTISIVYSYFLSMRFVYTRR 64

Query: 60  RR-KSFLETVRYGVMYFMLSILNYAFYVKLLLTFQGLQPLLATVLSAVSSMLFVFLLYIR 118
                  E + + V+ F+   LN A           +   +A V+  V    + F+    
Sbjct: 65  GDISRTEEVIAFFVVSFIGLALNDALLYL-FAGHIDIDYRIAKVIVGVIVSFWNFVSRKV 123

Query: 119 FM 120
           F+
Sbjct: 124 FV 125


>gi|330833513|ref|YP_004402338.1| family 2 glycosyl transferase [Streptococcus suis ST3]
 gi|329307736|gb|AEB82152.1| glycosyl transferase family 2 [Streptococcus suis ST3]
          Length = 388

 Score = 61.5 bits (148), Expect = 4e-08,   Method: Composition-based stats.
 Identities = 11/127 (8%), Positives = 34/127 (26%), Gaps = 8/127 (6%)

Query: 2   KQCIIFIINIVVVFFIDVMGFFILMKCGADP------FYSRIFSIAVAFLVTWIPSRLFI 55
           K    F +     F +D   + + +              +   +   +    +  ++  +
Sbjct: 216 KNLFKFALASFGGFLVDYGIYALALLLLTSLPTALRLLVANTIARICSATCNFALNKKLV 275

Query: 56  FLKLRRKSFLETVRYGVMYFMLSILNYAFYVKLLLTFQGLQPLLATVLSAVSSMLFVFLL 115
           F             Y  +  +L + + A          GL   +  +   +   L  + +
Sbjct: 276 F-NNEESIARTGAGYFTLALVLFLCDTALLYL-FHQILGLNLYIVKLAVDIFLFLASWFV 333

Query: 116 YIRFMTR 122
               + +
Sbjct: 334 QKNIIFK 340


>gi|294816367|ref|ZP_06775010.1| Dolichol-phosphate mannosyltransferase [Streptomyces clavuligerus
           ATCC 27064]
 gi|326444697|ref|ZP_08219431.1| dolichol-phosphate mannosyltransferase [Streptomyces clavuligerus
           ATCC 27064]
 gi|294328966|gb|EFG10609.1| Dolichol-phosphate mannosyltransferase [Streptomyces clavuligerus
           ATCC 27064]
          Length = 411

 Score = 61.5 bits (148), Expect = 4e-08,   Method: Composition-based stats.
 Identities = 18/123 (14%), Positives = 43/123 (34%), Gaps = 3/123 (2%)

Query: 1   MKQCIIFIINIVVVFFIDVMGFFILMKCGADPFYSRIFSIAVAFLVTWIPSRLFIFLKLR 60
           + + + F +  +  F  +++  + L   G     + I +        ++   + +F   R
Sbjct: 275 LARMVGFGLIGLTGFLPNLLALYALTSAGMHYLPAEIVANQFGVAWNFLLIEVLLFRGRR 334

Query: 61  --RKSFLETVRYGVMYFMLSILNYAFYVKLLLTFQGLQPLLATVLSAVSSMLFVFLLYIR 118
             R       R+ ++     IL        L+   G+  L AT L+ + + +  F     
Sbjct: 335 AHRHWADRVGRFALLANADLILRIPLIAL-LVGTAGMTVLPATALALLLTFVLRFTATEA 393

Query: 119 FMT 121
            + 
Sbjct: 394 LVY 396



 Score = 36.8 bits (84), Expect = 1.1,   Method: Composition-based stats.
 Identities = 12/64 (18%), Positives = 23/64 (35%), Gaps = 2/64 (3%)

Query: 59  LRRKSFLETVRYGVMYFMLSILNYAFYVKLLLTFQGLQPLLATVLSAVSSMLFVFLLYIR 118
                    V +G++     + N        LT  G+  L A +++    + + FLL   
Sbjct: 270 RTASPLARMVGFGLIGLTGFLPNLLALYA--LTSAGMHYLPAEIVANQFGVAWNFLLIEV 327

Query: 119 FMTR 122
            + R
Sbjct: 328 LLFR 331


>gi|186475630|ref|YP_001857100.1| GtrA family protein [Burkholderia phymatum STM815]
 gi|184192089|gb|ACC70054.1| GtrA family protein [Burkholderia phymatum STM815]
          Length = 129

 Score = 61.5 bits (148), Expect = 4e-08,   Method: Composition-based stats.
 Identities = 29/124 (23%), Positives = 52/124 (41%), Gaps = 3/124 (2%)

Query: 2   KQCIIFIINIVVVFFIDVMGFFILMKCGADPFYSRIFSIAVAFLVTWIPSRLFIFL-KLR 60
           ++ + F I  VV   +D    + ++  GA  F  R  S   A   TW  +R F F+    
Sbjct: 3   RELLRFAIAGVVGLLVDAGVLYGMLALGAGYFVGRAVSFIAAVWSTWQINRRFTFVEGSN 62

Query: 61  RKSFLETVRYGVMYFMLSILNYAFYVKLLLTFQ--GLQPLLATVLSAVSSMLFVFLLYIR 118
           + ++ E   Y         +NYA Y   +L      L PL+A  + +++ M   F+    
Sbjct: 63  KSAWAEWWHYLFAMLGGGAVNYAAYSATILLLPKSALLPLIAVAVGSLAGMTVNFVSAKL 122

Query: 119 FMTR 122
           ++ +
Sbjct: 123 WVFK 126


>gi|148555783|ref|YP_001263365.1| GtrA family protein [Sphingomonas wittichii RW1]
 gi|148500973|gb|ABQ69227.1| GtrA family protein [Sphingomonas wittichii RW1]
          Length = 160

 Score = 61.5 bits (148), Expect = 4e-08,   Method: Composition-based stats.
 Identities = 23/124 (18%), Positives = 50/124 (40%), Gaps = 4/124 (3%)

Query: 1   MKQCIIFIINIVVVFFIDVMGFFILMKC-GADPFYSRIFSIAVAFLVTWIPSRLFIFLKL 59
           + Q + + +  V    +++  + +L+K  G DP  +  F    A    ++    + F   
Sbjct: 37  LGQLVRYAVTGVFASLVNIGIYHLLVKLAGFDPNLAWTFGFVGAATTGYVVHGQWSFRGH 96

Query: 60  --RRKSFLETVRYGVMYFMLSILNYAFYVKLLLTFQGLQPLLATVLSAVSSMLFVFLLYI 117
             R +  +   R+ ++  +   LN + +V LL+    L       L    + L VF L  
Sbjct: 97  GGRDRQGVRIARFAIVSLISFALN-SLWVWLLVQHMDLPIWSPYPLVLGVTPLLVFWLNR 155

Query: 118 RFMT 121
           +++ 
Sbjct: 156 QWVF 159


>gi|325261541|ref|ZP_08128279.1| putative GtrA family protein [Clostridium sp. D5]
 gi|324032995|gb|EGB94272.1| putative GtrA family protein [Clostridium sp. D5]
          Length = 128

 Score = 61.5 bits (148), Expect = 4e-08,   Method: Composition-based stats.
 Identities = 16/119 (13%), Positives = 46/119 (38%), Gaps = 1/119 (0%)

Query: 2   KQCIIFIINIVVVFFIDVMGFFILMKC-GADPFYSRIFSIAVAFLVTWIPSRLFIFLKLR 60
           +Q   F +     F ID     +L +  G +   S   S  V+ +  ++ S  ++F    
Sbjct: 3   QQITRFAVVGGSAFLIDYGIMILLTELCGINYLISSAISFTVSVIYNYLLSVHWVFNVTE 62

Query: 61  RKSFLETVRYGVMYFMLSILNYAFYVKLLLTFQGLQPLLATVLSAVSSMLFVFLLYIRF 119
            +S  +     ++  ++ +      + + +    +  +++ + +    M++ F+    F
Sbjct: 63  DRSQKQDFAVFIVLSVIGLGINQLIMWVCVDKLQIFYMISKIGATAIVMVYNFITRKIF 121


>gi|45600414|gb|AAS69899.1| dolichyl-phosphate mannose synthase [Leptospira interrogans serovar
           Copenhageni str. Fiocruz L1-130]
          Length = 329

 Score = 61.5 bits (148), Expect = 4e-08,   Method: Composition-based stats.
 Identities = 25/118 (21%), Positives = 45/118 (38%), Gaps = 2/118 (1%)

Query: 4   CIIFIINIVVVFFIDVMGFFILMKCGADPFYSRIFSIAVAFLVTWIPSRLFIFLKLRRKS 63
              F  + ++   ID   F I+    ++   S IFS  VA    +  ++ F+F       
Sbjct: 207 FFRFAFSSMLTSAIDFCVFTIVYLSVSNLLTSIIFSRTVAGTFNFFVNKRFVFRDPG-GV 265

Query: 64  FLETVRYGVMYFMLSILNYAFYVKLLLTFQGLQPLLATVLSAVSSMLFVFLLYIRFMT 121
            +E V+Y  +   L +L +      L +  G   ++A V       L  F +   F+ 
Sbjct: 266 AVEFVKYAFLVSGLGLLAFTAIRY-LHSMHGWNVIVAKVFVETIFFLVSFAIQREFVF 322


>gi|296447992|ref|ZP_06889898.1| GtrA family protein [Methylosinus trichosporium OB3b]
 gi|296254502|gb|EFH01623.1| GtrA family protein [Methylosinus trichosporium OB3b]
          Length = 130

 Score = 61.1 bits (147), Expect = 4e-08,   Method: Composition-based stats.
 Identities = 20/122 (16%), Positives = 46/122 (37%), Gaps = 3/122 (2%)

Query: 2   KQCIIFIINIVVVFFIDVMGFFILMKCGA-DPFYSRIFSIAVAFLVTWIPSRLFIFLKLR 60
           +Q  +F +  VV   +  +    L++     P  + +    V  +V++  +R   F   R
Sbjct: 8   RQITVFALVGVVATLLHYVVLIALVELAERPPVMAALCGYVVGGIVSYGLNRRHTFASDR 67

Query: 61  RKSFLETVRYGVMYFMLSILNYAFYVKLLLTFQGLQPLLATVLSAVSSMLFVFLLYIRFM 120
                   R+ ++ F+   L Y  ++ + +   G   L A + +      + F+    + 
Sbjct: 68  PHEEATW-RFALVAFVGFCLTY-LFMDVFVARLGAPYLPAQMATTGVVFFWSFVANRLWT 125

Query: 121 TR 122
            R
Sbjct: 126 FR 127


>gi|325674846|ref|ZP_08154533.1| glycosyl transferase [Rhodococcus equi ATCC 33707]
 gi|325554432|gb|EGD24107.1| glycosyl transferase [Rhodococcus equi ATCC 33707]
          Length = 412

 Score = 61.1 bits (147), Expect = 4e-08,   Method: Composition-based stats.
 Identities = 17/126 (13%), Positives = 43/126 (34%), Gaps = 6/126 (4%)

Query: 1   MKQCIIFIINIVVVFFIDVMGFFILMKCGADPFYSRIFSIAVAFLVTWIPSRLFIFLKLR 60
           + Q   F +  V    +     ++  +      ++   ++ V  +     +R F F    
Sbjct: 280 LGQLARFAVVGVAST-VAYALLYLAFQEAVGAQWANALALLVTAVANTAANRAFTFGVRG 338

Query: 61  RKSFLET-VRYGVMYFMLSILNYAFYVKLLLTFQGLQP---LLATVLSAVSSMLFVFLLY 116
           R+      ++  V++     +       L     G  P   L+  V++ + + L  F+  
Sbjct: 339 RRGAARHQLQGLVVFAFGLAITSGSLAALHRLTPGASPHLELVVLVVANLVATLSRFVGL 398

Query: 117 IRFMTR 122
             ++ R
Sbjct: 399 R-WVFR 403


>gi|94498768|ref|ZP_01305316.1| hypothetical protein SKA58_14247 [Sphingomonas sp. SKA58]
 gi|94421777|gb|EAT06830.1| hypothetical protein SKA58_14247 [Sphingomonas sp. SKA58]
          Length = 172

 Score = 61.1 bits (147), Expect = 4e-08,   Method: Composition-based stats.
 Identities = 22/123 (17%), Positives = 42/123 (34%), Gaps = 4/123 (3%)

Query: 3   QCIIFIINIVVVFFIDVMGFFILMKCGADPF-YSRIFSIAVAFLVTWIPSRLFIFLKLRR 61
           Q + + +  + V       ++ L   G      + +     A  V ++   LF F    R
Sbjct: 51  QIVRYGVTGLFVTACQAAIYWCLATLGGLHVQIANLIGYGGAVCVGYVAHSLFTFRDQAR 110

Query: 62  K--SFLETVRYGVMYFMLSILNYAFYVKLLLTFQGLQPLLATVLSAVSSMLFVFLLYIRF 119
                   VR+     +   LN A +V L +T  G             +   +F+L  ++
Sbjct: 111 SDGHGARGVRFVAASLVSYGLN-ALWVWLCVTHMGWPEWAPIPAMLFVTPAIMFVLNRQW 169

Query: 120 MTR 122
           + R
Sbjct: 170 VFR 172


>gi|297154250|gb|ADI03962.1| putative glycosyl transferase [Streptomyces bingchenggensis BCW-1]
          Length = 421

 Score = 61.1 bits (147), Expect = 5e-08,   Method: Composition-based stats.
 Identities = 18/120 (15%), Positives = 38/120 (31%), Gaps = 4/120 (3%)

Query: 7   FIINIVVVFFIDVMGFFILMKCGADPFYSRIFSIAVAFLVTWIPSRLFIFLKLRRKSFLE 66
           F    V    I     + L++    P  + + S+ V  +     +R   F          
Sbjct: 302 FAAIGVAST-IGQGLLYWLLRGWWPPALANLVSLLVLTVFNTEANRRLTFRWSETGVGRA 360

Query: 67  TVRYGVMYFMLSILNYAFYVKLLLTFQGLQ---PLLATVLSAVSSMLFVFLLYIRFMTRR 123
            +  G ++ +  ++  A  +    +          L  + S+V      FL+    + RR
Sbjct: 361 HLGAGALFVLGYLVTSAAVLLYRESSPDASTAAETLVLIASSVLVTAVRFLVLRLAVFRR 420


>gi|222528413|ref|YP_002572295.1| GtrA family protein [Caldicellulosiruptor bescii DSM 6725]
 gi|222455260|gb|ACM59522.1| GtrA family protein [Caldicellulosiruptor bescii DSM 6725]
          Length = 143

 Score = 61.1 bits (147), Expect = 5e-08,   Method: Composition-based stats.
 Identities = 17/124 (13%), Positives = 46/124 (37%), Gaps = 4/124 (3%)

Query: 3   QCIIFIINIVVVFFIDVMGFFILMK-CGADPFYSRIFSIAVAFLVTWIPSRLFIFLKL-- 59
           Q + F I  V+   +D   FF+           S++F      + ++I ++ + F     
Sbjct: 20  QLVKFSIVGVINTAVDFAVFFLFYSVFHISYSLSQVFGYTSGMINSFIMNKKWTFEDKTT 79

Query: 60  RRKSFLETVRYGVMYFMLSILNYAFYVKLLLTFQGLQPLLATVLSAVSSMLFVFLLYIRF 119
            +    + +++ +   +    +                L+A VL+ + + +  +L Y  +
Sbjct: 80  GKVIITKLLKFVITNLVSLGSSIVVLKLSKTYLSN-SILIAKVLATLCAQMINYLSYKYW 138

Query: 120 MTRR 123
           +  +
Sbjct: 139 VFNK 142


>gi|261338033|ref|ZP_05965917.1| conserved hypothetical membrane protein [Bifidobacterium gallicum
           DSM 20093]
 gi|270277542|gb|EFA23396.1| conserved hypothetical membrane protein [Bifidobacterium gallicum
           DSM 20093]
          Length = 185

 Score = 61.1 bits (147), Expect = 5e-08,   Method: Composition-based stats.
 Identities = 13/132 (9%), Positives = 46/132 (34%), Gaps = 13/132 (9%)

Query: 1   MKQCIIFIINIVVVFFIDVMGFFILM-KCGADPFYSRIFSIAVAFLVTWIPSRLFIFLKL 59
           ++Q + F +  V+   +D     +L+         +   S  ++F+  ++ S  ++F   
Sbjct: 5   IEQILKFGVVGVIAALLDFGILNLLVIFLHMHNVIASTISFTLSFIFNYLASMKYVFKHR 64

Query: 60  -RRKSFLETVRYGVMYFMLSILNYAFYVKLLLTFQGLQPL-----------LATVLSAVS 107
                ++E + + +   +  ++N                +           +  +++   
Sbjct: 65  PDMARWMEVLIFLLSAVIGLMMNNGIIWLSTYGMNRDAFITQHVEYVLRTNVGKIIATFI 124

Query: 108 SMLFVFLLYIRF 119
             ++ F++   F
Sbjct: 125 VAVWNFVIRKIF 136


>gi|318041168|ref|ZP_07973124.1| putative glycosyl transferase [Synechococcus sp. CB0101]
          Length = 364

 Score = 61.1 bits (147), Expect = 5e-08,   Method: Composition-based stats.
 Identities = 17/122 (13%), Positives = 39/122 (31%), Gaps = 2/122 (1%)

Query: 2   KQCIIFIINIVVVFFIDVMGFFILMKCGADPFYSRIFSIAVAFLVTWIPSRLFIFLKLRR 61
           ++ I F +  V    + ++   + M  G     +  F++ VA    ++ +    F   R 
Sbjct: 240 RRAISFGLVGVSGVAVQLLATQVFMAAGLGFKQALPFAVVVAASSNYLINNALTFRFQRL 299

Query: 62  KSFLETVRYGVMYFMLSILNYA--FYVKLLLTFQGLQPLLATVLSAVSSMLFVFLLYIRF 119
           K             + S+   A         +      L A +   +   ++ +    RF
Sbjct: 300 KGLALLRGLLKFLLVASLPVLANVGLASAFYSLVARDTLWAQLAGILVVFVWNYAASSRF 359

Query: 120 MT 121
           + 
Sbjct: 360 VW 361


>gi|225376899|ref|ZP_03754120.1| hypothetical protein ROSEINA2194_02541 [Roseburia inulinivorans DSM
           16841]
 gi|225211220|gb|EEG93574.1| hypothetical protein ROSEINA2194_02541 [Roseburia inulinivorans DSM
           16841]
          Length = 167

 Score = 61.1 bits (147), Expect = 5e-08,   Method: Composition-based stats.
 Identities = 17/134 (12%), Positives = 52/134 (38%), Gaps = 11/134 (8%)

Query: 1   MKQCIIFIINIVVVFFIDVMGFFILMKCGA--------DPFYSRIFSIAVAFLVTWIPSR 52
           + Q + F I  +    I  + + + +            D   +++ +  ++ L ++  + 
Sbjct: 31  LMQFVKFGIVGLSNTVISYVIYVVTLILFQKNNLIPSVDYLAAQVIAFILSVLWSFYWNN 90

Query: 53  LFIFLKLR---RKSFLETVRYGVMYFMLSILNYAFYVKLLLTFQGLQPLLATVLSAVSSM 109
            F+F K     R      ++  + Y    +   +    L +   G+  ++A +++ + S+
Sbjct: 91  KFVFEKADNEERNIVHALIKTYISYAFTGLFLNSILSLLWVEVFGIPKIIAPIINLLVSV 150

Query: 110 LFVFLLYIRFMTRR 123
              F++   +  R+
Sbjct: 151 PLNFIMNKFWAFRK 164


>gi|283782319|ref|YP_003373074.1| ribulose-phosphate 3-epimerase [Pirellula staleyi DSM 6068]
 gi|283440772|gb|ADB19214.1| ribulose-phosphate 3-epimerase [Pirellula staleyi DSM 6068]
          Length = 363

 Score = 61.1 bits (147), Expect = 5e-08,   Method: Composition-based stats.
 Identities = 16/126 (12%), Positives = 48/126 (38%), Gaps = 1/126 (0%)

Query: 2   KQCIIFIINIVVVFFIDVMGFFILMKCGADPFYSRIFSIAVAFLVTWIPSRLFIFLKLRR 61
           +   +F+I  +    ++ +    L+            +  V  L+  + +  F F     
Sbjct: 27  RHLGVFLIVGLASLVLEAVLIESLLPQNWPWVMRASLAFVVGMLIAAVVNVQFNFQVTPS 86

Query: 62  KSFLETVRYGVMYFMLSILNYAFYVKLLLTFQGLQPLLATVLSAVSSMLFVFLLYIRFMT 121
           +     + YG++  +   LN      L L F+ +   +  ++++ +    +++++ R+  
Sbjct: 87  RQLRAILVYGIVSLVSLSLNLGLAYALRL-FEVMPYSIGRLVASGALCGVIYIVHRRWTF 145

Query: 122 RRVYFI 127
            R+   
Sbjct: 146 HRLSRN 151


>gi|229158994|ref|ZP_04287050.1| GtrA [Bacillus cereus ATCC 4342]
 gi|228624413|gb|EEK81184.1| GtrA [Bacillus cereus ATCC 4342]
          Length = 127

 Score = 61.1 bits (147), Expect = 5e-08,   Method: Composition-based stats.
 Identities = 17/121 (14%), Positives = 51/121 (42%), Gaps = 2/121 (1%)

Query: 1   MKQCIIFIINIVVVFFIDVMGFFILMKCGADPFYSRIFSIAVAFLVTWIPSRLFIFLKLR 60
           M++ + F +  +    I ++ F+IL+K G +   +   +  +    ++  ++ ++F    
Sbjct: 1   MEKLLKFGLVGIFNTLITIISFWILLKFGMNYLIANTIAYLIGVANSYYWNKNWVFKPNN 60

Query: 61  RKSFLETVRYGVMYFMLSILNYAFYVKLLLTFQGLQPLLATVLSAVSSMLFVFLLYIRFM 120
           + S +   ++  +  ++   N      +L+       L+A + +    M+  F+L   + 
Sbjct: 61  KSSSM-FFKFLTVNLIVLAFNTLCL-FILVNKFTFNALIAQIFAIGVGMVINFVLNKIWT 118

Query: 121 T 121
            
Sbjct: 119 F 119


>gi|314920858|gb|EFS84689.1| conserved hypothetical protein [Propionibacterium acnes HL050PA3]
          Length = 219

 Score = 61.1 bits (147), Expect = 5e-08,   Method: Composition-based stats.
 Identities = 16/159 (10%), Positives = 48/159 (30%), Gaps = 36/159 (22%)

Query: 3   QCIIFIINIVVVFFIDVMGFFILMKCGADPFYSR--------------------IFSIAV 42
           + I F +     F ++++   I+ K      +++                    +     
Sbjct: 35  EFIKFGVVGGSGFLVNIIVAIIMNKANGGTEHAQDILFNLAGTRWNFRFTSLVWLVGFVG 94

Query: 43  AFLVTWIPSRLFIFLKL-RRKSFLETVRYGVMYFMLSILNYAFYVKLLLTFQGLQ----- 96
           A +  +  +R + F +  RR  + E   +  +  + +I+     +        +      
Sbjct: 95  ANITNFQLNRSWTFKREYRRGWWREFWPFFAVGSIAAIIGMFIKIFFTNPTSPIYLPEPW 154

Query: 97  ----------PLLATVLSAVSSMLFVFLLYIRFMTRRVY 125
                        + + + + +M   F++   +  R V 
Sbjct: 155 FNEGRGIQSREYWSQIFAIIVTMPINFVVNKLWTFRAVK 193


>gi|163840270|ref|YP_001624675.1| GtrA-like protein [Renibacterium salmoninarum ATCC 33209]
 gi|162953746|gb|ABY23261.1| GtrA-like protein [Renibacterium salmoninarum ATCC 33209]
          Length = 183

 Score = 61.1 bits (147), Expect = 5e-08,   Method: Composition-based stats.
 Identities = 21/126 (16%), Positives = 48/126 (38%), Gaps = 5/126 (3%)

Query: 2   KQCIIFIINIVVVFFIDVMGFFILMKCGADPFYSRIFSIAVAFLVTWIPSRLFIFLKLRR 61
           KQ I F+I   +     +  F  L    A   ++ + ++ +  ++    +R   +    R
Sbjct: 56  KQVIGFLIVGAICTAASLGIFTALRPF-AGTQWANLIALVLTSVLNTDLNRRHSWSIRDR 114

Query: 62  KSFL----ETVRYGVMYFMLSILNYAFYVKLLLTFQGLQPLLATVLSAVSSMLFVFLLYI 117
           K +L    + +    +  +L+  +      +      L  +L    + V + +  FLL  
Sbjct: 115 KHWLDDQSKGLWVMFLALLLTSSSLLLLHTINPNSSVLDEVLTITGANVLAAVSRFLLLR 174

Query: 118 RFMTRR 123
            ++ RR
Sbjct: 175 YWIFRR 180


>gi|324329381|gb|ADY24641.1| putative GtrA-like protein [Bacillus thuringiensis serovar
           finitimus YBT-020]
          Length = 127

 Score = 61.1 bits (147), Expect = 5e-08,   Method: Composition-based stats.
 Identities = 17/127 (13%), Positives = 54/127 (42%), Gaps = 2/127 (1%)

Query: 1   MKQCIIFIINIVVVFFIDVMGFFILMKCGADPFYSRIFSIAVAFLVTWIPSRLFIFLKLR 60
           M++ + F +  +    I ++ F+IL+K G +   +   + ++    ++  ++ ++F    
Sbjct: 1   MEKLLKFGLVGIFNTLITIISFWILLKFGMNYLIANTIAYSIGVANSYYWNKNWVFKPNN 60

Query: 61  RKSFLETVRYGVMYFMLSILNYAFYVKLLLTFQGLQPLLATVLSAVSSMLFVFLLYIRFM 120
           + S +   ++  +  ++   N      +L+       L+A + +    M+  F+L   + 
Sbjct: 61  KGSSM-FFKFLTVNLIVYAFNTLCL-FILVNKLTFNALIAQIFAIGFGMVINFVLNKIWT 118

Query: 121 TRRVYFI 127
             +   +
Sbjct: 119 FNQTKKV 125


>gi|325978303|ref|YP_004288019.1| glycosyl transferase [Streptococcus gallolyticus subsp.
           gallolyticus ATCC BAA-2069]
 gi|325178231|emb|CBZ48275.1| glycosyl transferase [Streptococcus gallolyticus subsp.
           gallolyticus ATCC BAA-2069]
          Length = 335

 Score = 61.1 bits (147), Expect = 5e-08,   Method: Composition-based stats.
 Identities = 18/118 (15%), Positives = 48/118 (40%), Gaps = 3/118 (2%)

Query: 4   CIIFIINIVVVFFIDVMGFFILMKCGADPFYSRIFSIAVAFLVTWIPSRLFIFLKLRRKS 63
            + F    ++   +D +  F L+    +   S I +  ++     + +   +F       
Sbjct: 220 FLKFSGASILAAIVDALALFTLIALTKNLLISVILARLISATTQCLLNANLVF-NRSNPL 278

Query: 64  FLETVRYGVMYFMLSILNYAFYVKLLLTFQGLQPLLATVLSAVSSMLFVFLLYIRFMT 121
            +  VRY ++  ++   NY  ++  +L   GL  +L+ +L+     +  + +  +F+ 
Sbjct: 279 LISIVRYFLLVAVILTCNY--FMLKVLISIGLGLILSKLLTETILFILSYRVQRKFVF 334


>gi|229827616|ref|ZP_04453685.1| hypothetical protein GCWU000182_03005 [Abiotrophia defectiva ATCC
           49176]
 gi|229788254|gb|EEP24368.1| hypothetical protein GCWU000182_03005 [Abiotrophia defectiva ATCC
           49176]
          Length = 362

 Score = 61.1 bits (147), Expect = 5e-08,   Method: Composition-based stats.
 Identities = 22/126 (17%), Positives = 46/126 (36%), Gaps = 8/126 (6%)

Query: 3   QCIIFIINIVVVFFIDVMGF------FILMKCGADPFYSRIFSIAVAFLVTWIPSRLFIF 56
           +   F ++ ++ F ID   +      F L         S I +  ++  V +  ++ F+F
Sbjct: 218 EIFRFSLSSLLAFIIDYAAYGILSLVFALFPTNLMLILSNIGARLISSTVNFNINKKFVF 277

Query: 57  LKLRRKSFLETVRYGVMYFMLSILNYAFYVKLLLTFQGLQPLLATVLSAVSSMLFVFLLY 116
               +      +RY  +   +  LN       L TF G    L  +++ +      F + 
Sbjct: 278 KHSEKG-KGSLIRYFTLAAGILGLNTLIL-LGLNTFSGGNIYLLKLVTEIVCFFISFTVQ 335

Query: 117 IRFMTR 122
             F+ +
Sbjct: 336 KVFVFK 341


>gi|220924296|ref|YP_002499598.1| GtrA family protein [Methylobacterium nodulans ORS 2060]
 gi|219948903|gb|ACL59295.1| GtrA family protein [Methylobacterium nodulans ORS 2060]
          Length = 159

 Score = 61.1 bits (147), Expect = 5e-08,   Method: Composition-based stats.
 Identities = 18/120 (15%), Positives = 43/120 (35%), Gaps = 3/120 (2%)

Query: 3   QCIIFIINIVVVFFIDVMGFFILMKCG-ADPFYSRIFSIAVAFLVTWIPSRLFIFLKLRR 61
           Q I ++   +    +       L++ G  DP  + +       +V++  +R   +   R 
Sbjct: 25  QFISYVGVGLAALVVHYGLLVALVEFGRVDPVAAAVAGYIAGGVVSYTLNRRHTYASDRP 84

Query: 62  KSFLETVRYGVMYFMLSILNYAFYVKLLLTFQGLQPLLATVLSAVSSMLFVFLLYIRFMT 121
            +     R+ V+  +   L +   + +L  + GL  L A   +    + + F     +  
Sbjct: 85  HAEATW-RFAVVAAIGLGLTW-ILMAVLTRWAGLAYLPAQFATTGLVVFWNFTGNRLWTF 142


>gi|116250047|ref|YP_765885.1| transmembrane protein [Rhizobium leguminosarum bv. viciae 3841]
 gi|115254695|emb|CAK05769.1| putative transmembrane protein [Rhizobium leguminosarum bv. viciae
           3841]
          Length = 125

 Score = 61.1 bits (147), Expect = 5e-08,   Method: Composition-based stats.
 Identities = 43/123 (34%), Positives = 65/123 (52%), Gaps = 1/123 (0%)

Query: 1   MKQCIIFIINIVVVFFIDVMGFFILMKCGA-DPFYSRIFSIAVAFLVTWIPSRLFIFLKL 59
           M++ I F I   + F +D      L+      PF +R+ +IA A   TW  +R F F + 
Sbjct: 1   MRKLIHFAIAGGIGFLVDAGILSALLALTPLGPFLARLVAIAFAMAATWAFNRSFTFDRS 60

Query: 60  RRKSFLETVRYGVMYFMLSILNYAFYVKLLLTFQGLQPLLATVLSAVSSMLFVFLLYIRF 119
            R    E  RYG +    +++NY  Y  LLL+   LQPL A V+++++SM+F F  Y RF
Sbjct: 61  GRSLAAEGFRYGSVGVTAALVNYGLYSALLLSLPALQPLAAMVIASIASMIFSFFGYSRF 120

Query: 120 MTR 122
           + R
Sbjct: 121 VFR 123


>gi|322391960|ref|ZP_08065424.1| GtrA family protein [Streptococcus peroris ATCC 700780]
 gi|321145186|gb|EFX40583.1| GtrA family protein [Streptococcus peroris ATCC 700780]
          Length = 346

 Score = 61.1 bits (147), Expect = 6e-08,   Method: Composition-based stats.
 Identities = 14/127 (11%), Positives = 46/127 (36%), Gaps = 8/127 (6%)

Query: 2   KQCIIFIINIVVVFFIDVMGFFILMKC------GADPFYSRIFSIAVAFLVTWIPSRLFI 55
           K    F ++ +  F +D + + + +            F S   +   + +  +  ++  +
Sbjct: 216 KNIFKFALSSLSSFVVDYVVYALAILFLPTVPTNFRIFLSNGLARVTSSVFNYSTNKKLV 275

Query: 56  FLKLRRKSFLETVRYGVMYFMLSILNYAFYVKLLLTFQGLQPLLATVLSAVSSMLFVFLL 115
           F           + Y  +  +   +     ++L  T  G+  L++ ++  +      +L+
Sbjct: 276 FKNED-SLAKTGMEYFGLA-VGLFVLDTLLIRLFFTVFGISLLISKIIVGILLFAVSWLV 333

Query: 116 YIRFMTR 122
             +F+ +
Sbjct: 334 QKKFIFK 340


>gi|223933367|ref|ZP_03625354.1| glycosyl transferase family 2 [Streptococcus suis 89/1591]
 gi|223897934|gb|EEF64308.1| glycosyl transferase family 2 [Streptococcus suis 89/1591]
          Length = 350

 Score = 61.1 bits (147), Expect = 6e-08,   Method: Composition-based stats.
 Identities = 12/127 (9%), Positives = 35/127 (27%), Gaps = 8/127 (6%)

Query: 2   KQCIIFIINIVVVFFIDVMGFFILMKCGADP------FYSRIFSIAVAFLVTWIPSRLFI 55
           K    F +     F +D   + + +              +   +   +    +  ++  +
Sbjct: 216 KNLFKFALASFGGFLVDYGVYALALLLLTSLPTALRLLVANTIARICSTTCNFALNKKLV 275

Query: 56  FLKLRRKSFLETVRYGVMYFMLSILNYAFYVKLLLTFQGLQPLLATVLSAVSSMLFVFLL 115
           F           V Y  +  +L + + A          GL   +  +   +   L  + +
Sbjct: 276 F-NSEESIARTGVGYFTLALVLFLCDTALLYL-FHQILGLNLYIVKLAVGIFLFLASWFV 333

Query: 116 YIRFMTR 122
               + +
Sbjct: 334 QKNIIFK 340


>gi|307154245|ref|YP_003889629.1| family 2 glycosyl transferase [Cyanothece sp. PCC 7822]
 gi|306984473|gb|ADN16354.1| glycosyl transferase family 2 [Cyanothece sp. PCC 7822]
          Length = 432

 Score = 61.1 bits (147), Expect = 6e-08,   Method: Composition-based stats.
 Identities = 19/129 (14%), Positives = 54/129 (41%), Gaps = 10/129 (7%)

Query: 3   QCIIFIINIVVVFFIDVMGFFILMKCGADPFY-----SRIFSIAVAFLVTWIPSRLFIFL 57
           +   F+I        +++  F+L++            + + SI ++ L+++   R++++ 
Sbjct: 5   KIFKFLIGGGFAAAFNIVLMFLLIEWLGFNTVFLRNIANVISIELSLLLSFFIYRIWVWP 64

Query: 58  KL----RRKSFLETVRYGVMYFMLSILNYAFYVKLLLTFQGLQPLLATVLSAVSSMLFVF 113
                 R   + +   Y  +    +I+   F +  LL + G+   + T++  + S    +
Sbjct: 65  GGVWTVREVLWRQIPLYH-VAAGTAIMVRIFLLFPLLDWLGINYAVNTLVGVLVSASLNY 123

Query: 114 LLYIRFMTR 122
           L+  R + +
Sbjct: 124 LISDRLVFK 132


>gi|154505109|ref|ZP_02041847.1| hypothetical protein RUMGNA_02621 [Ruminococcus gnavus ATCC 29149]
 gi|153794588|gb|EDN77008.1| hypothetical protein RUMGNA_02621 [Ruminococcus gnavus ATCC 29149]
          Length = 132

 Score = 60.7 bits (146), Expect = 6e-08,   Method: Composition-based stats.
 Identities = 20/120 (16%), Positives = 45/120 (37%), Gaps = 1/120 (0%)

Query: 1   MKQCIIFIINIVVVFFIDVMGFFILMK-CGADPFYSRIFSIAVAFLVTWIPSRLFIFLKL 59
           M+Q I F       F ID      L +  G +   S   S +V+ +  +I S  ++F   
Sbjct: 10  MRQIIRFAFVGGSAFVIDYGVMIFLTEMIGINYLISSGISFSVSVIYNYILSVHWVFDVA 69

Query: 60  RRKSFLETVRYGVMYFMLSILNYAFYVKLLLTFQGLQPLLATVLSAVSSMLFVFLLYIRF 119
             +S        ++  ++ +      + + +    +  ++A +      M++ F+    F
Sbjct: 70  EDRSKRAEFVIFIILSVIGLGINQLVMWIAVDIFRMFYMIAKIGVTAIVMVYNFITRKLF 129


>gi|146295336|ref|YP_001179107.1| GtrA family protein [Caldicellulosiruptor saccharolyticus DSM 8903]
 gi|312623288|ref|YP_004024901.1| gtra family protein [Caldicellulosiruptor kronotskyensis 2002]
 gi|145408912|gb|ABP65916.1| GtrA family protein [Caldicellulosiruptor saccharolyticus DSM 8903]
 gi|312203755|gb|ADQ47082.1| GtrA family protein [Caldicellulosiruptor kronotskyensis 2002]
          Length = 143

 Score = 60.7 bits (146), Expect = 6e-08,   Method: Composition-based stats.
 Identities = 16/124 (12%), Positives = 46/124 (37%), Gaps = 4/124 (3%)

Query: 3   QCIIFIINIVVVFFIDVMGFFILMK-CGADPFYSRIFSIAVAFLVTWIPSRLFIFLKL-- 59
           Q + F I  V+   +D   FF+           S++F      + ++I ++ + F     
Sbjct: 20  QLVKFSIVGVINTAVDFAVFFLFYSVFRISYSLSQVFGYTSGMINSFIMNKKWTFEDKTT 79

Query: 60  RRKSFLETVRYGVMYFMLSILNYAFYVKLLLTFQGLQPLLATVLSAVSSMLFVFLLYIRF 119
            +    + +++ +   +    +                L+A +L+ + + +  +L Y  +
Sbjct: 80  GKVIITKLLKFVITNLVSLGSSIVVLKLSKTYLSN-SILIAKILATLCAQMINYLSYKYW 138

Query: 120 MTRR 123
           +  +
Sbjct: 139 VFNK 142


>gi|326773005|ref|ZP_08232289.1| GtrA family protein [Actinomyces viscosus C505]
 gi|326637637|gb|EGE38539.1| GtrA family protein [Actinomyces viscosus C505]
          Length = 392

 Score = 60.7 bits (146), Expect = 6e-08,   Method: Composition-based stats.
 Identities = 21/118 (17%), Positives = 43/118 (36%), Gaps = 3/118 (2%)

Query: 4   CIIFIINIVVVFFIDVMGFFILMKCGADPFYSRIFSIAVAFLVTWIPSRLFIFLKLRRKS 63
            + F+   +  F ID +G  ++         + + +  V+    +  +R  +F   R   
Sbjct: 274 LLRFMGASLASFGIDWLGVMVIFAMTGSLLAAVVGARLVSGTANFFMNRR-VFRARRGTV 332

Query: 64  FLETVRYGVMYFMLSILNYAFYVKLLLTFQGLQPLLATVLSAVSSMLFVFLLYIRFMT 121
               VRY V+   L   +Y        T  G+   +A VL   +  +  ++   R + 
Sbjct: 333 VRTAVRYTVLAVSLLAASYLMLKA--FTAVGIPLGIAKVLGDGAIYVTSYVAQRRLVF 388


>gi|146319544|ref|YP_001199256.1| cell wall biosynthesis glycosyltransferase [Streptococcus suis
           05ZYH33]
 gi|146321739|ref|YP_001201450.1| cell wall biosynthesis glycosyltransferase [Streptococcus suis
           98HAH33]
 gi|253752549|ref|YP_003025690.1| glycosyl transferase [Streptococcus suis SC84]
 gi|253754375|ref|YP_003027516.1| glycosyl transferase [Streptococcus suis P1/7]
 gi|253756309|ref|YP_003029449.1| glycosyl transferase [Streptococcus suis BM407]
 gi|145690350|gb|ABP90856.1| Glycosyltransferases involved in cell wall biogenesis
           [Streptococcus suis 05ZYH33]
 gi|145692545|gb|ABP93050.1| Glycosyltransferases involved in cell wall biogenesis
           [Streptococcus suis 98HAH33]
 gi|251816838|emb|CAZ52483.1| putative glycosyl transferase [Streptococcus suis SC84]
 gi|251818773|emb|CAZ56611.1| putative glycosyl transferase [Streptococcus suis BM407]
 gi|251820621|emb|CAR47379.1| putative glycosyl transferase [Streptococcus suis P1/7]
 gi|319758961|gb|ADV70903.1| cell wall biosynthesis glycosyltransferase [Streptococcus suis
           JS14]
          Length = 350

 Score = 60.7 bits (146), Expect = 6e-08,   Method: Composition-based stats.
 Identities = 12/127 (9%), Positives = 35/127 (27%), Gaps = 8/127 (6%)

Query: 2   KQCIIFIINIVVVFFIDVMGFFILMKCGADP------FYSRIFSIAVAFLVTWIPSRLFI 55
           K    F +     F +D   + + +              +   +   +    +  ++  +
Sbjct: 216 KNLFKFALASFGGFLVDYGIYALALLLLTSLPTALRLLVANTIARICSATCNFALNKKLV 275

Query: 56  FLKLRRKSFLETVRYGVMYFMLSILNYAFYVKLLLTFQGLQPLLATVLSAVSSMLFVFLL 115
           F           V Y  +  +L + + A          GL   +  +   +   L  + +
Sbjct: 276 F-NNEESIARTGVGYFTLALVLFLCDTALLYL-FHQILGLNLYIVKLAVGIFLFLASWFI 333

Query: 116 YIRFMTR 122
               + +
Sbjct: 334 QKNIIFK 340


>gi|296875862|ref|ZP_06899923.1| GtrA family protein [Streptococcus parasanguinis ATCC 15912]
 gi|296433103|gb|EFH18889.1| GtrA family protein [Streptococcus parasanguinis ATCC 15912]
          Length = 350

 Score = 60.7 bits (146), Expect = 6e-08,   Method: Composition-based stats.
 Identities = 12/127 (9%), Positives = 45/127 (35%), Gaps = 8/127 (6%)

Query: 2   KQCIIFIINIVVVFFIDVMGFFILMKCGAD------PFYSRIFSIAVAFLVTWIPSRLFI 55
           K    F ++ +  F +D + +   +              +   +   + +  +  ++  +
Sbjct: 216 KDMFKFALSSLSSFIVDYLVYAFFLFVMMAVPISLRILLANGIARVTSSIFNYSTNKHLV 275

Query: 56  FLKLRRKSFLETVRYGVMYFMLSILNYAFYVKLLLTFQGLQPLLATVLSAVSSMLFVFLL 115
           F      +   +  +G+   +   +     ++L  T  GL  L++ ++      L  +++
Sbjct: 276 FKNKDSVTKTGSGYFGL--ALGLFILDTLLIRLFYTAFGLNLLISKIVVGFLLFLVSWVI 333

Query: 116 YIRFMTR 122
             + + +
Sbjct: 334 QKKVIFK 340


>gi|319781561|ref|YP_004141037.1| GtrA family protein [Mesorhizobium ciceri biovar biserrulae
           WSM1271]
 gi|317167449|gb|ADV10987.1| GtrA family protein [Mesorhizobium ciceri biovar biserrulae
           WSM1271]
          Length = 136

 Score = 60.7 bits (146), Expect = 6e-08,   Method: Composition-based stats.
 Identities = 22/117 (18%), Positives = 49/117 (41%), Gaps = 3/117 (2%)

Query: 3   QCIIFIINIVVVFFIDVMGFFILMKCGADPFYSRIFSIAVAFLVTWIPSRLFIF-LKLRR 61
           + + F I  +    ID+  FF+L+K GA P  + + +  +A   ++  +  + F      
Sbjct: 14  KIVRFAIVGLANTAIDLASFFLLLKLGASPLPANVAAWFIAVTFSFAANGFWSFERNRAI 73

Query: 62  KSFLETVRYGVMYFMLSILNYAFYVKLLLTFQGLQPLLATVLSAVSSMLFVFLLYIR 118
           +     +R+  +  ++S+   +  + L     G+ P  A +   V + +  FL    
Sbjct: 74  RLRDAFLRFASLGGLISLGVSSLSIALFAGIAGVWP--AKIAGVVVAAVLNFLAARW 128


>gi|311033188|ref|ZP_07711278.1| putative GtrA-like protein [Bacillus sp. m3-13]
          Length = 126

 Score = 60.7 bits (146), Expect = 7e-08,   Method: Composition-based stats.
 Identities = 21/121 (17%), Positives = 53/121 (43%), Gaps = 2/121 (1%)

Query: 1   MKQCIIFIINIVVVFFIDVMGFFILMKCGADPFYSRIFSIAVAFLVTWIPSRLFIFLKLR 60
           MK+ + F    V    I  + F IL   G +   + +    +  + ++  ++ ++F   R
Sbjct: 1   MKRLLKFGTVGVFNTLITFVSFTILYFLGFNYLVANVIGYCLGVMNSYYWNKKWVFQDNR 60

Query: 61  RKSFLETVRYGVMYFMLSILNYAFYVKLLLTFQGLQPLLATVLSAVSSMLFVFLLYIRFM 120
           +   +   ++  +  +   +    ++ LL+   GLQP+LA + +  +S+   + L  ++ 
Sbjct: 61  KTVSI-FYKFIAVNLLTLGIQ-TLFLFLLVNTMGLQPVLANLGAIGASLFINYFLNAKWT 118

Query: 121 T 121
            
Sbjct: 119 F 119


>gi|302384987|ref|YP_003820809.1| GtrA family protein [Clostridium saccharolyticum WM1]
 gi|302195615|gb|ADL03186.1| GtrA family protein [Clostridium saccharolyticum WM1]
          Length = 162

 Score = 60.7 bits (146), Expect = 7e-08,   Method: Composition-based stats.
 Identities = 13/125 (10%), Positives = 45/125 (36%), Gaps = 3/125 (2%)

Query: 1   MKQCIIFIINIVVVFFIDVMGFFILMKCGADPFYSRIFSIAVAFLVTWIPSRLFIFLKLR 60
           + Q I F    +    +    + + +  G     +      +    ++  +  ++F    
Sbjct: 36  IMQFIRFCFVGISNTMLHYFIYLVCLLLGIQYMLANFIGFTIGVANSFYWNNRYVFKDNG 95

Query: 61  RK---SFLETVRYGVMYFMLSILNYAFYVKLLLTFQGLQPLLATVLSAVSSMLFVFLLYI 117
                  L  ++  + Y +  IL  +  + + +   G+  L+A + + + ++   F++  
Sbjct: 96  ESKRFWLLTFLKTYISYGLTGILLNSVLLHIEVGTLGINQLIAPIANLLITIPLNFVINK 155

Query: 118 RFMTR 122
            +  +
Sbjct: 156 FWAYK 160


>gi|28492992|ref|NP_787153.1| hypothetical protein TWT025 [Tropheryma whipplei str. Twist]
 gi|28476032|gb|AAO44122.1| unknown [Tropheryma whipplei str. Twist]
          Length = 153

 Score = 60.7 bits (146), Expect = 7e-08,   Method: Composition-based stats.
 Identities = 23/132 (17%), Positives = 51/132 (38%), Gaps = 10/132 (7%)

Query: 2   KQCIIFIINIVVVFFIDVMGFFILMKCG-----ADPFYSRIFSIAVAFLVTWIPSRLFIF 56
           +Q   F I  +   F++++ F +LM  G          +   ++ V+    WI +R  +F
Sbjct: 20  RQIATFGIVGIAGIFVNILVFNLLMLLGFRNIAYGSVLAASVAVIVSISFNWIGNRHLVF 79

Query: 57  LK-LRRKSFLETVRYGVMYFMLSILNYAFYVKLLL----TFQGLQPLLATVLSAVSSMLF 111
               R     E VR+ ++    S++  A  V        T      + + ++    + + 
Sbjct: 80  RGLRRDGVLREAVRFFLVSIGGSLVQLACLVVSHYGMGFTSILADNIASNLVGLPLATVL 139

Query: 112 VFLLYIRFMTRR 123
            F+ Y  ++  +
Sbjct: 140 RFIGYYFWVFSK 151


>gi|288905317|ref|YP_003430539.1| glycosyl transferase family 2 [Streptococcus gallolyticus UCN34]
 gi|306831398|ref|ZP_07464557.1| GtrA family protein [Streptococcus gallolyticus subsp. gallolyticus
           TX20005]
 gi|288732043|emb|CBI13608.1| putative glycosyl transferase family 2 [Streptococcus gallolyticus
           UCN34]
 gi|304426458|gb|EFM29571.1| GtrA family protein [Streptococcus gallolyticus subsp. gallolyticus
           TX20005]
          Length = 335

 Score = 60.7 bits (146), Expect = 7e-08,   Method: Composition-based stats.
 Identities = 18/118 (15%), Positives = 48/118 (40%), Gaps = 3/118 (2%)

Query: 4   CIIFIINIVVVFFIDVMGFFILMKCGADPFYSRIFSIAVAFLVTWIPSRLFIFLKLRRKS 63
            + F    ++   +D +  F L+    +   S I +  ++     + +   +F       
Sbjct: 220 FLKFSGASILAAIVDALALFTLVALTKNLLISVILARLISATTQCLLNANLVF-NRSNPL 278

Query: 64  FLETVRYGVMYFMLSILNYAFYVKLLLTFQGLQPLLATVLSAVSSMLFVFLLYIRFMT 121
            +  VRY ++  ++   NY  ++  +L   GL  +L+ +L+     +  + +  +F+ 
Sbjct: 279 LISIVRYFLLVAVILTCNY--FMLKVLISIGLGLILSKLLTETILFILSYRVQRKFVF 334


>gi|237785290|ref|YP_002905995.1| hypothetical protein ckrop_0691 [Corynebacterium kroppenstedtii DSM
           44385]
 gi|237758202|gb|ACR17452.1| putative membrane protein [Corynebacterium kroppenstedtii DSM
           44385]
          Length = 203

 Score = 60.7 bits (146), Expect = 7e-08,   Method: Composition-based stats.
 Identities = 18/162 (11%), Positives = 43/162 (26%), Gaps = 38/162 (23%)

Query: 3   QCIIFIINIVVVFFIDVMGFFILMKCGADPF----------------------YSRIFSI 40
           Q I F +       ++++   I  K     F                           + 
Sbjct: 18  QFIKFGLVGGSGVIVNMVALVIANKLFGWGFDVTPHDTVLNLLGTRFHLRWYHIFATIAF 77

Query: 41  AVAFLVTWIPSRLFIFLKLRRKSF-LETVRYGVMYFMLSILNYAFYVKLLLTFQGL---- 95
            VA    +  +R + F       +  E + +  +  +  +++      L+     L    
Sbjct: 78  VVANTWNFQINRWWTFKSHGHGRWLREFLAFFAVGLLSWVVSQIVMTLLMNPTSPLELSP 137

Query: 96  -----------QPLLATVLSAVSSMLFVFLLYIRFMTRRVYF 126
                      Q   A ++    +M   F++   +  + V  
Sbjct: 138 RIFDSSTGLRNQLYWANLIGIFVAMPVNFVVNKLWTFKAVRV 179



 Score = 35.6 bits (81), Expect = 2.4,   Method: Composition-based stats.
 Identities = 10/80 (12%), Positives = 30/80 (37%), Gaps = 17/80 (21%)

Query: 1   MKQCIIFIINIVVVFFIDVMGFFILMK-----------------CGADPFYSRIFSIAVA 43
           +++ + F    ++ + +  +   +LM                       +++ +  I VA
Sbjct: 102 LREFLAFFAVGLLSWVVSQIVMTLLMNPTSPLELSPRIFDSSTGLRNQLYWANLIGIFVA 161

Query: 44  FLVTWIPSRLFIFLKLRRKS 63
             V ++ ++L+ F  +R   
Sbjct: 162 MPVNFVVNKLWTFKAVRVSR 181


>gi|320547941|ref|ZP_08042224.1| GtrA family protein [Streptococcus equinus ATCC 9812]
 gi|320447481|gb|EFW88241.1| GtrA family protein [Streptococcus equinus ATCC 9812]
          Length = 355

 Score = 60.7 bits (146), Expect = 7e-08,   Method: Composition-based stats.
 Identities = 11/123 (8%), Positives = 42/123 (34%), Gaps = 8/123 (6%)

Query: 4   CIIFIINIVVVFFIDVMGFFILMKCGAD-----PFYSRIFSIAVAFLVTWIPSRLFIFLK 58
              +I + +  F +D++ F IL+             + + + A++ +V +  +   +F  
Sbjct: 228 FFKYIFSSLFSFLVDIIAFTILISLLNGLSFSAVTLASVLARAISSVVNYFLNHKVVFK- 286

Query: 59  LRRKSFLETVRYGVMYFMLSILNYAFYVKLLLTFQGLQPLLATVLSAVSSMLFVFLLYIR 118
             +      V+Y  +  +  +++      +      +   +  ++         + +   
Sbjct: 287 --KGKASSAVKYFTLVVVQIMVSSFLVTIVGNALTAVPISIVKIVVDGMLFFVSYFVQKH 344

Query: 119 FMT 121
            + 
Sbjct: 345 LVF 347



 Score = 34.9 bits (79), Expect = 4.0,   Method: Composition-based stats.
 Identities = 11/74 (14%), Positives = 29/74 (39%), Gaps = 3/74 (4%)

Query: 53  LFIFLKLRRKSFLETVRYGVMYFMLSILNYAFYVKLLLTFQGLQP---LLATVLSAVSSM 109
            F  ++   + +    +Y        +++   +  L+    GL      LA+VL+   S 
Sbjct: 214 HFDVVRDSLRIYKVFFKYIFSSLFSFLVDIIAFTILISLLNGLSFSAVTLASVLARAISS 273

Query: 110 LFVFLLYIRFMTRR 123
           +  + L  + + ++
Sbjct: 274 VVNYFLNHKVVFKK 287


>gi|162148923|ref|YP_001603384.1| dolichol-phosphate mannosyltransferase [Gluconacetobacter
           diazotrophicus PAl 5]
 gi|161787500|emb|CAP57096.1| putative Dolichol-phosphate mannosyltransferase [Gluconacetobacter
           diazotrophicus PAl 5]
          Length = 377

 Score = 60.7 bits (146), Expect = 7e-08,   Method: Composition-based stats.
 Identities = 9/97 (9%), Positives = 33/97 (34%), Gaps = 3/97 (3%)

Query: 3   QCIIFIINIVVVFFIDVMGFFILMKCGADPFYSRIFSIAVAFLVTWIPSRLFIFLK---L 59
           + I F +  +V   ++++   +  +CGAD    +      A +  +  +    +      
Sbjct: 261 RFIAFALVGLVGILVNLVVLDVARRCGADFASGQGIGTVAAMVANFWMNNSLTYRDCRLR 320

Query: 60  RRKSFLETVRYGVMYFMLSILNYAFYVKLLLTFQGLQ 96
             + +L  + +  +  + ++ +      +        
Sbjct: 321 GGRMWLGLLLFLAICSVGALADIGIARAVFSEDGKWN 357


>gi|298294341|ref|YP_003696280.1| GtrA family protein [Starkeya novella DSM 506]
 gi|296930852|gb|ADH91661.1| GtrA family protein [Starkeya novella DSM 506]
          Length = 145

 Score = 60.3 bits (145), Expect = 7e-08,   Method: Composition-based stats.
 Identities = 17/122 (13%), Positives = 40/122 (32%), Gaps = 3/122 (2%)

Query: 2   KQCIIFIINIVVVFFIDVMGFFILMKCGADPFYS-RIFSIAVAFLVTWIPSRLFIFLKLR 60
           +  ++F     +           L++ G     +       V  L  +  +R  +F    
Sbjct: 22  RHLLLFAALGGIGTLAHYAVLIGLVQGGVAGPVAGSTAGFLVGGLTNYQLNRRIVFR-ST 80

Query: 61  RKSFLETVRYGVMYFMLSILNYAFYVKLLLTFQGLQPLLATVLSAVSSMLFVFLLYIRFM 120
           +       ++ ++  +  ++N A  + LL        L A VL     +L+ +     + 
Sbjct: 81  KPHHEAMTKFFLIAGIGLVINAAL-MALLTGPLAAPYLPAQVLVTGLLVLWHYAGNALWT 139

Query: 121 TR 122
            R
Sbjct: 140 FR 141


>gi|283781320|ref|YP_003372075.1| GtrA family protein [Pirellula staleyi DSM 6068]
 gi|283439773|gb|ADB18215.1| GtrA family protein [Pirellula staleyi DSM 6068]
          Length = 174

 Score = 60.3 bits (145), Expect = 7e-08,   Method: Composition-based stats.
 Identities = 19/122 (15%), Positives = 44/122 (36%), Gaps = 3/122 (2%)

Query: 3   QCIIFIINIVVVFFIDVMGFFILMKC-GADPFYSRIFSIAVAFLVTWIPSRLFIFLKLR- 60
           +   ++I  VV   +D+    +L +  G   F +   +  +  L  +  S  ++F     
Sbjct: 34  ELQRYLIVAVVALLVDLGSLLVLRELVGTSTFVAAALAFVLGLLTNYFLSVAWVFPARNV 93

Query: 61  RKSFLETVRYGVMYFMLSILNYAFYVKLLLTFQGLQPLLATVLSAVSSMLFVFLLYIRFM 120
           +   LE V +  +  +   L     +       G+   L  +L+     ++ F +    +
Sbjct: 94  QSPLLEFVLFATIGIVGLALTE-LLLFCGSDLLGIDYRLVKLLAVGVVFVWNFGVRKLLL 152

Query: 121 TR 122
            R
Sbjct: 153 FR 154


>gi|166367381|ref|YP_001659654.1| glycosyl transferase family protein [Microcystis aeruginosa
           NIES-843]
 gi|166089754|dbj|BAG04462.1| glycosyl transferase family 2 [Microcystis aeruginosa NIES-843]
          Length = 423

 Score = 60.3 bits (145), Expect = 7e-08,   Method: Composition-based stats.
 Identities = 15/129 (11%), Positives = 47/129 (36%), Gaps = 10/129 (7%)

Query: 3   QCIIFIINIVVVFFIDVMGFFIL-----MKCGADPFYSRIFSIAVAFLVTWIPSRLFIFL 57
           +   F+I   V F I++   +                + + SI ++ + ++   R++++ 
Sbjct: 9   KIFRFLIAGGVAFLINLFLIYWFIDDLGFNTPFLKNVANVISIEISLIASFFIYRIWVWT 68

Query: 58  KLRRKSF----LETVRYGVMYFMLSILNYAFYVKLLLTFQGLQPLLATVLSAVSSMLFVF 113
                      ++   Y +   +  +L   F +   L + G+ P + T++  +      +
Sbjct: 69  GGDWTIRDVILIQLPLYHLSAGLAVLLR-VFLIFPFLNWLGISPGVNTMIGVLLGASINY 127

Query: 114 LLYIRFMTR 122
           +     + +
Sbjct: 128 VASDSLIFK 136


>gi|296141771|ref|YP_003649014.1| GtrA family protein [Tsukamurella paurometabola DSM 20162]
 gi|296029905|gb|ADG80675.1| GtrA family protein [Tsukamurella paurometabola DSM 20162]
          Length = 146

 Score = 60.3 bits (145), Expect = 8e-08,   Method: Composition-based stats.
 Identities = 21/128 (16%), Positives = 43/128 (33%), Gaps = 8/128 (6%)

Query: 3   QCIIFIINIVVVFFIDVMGFFILMK-CGADPFYSRIFSIAVAFLVTWIPSRLFIFLK--L 59
           Q I F++       +D     IL    GA  F ++           ++ +R + F     
Sbjct: 17  QLIRFVLTGAFSAVVDFGITLILTMGFGASDFTAKTIGFICGTTTAYLLNRRWTFKAEPS 76

Query: 60  RRKSFLETVRYGVMYFMLSILNYAFYVKLLLTFQG-----LQPLLATVLSAVSSMLFVFL 114
            ++       Y  MY + + L          +  G         LA V++  ++ +  F+
Sbjct: 77  TKRLAAVWALYVTMYGVQTGLYLGILALFPPSDDGGAGSYAIRALAFVIAQGTATVVNFI 136

Query: 115 LYIRFMTR 122
           +    + R
Sbjct: 137 VQRTVIFR 144


>gi|325003106|ref|ZP_08124218.1| GtrA-like protein [Pseudonocardia sp. P1]
          Length = 189

 Score = 60.3 bits (145), Expect = 8e-08,   Method: Composition-based stats.
 Identities = 18/122 (14%), Positives = 43/122 (35%), Gaps = 4/122 (3%)

Query: 3   QCIIFIINIVVVFFIDVMGFFILMKCGADPFYSRIFSIAVAFLVTWIPSRLFIFLKLRRK 62
           Q   + +       ++   F +L++   D   + + ++ +   V+   +R F F   R  
Sbjct: 41  QLARYAVIGGGATALNAALF-LLVRPWLDAVPANLVALVLTTAVSTEANRRFAFGGARAH 99

Query: 63  SFLETVR---YGVMYFMLSILNYAFYVKLLLTFQGLQPLLATVLSAVSSMLFVFLLYIRF 119
              E V+       Y   +         +L+     +   A  L++V+  L  F +   +
Sbjct: 100 RLREWVQDVGTVAFYATYTSTVLIGLEWILVRPTPAEEATAVALASVAGGLLRFAVLRFW 159

Query: 120 MT 121
           + 
Sbjct: 160 VF 161


>gi|154150290|ref|YP_001403908.1| GtrA family protein [Candidatus Methanoregula boonei 6A8]
 gi|153998842|gb|ABS55265.1| GtrA family protein [Methanoregula boonei 6A8]
          Length = 134

 Score = 60.3 bits (145), Expect = 8e-08,   Method: Composition-based stats.
 Identities = 22/121 (18%), Positives = 47/121 (38%), Gaps = 2/121 (1%)

Query: 3   QCIIFIINIVVVFFIDVMGFFILMKCGA-DPFYSRIFSIAVAFLVTWIPSRLFIFLKLRR 61
           + I F +   +   +D+   +           Y+  FS     +V ++ ++   F     
Sbjct: 12  RIIPFFLVGALSSLVDIGLMYTCTTFFEVWYLYAAAFSYCCGIVVNYLANKYLTFHDTST 71

Query: 62  KSFLETVRYGVMYFMLSILNYAFYVKLLLTFQGLQPLLATVLSAVSSMLFVFLLYIRFMT 121
           K+ ++   +  +     I+N        +TF  L PLLA +++   + L+ +    RF  
Sbjct: 72  KTAVQFATFTAVSISCLIVNLGIVWLG-VTFFALTPLLAKIIATCLAFLWSYHGQSRFTF 130

Query: 122 R 122
           R
Sbjct: 131 R 131


>gi|260905733|ref|ZP_05914055.1| glycosyl transferase family protein [Brevibacterium linens BL2]
          Length = 417

 Score = 60.3 bits (145), Expect = 8e-08,   Method: Composition-based stats.
 Identities = 13/123 (10%), Positives = 36/123 (29%), Gaps = 5/123 (4%)

Query: 3   QCIIFIINIVVVFFIDVMGFFILMKCGADPFYSRIFSIAVAFLVTWIPSRLFIFLKLRRK 62
           Q + FI   +V   +     F+       P  + + ++ ++ +     +R   F      
Sbjct: 282 QILHFIDVGIVSTLL-YAVLFLFGVQMFSPTVANLGALLISTVANTGLNRRHTFGVRSPH 340

Query: 63  SFLET----VRYGVMYFMLSILNYAFYVKLLLTFQGLQPLLATVLSAVSSMLFVFLLYIR 118
             L      +    +    +    A           +  L     + + + +  F+L   
Sbjct: 341 HGLAAQIKGLASFALCLGFTSAGLAISANFTGPLASVGTLAVLTSANLLATIVRFVLLRT 400

Query: 119 FMT 121
           ++ 
Sbjct: 401 WVF 403


>gi|315500115|ref|YP_004088918.1| glycosyl transferase family 2 [Asticcacaulis excentricus CB 48]
 gi|315418127|gb|ADU14767.1| glycosyl transferase family 2 [Asticcacaulis excentricus CB 48]
          Length = 420

 Score = 60.3 bits (145), Expect = 8e-08,   Method: Composition-based stats.
 Identities = 15/136 (11%), Positives = 45/136 (33%), Gaps = 18/136 (13%)

Query: 3   QCIIFIINIVVVFFIDVMGFFILMKC--------------GADPFYSRIFSIAVAFLVTW 48
           + ++F +  V   F+  +   +                    D   +   +I ++    +
Sbjct: 279 RFVLFGLVGVSGAFVYAIILALSHSLLRVDGGLPLYRYQVRYDDIINYGLAIWLSMTWNF 338

Query: 49  IPSRLFIFLKLRRKSFL---ETVRYGVMYFMLSILNYAFYVKLLLTFQGLQPLLATVLSA 105
             + +  F   R + +      + +     + ++L+      LL  + G+    A + +A
Sbjct: 339 YINNVLTFRDKRLRGWPMLTGLLGFYFACSIGALLSLGV-AILLKDYFGIHWFAAGISAA 397

Query: 106 VSSMLFVFLLYIRFMT 121
           + S ++ +     F  
Sbjct: 398 LLSGVWNYWGAKAFAW 413


>gi|150008283|ref|YP_001303026.1| putative GtrA family protein [Parabacteroides distasonis ATCC 8503]
 gi|255015437|ref|ZP_05287563.1| putative GtrA family protein [Bacteroides sp. 2_1_7]
 gi|256839431|ref|ZP_05544940.1| conserved hypothetical protein [Parabacteroides sp. D13]
 gi|262384602|ref|ZP_06077736.1| conserved hypothetical protein [Bacteroides sp. 2_1_33B]
 gi|298375139|ref|ZP_06985096.1| GtrA family protein [Bacteroides sp. 3_1_19]
 gi|301309213|ref|ZP_07215157.1| GtrA family protein [Bacteroides sp. 20_3]
 gi|149936707|gb|ABR43404.1| conserved hypothetical protein, putative GtrA family protein
           [Parabacteroides distasonis ATCC 8503]
 gi|256738361|gb|EEU51686.1| conserved hypothetical protein [Parabacteroides sp. D13]
 gi|262293895|gb|EEY81829.1| conserved hypothetical protein [Bacteroides sp. 2_1_33B]
 gi|298267639|gb|EFI09295.1| GtrA family protein [Bacteroides sp. 3_1_19]
 gi|300832895|gb|EFK63521.1| GtrA family protein [Bacteroides sp. 20_3]
          Length = 126

 Score = 60.3 bits (145), Expect = 8e-08,   Method: Composition-based stats.
 Identities = 18/123 (14%), Positives = 44/123 (35%), Gaps = 2/123 (1%)

Query: 1   MKQCIIFIINIVVVFFIDVMGFFILMKC-GADPFYSRIFSIAVAFLVTWIPSRLFIFLKL 59
           +KQ I + +  +    I ++  +++MK  G     S +       L ++I ++ + F   
Sbjct: 4   IKQAIKYGVVGLSNTLITMIVIWVMMKLFGCREGLSNLTGYVAGILNSFIWNKQWTFKGS 63

Query: 60  RRKSFLETVRYGVMYFMLSILNYAFYVKLLLTFQGLQPLLATVLSAVSSMLFVFLLYIRF 119
                   VR+ + + +   L Y   + L             ++      +  FL+   +
Sbjct: 64  STGWTKGAVRFTIAFIICYALQYGLVLILNSRLTIDHYY-NHLIGMAFYTVINFLVNKFY 122

Query: 120 MTR 122
             +
Sbjct: 123 TFK 125


>gi|10640137|emb|CAC11989.1| hypothetical protein [Thermoplasma acidophilum]
          Length = 279

 Score = 60.3 bits (145), Expect = 8e-08,   Method: Composition-based stats.
 Identities = 15/129 (11%), Positives = 43/129 (33%), Gaps = 8/129 (6%)

Query: 6   IFIINIVVVFFIDVMGFFILMKCGADPFYSRIFSIAVAFLVTWIPSRLFIFLKLR----- 60
            ++I       ++     +L        ++  F+I  +    ++ +  + F         
Sbjct: 154 KYMIVGTTGILLNEFMLKMLSY-HLPLTFADAFAIETSITSNFLMNEYWTFNNRDVTKGV 212

Query: 61  RKSFLETVRYGVMYFMLSILNYAFYVKLLLTFQGLQPLLATVLSAVSSMLFVFLLYIRFM 120
           +  F     + +   +   +N   +    L   G++ L A ++    + L  +L+  R +
Sbjct: 213 KGFFRRMGFHNLTSLIGLGINLGIFTA--LVDTGMEMLAANLIGIAVAFLSRYLMSSRIV 270

Query: 121 TRRVYFIKK 129
                  K+
Sbjct: 271 WHGPTKTKE 279


>gi|322387876|ref|ZP_08061483.1| dolichyl-phosphate beta-D-mannosyltransferase [Streptococcus
           infantis ATCC 700779]
 gi|321141149|gb|EFX36647.1| dolichyl-phosphate beta-D-mannosyltransferase [Streptococcus
           infantis ATCC 700779]
          Length = 347

 Score = 60.3 bits (145), Expect = 8e-08,   Method: Composition-based stats.
 Identities = 15/127 (11%), Positives = 45/127 (35%), Gaps = 8/127 (6%)

Query: 2   KQCIIFIINIVVVFFIDVMGFFILMKCGAD------PFYSRIFSIAVAFLVTWIPSRLFI 55
           K    F ++ +  F +D + + I +            F +   +   + +  +  ++  +
Sbjct: 216 KNIFKFALSSLSSFVVDYIVYAIAILFLPTAPTSFRIFLANGLARVTSSVFNYSTNKKLV 275

Query: 56  FLKLRRKSFLETVRYGVMYFMLSILNYAFYVKLLLTFQGLQPLLATVLSAVSSMLFVFLL 115
           F             +G+   +   +     ++L  T  G+  L+A V+  +      + +
Sbjct: 276 FKNDDSLVKTGMGYFGL--AVGLFVLDTLLIRLFFTVFGVNLLIAKVIVGILLFAVSWTV 333

Query: 116 YIRFMTR 122
             +F+ +
Sbjct: 334 QKKFIFK 340


>gi|269957490|ref|YP_003327279.1| Dolichyl-phosphate beta-D-mannosyltransferase [Xylanimonas
           cellulosilytica DSM 15894]
 gi|269306171|gb|ACZ31721.1| Dolichyl-phosphate beta-D-mannosyltransferase [Xylanimonas
           cellulosilytica DSM 15894]
          Length = 384

 Score = 60.3 bits (145), Expect = 9e-08,   Method: Composition-based stats.
 Identities = 12/122 (9%), Positives = 40/122 (32%), Gaps = 3/122 (2%)

Query: 3   QCIIFIINIVVVFFIDVMGFFILMKCGADPFYSRIFSIAVAFLVTWIPSRLFIFLK--LR 60
           +   F +   +   ++++  + L   G     + I S  +  +  ++    F+F      
Sbjct: 234 RLSPFAVIGALGAVLNLLILWALQSAGVHYLPAVIASNGLTIVTNFLLQERFVFRDLRDG 293

Query: 61  RKSFLETVRYGVMYFMLSILNYAFYVKLLLTFQGLQPLLATVLSAVSSMLFVFLLYIRFM 120
                  V+        +++     +  ++      P L      + + L  F+ + + +
Sbjct: 294 GSMGRRFVQSFAFNGTEAVIR-TLLLWWIVEAAFPHPELVQAGLILVAFLVRFVFHAQVV 352

Query: 121 TR 122
            +
Sbjct: 353 YK 354


>gi|307353524|ref|YP_003894575.1| GtrA family protein [Methanoplanus petrolearius DSM 11571]
 gi|307156757|gb|ADN36137.1| GtrA family protein [Methanoplanus petrolearius DSM 11571]
          Length = 147

 Score = 60.3 bits (145), Expect = 9e-08,   Method: Composition-based stats.
 Identities = 17/121 (14%), Positives = 50/121 (41%), Gaps = 3/121 (2%)

Query: 3   QCIIFIINIVVVFFIDVMGFFILMKCGADPFYSRIFSIAVAFLVTWIPSRLFIFLKLRRK 62
           Q   F++  ++   +  + FF+L+    +   + +    +A   ++I +R ++F      
Sbjct: 26  QLSKFLLVGILNTVVGYLIFFVLVGF-MNYMIATVAGHFLAVTHSYIWNRFWVFSSKNHP 84

Query: 63  SFLETVRYGVMYFMLSILNYAFYVKLLLTFQGLQPLLATVLSAVSSMLFVFLLYIRFMTR 122
              E +++  +Y  + + N    + + +   G+ P +A +L    +    F  +     +
Sbjct: 85  VT-EFIKFNFVYLFVLLENL-ILMPIFVAGLGIDPRIAALLCIPITTFISFFGHRYLSFK 142

Query: 123 R 123
           +
Sbjct: 143 K 143


>gi|312133475|ref|YP_004000814.1| membrane protein [Bifidobacterium longum subsp. longum BBMN68]
 gi|317483381|ref|ZP_07942373.1| GtrA-like protein [Bifidobacterium sp. 12_1_47BFAA]
 gi|322688339|ref|YP_004208073.1| hypothetical protein BLIF_0148 [Bifidobacterium longum subsp.
           infantis 157F]
 gi|311772712|gb|ADQ02200.1| Hypothetical Membrane protein [Bifidobacterium longum subsp. longum
           BBMN68]
 gi|316915198|gb|EFV36628.1| GtrA-like protein [Bifidobacterium sp. 12_1_47BFAA]
 gi|320459675|dbj|BAJ70295.1| conserved hypothetical protein [Bifidobacterium longum subsp.
           infantis 157F]
          Length = 178

 Score = 60.3 bits (145), Expect = 9e-08,   Method: Composition-based stats.
 Identities = 17/128 (13%), Positives = 42/128 (32%), Gaps = 13/128 (10%)

Query: 5   IIFIINIVVVFFIDVMGFFILM-KCGADPFYSRIFSIAVAFLVTWIPSRLFIFLKL-RRK 62
           + F I  V+ F ID     +L+         +   S  ++ +  ++ S  F+F       
Sbjct: 1   MKFGIVGVIAFVIDWGILNLLVGIFHMHNVLAATISFIISLIFNYLASMKFVFKHRDDMA 60

Query: 63  SFLETVRYGVMYFMLSILNYAFYVKLLLTFQGLQPL-----------LATVLSAVSSMLF 111
            ++E + +     +   +N A              +           +  +++    M++
Sbjct: 61  RWMEILIFVAGAVVGLFMNDAIIWISTYGMNHDAYVSQHAEYLLRTNIGKLVATAVVMIW 120

Query: 112 VFLLYIRF 119
            FL+    
Sbjct: 121 NFLIRKWL 128


>gi|311235451|gb|ADP88304.1| GtrA family protein [Desulfovibrio vulgaris RCH1]
          Length = 407

 Score = 60.3 bits (145), Expect = 9e-08,   Method: Composition-based stats.
 Identities = 23/120 (19%), Positives = 42/120 (35%), Gaps = 3/120 (2%)

Query: 4   CIIFIINIVVVFFIDVMGFFILMKCGADPFYSRIFSIAVAFLVTWIPSRLFIFLKLRRKS 63
            + F I+ ++ F ID + F       +    S +F+   A    +  +R  +F   RR S
Sbjct: 246 FLRFNISALLTFAIDYLVFGAFFALSSSVGLSIVFARLCAGAFNYTVNREIVFRSTRRHS 305

Query: 64  FLETVRYGVMYFMLSILNYAFYVKLLLTFQGLQPLLATVLSAVSSMLFVFLLYIRFMTRR 123
               +    +  M SI   +      L   G     A +       LF F++    +  +
Sbjct: 306 VTLLLYALTVLLMGSIAYVSIKA---LAASGTNVYAAKIFIECVLFLFSFIIQRELIFTK 362


>gi|260102653|ref|ZP_05752890.1| conserved hypothetical protein [Lactobacillus helveticus DSM 20075]
 gi|260083542|gb|EEW67662.1| conserved hypothetical protein [Lactobacillus helveticus DSM 20075]
          Length = 138

 Score = 60.3 bits (145), Expect = 1e-07,   Method: Composition-based stats.
 Identities = 15/126 (11%), Positives = 46/126 (36%), Gaps = 2/126 (1%)

Query: 3   QCIIFIINIVVVFFIDVMGFFILMKCGADPFYSRIFSIAVAFLVTWIPSRLFIFLKLRRK 62
           Q + +++  V+   +D   + IL     +   + I S     +  +  +    F      
Sbjct: 15  QLVKYVLIGVLGLVVDFGIYTILTYFKVNVEIANIISSTCGIINNFFWNSYTNFKVHDH- 73

Query: 63  SFLETVRYGVMYFMLSILNYAFYVKLLLTFQGLQPLLATVLSAVSSMLFVFLLYIRFMTR 122
             +  + Y ++  + ++      + + +   G   L+  +++   + L  F++      +
Sbjct: 74  LIVRFISYFLVGQITTVFT-TLSLFIFVNQLGYPHLIVKIVATFVATLIQFIINKIITFK 132

Query: 123 RVYFIK 128
           +V   K
Sbjct: 133 KVRNNK 138


>gi|317508826|ref|ZP_07966468.1| glycosyl hydrolase [Segniliparus rugosus ATCC BAA-974]
 gi|316252876|gb|EFV12304.1| glycosyl hydrolase [Segniliparus rugosus ATCC BAA-974]
          Length = 438

 Score = 59.9 bits (144), Expect = 1e-07,   Method: Composition-based stats.
 Identities = 15/130 (11%), Positives = 47/130 (36%), Gaps = 7/130 (5%)

Query: 1   MKQCIIFIINIVVVFFIDVMGFFILMKCGADPFYSRIFSIAVAFLVTWIPSRLFIFLKLR 60
           + Q + F +  V+   I     ++ ++       + + ++    +     +R F F    
Sbjct: 302 VGQLVRFGVVGVLST-IAFALLYLALRPLLGAQVANLVALLSTAIANTAANRAFTFGVRG 360

Query: 61  RK----SFLETVRYGVMYFMLSILNYAFYVKLLLTFQGLQ-PLLATVLSAVSSMLFVFLL 115
           R       L+ +   ++   L+  +      ++ +  G    L+  +++ + + L  F+ 
Sbjct: 361 RAGAGLHHLQGLIIFLIGLGLTSGSLYALHSMVSSDPGRHIELVTLIVANLVATLVRFIG 420

Query: 116 YIRFMTRRVY 125
               + R  +
Sbjct: 421 LR-LVFRHHH 429


>gi|229829601|ref|ZP_04455670.1| hypothetical protein GCWU000342_01698 [Shuttleworthia satelles DSM
           14600]
 gi|229791590|gb|EEP27704.1| hypothetical protein GCWU000342_01698 [Shuttleworthia satelles DSM
           14600]
          Length = 180

 Score = 59.9 bits (144), Expect = 1e-07,   Method: Composition-based stats.
 Identities = 15/132 (11%), Positives = 49/132 (37%), Gaps = 11/132 (8%)

Query: 3   QCIIFIINIVVVFFIDVMGFFILMKCG--------ADPFYSRIFSIAVAFLVTWIPSRLF 54
           Q + F I  V    +  + +   +           AD   +++ +  ++   ++  +   
Sbjct: 48  QFVKFGIVGVSNTLLSYLLYTGALILFRILGWFGRADYLLAQVVAFILSVAWSYYWNNKM 107

Query: 55  IFL---KLRRKSFLETVRYGVMYFMLSILNYAFYVKLLLTFQGLQPLLATVLSAVSSMLF 111
           +F       R  +   ++  + Y    +    F + L +   G+   +A +++ + S+  
Sbjct: 108 VFKLGEGETRSVWKSLLKTYISYSFTGLFLNTFLLILWVRIIGISEFIAPLINLLISVPL 167

Query: 112 VFLLYIRFMTRR 123
            F++   +  ++
Sbjct: 168 NFVINKFWAFKK 179


>gi|255282640|ref|ZP_05347195.1| bacterial membrane protein YfhO [Bryantella formatexigens DSM
           14469]
 gi|255266933|gb|EET60138.1| bacterial membrane protein YfhO [Bryantella formatexigens DSM
           14469]
          Length = 991

 Score = 59.9 bits (144), Expect = 1e-07,   Method: Composition-based stats.
 Identities = 22/123 (17%), Positives = 50/123 (40%), Gaps = 5/123 (4%)

Query: 3   QCIIFIINIVVVFFIDVMGFFIL-MKCGADPFYSRIFSIAVAFLVTWIPSRLFIFLKLR- 60
           + + +I        ++ + +FIL      D   +  FSI ++    ++ +++F+F     
Sbjct: 12  RIVRYIFFGGCTTMVNFVSYFILRTVLSVDVTRANFFSILLSIFFAYVVNKIFVFESKTQ 71

Query: 61  --RKSFLETVRYGVMYFMLSILNYAFYVKLLLTFQGLQPLLATVLSAVSSMLFVFLLYIR 118
             R+   E   +  M  +   +   F   LL +  G+  +LA +L     ++  F+    
Sbjct: 72  GLRELLSEMAGFVGMRGITMFIEI-FGTVLLSSVWGMNDMLAKLLIQFVVLVLNFVFSKI 130

Query: 119 FMT 121
           F+ 
Sbjct: 131 FVF 133


>gi|255505417|ref|ZP_05345932.3| GtrA family protein [Bryantella formatexigens DSM 14469]
 gi|255267865|gb|EET61070.1| GtrA family protein [Bryantella formatexigens DSM 14469]
          Length = 386

 Score = 59.9 bits (144), Expect = 1e-07,   Method: Composition-based stats.
 Identities = 22/126 (17%), Positives = 48/126 (38%), Gaps = 7/126 (5%)

Query: 2   KQCIIFIINIVVVFFIDVMGFFILMKCGADP----FYSRIFSIAVAFLVTWIPSRLFIFL 57
           +  + F ++    F +D + F + +            + I + AV+    +  +  F+F 
Sbjct: 240 RDMLKFTLSSFSGFVLDYLLFSLFLLFLPHTAFCVLLANIAARAVSAFCNYSMNCCFVFH 299

Query: 58  KLRRKSFLETVRYGVMYFMLSILNYAFYVKLLLTFQGLQPLLATVLSAVSSMLFVFLLYI 117
             RR       RY  +  +  +L     + +L+    +    A +L+     LF +L+  
Sbjct: 300 TNRR--MQTAARYFALAGV-ILLLNNLILGMLVQVLHVPVHPAKLLTECLLFLFSWLMQN 356

Query: 118 RFMTRR 123
             + RR
Sbjct: 357 CVIFRR 362


>gi|120586893|ref|YP_961238.1| methyltransferase type 12 [Desulfovibrio vulgaris subsp. vulgaris
           DP4]
 gi|120564307|gb|ABM30050.1| Methyltransferase type 12 [Desulfovibrio vulgaris DP4]
          Length = 578

 Score = 59.9 bits (144), Expect = 1e-07,   Method: Composition-based stats.
 Identities = 23/120 (19%), Positives = 42/120 (35%), Gaps = 3/120 (2%)

Query: 4   CIIFIINIVVVFFIDVMGFFILMKCGADPFYSRIFSIAVAFLVTWIPSRLFIFLKLRRKS 63
            + F I+ ++ F ID + F       +    S +F+   A    +  +R  +F   RR S
Sbjct: 246 FLRFNISALLTFAIDYLVFGAFFALSSSVGLSIVFARLCAGAFNYTVNREIVFRSTRRHS 305

Query: 64  FLETVRYGVMYFMLSILNYAFYVKLLLTFQGLQPLLATVLSAVSSMLFVFLLYIRFMTRR 123
               +    +  M SI   +      L   G     A +       LF F++    +  +
Sbjct: 306 VTLLLYALTVLLMGSIAYVSIKA---LAASGTNVYAAKIFIECVLFLFSFIIQRELIFTK 362


>gi|54023135|ref|YP_117377.1| hypothetical protein nfa11680 [Nocardia farcinica IFM 10152]
 gi|54014643|dbj|BAD56013.1| hypothetical protein [Nocardia farcinica IFM 10152]
          Length = 170

 Score = 59.9 bits (144), Expect = 1e-07,   Method: Composition-based stats.
 Identities = 20/125 (16%), Positives = 44/125 (35%), Gaps = 5/125 (4%)

Query: 2   KQCIIFIINIVVVFFIDVM--GFFIL-MKCGADPFYSRIFSIAVAFLVTWIPSRLFIFLK 58
           +Q + F +       + +     ++L +  G  P  +   + AV+ +V +   R  +F  
Sbjct: 43  RQELAFAVVGAFNTALGMALTVLWLLVLGAGVSPAVAPALAYAVSIVVAFTLHRTLVFRV 102

Query: 59  LRRKSFLETVRYGVMYFMLSILNYAFYVKLLLTFQGLQPLLATVLSAVSSMLFVFLLYIR 118
             R    + V + V+     ++N A      +    L  + A +       +  F  +  
Sbjct: 103 RGR-LVRDFVAFVVVNSGGLLMNMALLQLA-VQVAHLPRIPAALGVMAVVAVASFFGHRH 160

Query: 119 FMTRR 123
              RR
Sbjct: 161 ISFRR 165


>gi|111220167|ref|YP_710961.1| putative glycosyl transferase [Frankia alni ACN14a]
 gi|111147699|emb|CAJ59355.1| putative glycosyl transferase [Frankia alni ACN14a]
          Length = 435

 Score = 59.9 bits (144), Expect = 1e-07,   Method: Composition-based stats.
 Identities = 18/124 (14%), Positives = 42/124 (33%), Gaps = 5/124 (4%)

Query: 3   QCIIFIINIVVVFFIDVMGFFILMKCGADPFYSRIFSIAVAFLVTWIPSRLFIFL----K 58
           Q + F I  V       +  F+L++       + + ++ +  +     +R   F      
Sbjct: 304 QLVRFAIIGVASTLA-YLVLFVLLRTATGAQAANLLALLITAVANTAANRRLTFGLTGAA 362

Query: 59  LRRKSFLETVRYGVMYFMLSILNYAFYVKLLLTFQGLQPLLATVLSAVSSMLFVFLLYIR 118
              +  L+ +    +   L+  + A              +   VL+ + S +  FLL   
Sbjct: 363 QAGRHHLQGLVVFAIGLGLTSGSLAALHAASDHPGRGLEVTVLVLANLLSTVIRFLLLRA 422

Query: 119 FMTR 122
           ++ R
Sbjct: 423 WVFR 426


>gi|52222857|gb|AAU34198.1| polyprenyl mannose synthase MppG [Streptomyces hygroscopicus]
          Length = 425

 Score = 59.9 bits (144), Expect = 1e-07,   Method: Composition-based stats.
 Identities = 15/121 (12%), Positives = 40/121 (33%), Gaps = 3/121 (2%)

Query: 3   QCIIFIINIVVVFFIDVMGFFILMKCGA-DPFYSRIFSIAVAFLVTWIPSRLFIFLKLRR 61
           + + F +  V  F  +++  + L          + + +  +  L  +      ++   + 
Sbjct: 282 RMVAFGLIGVSGFVPNLLALWALTGATTLHYAVAEVLANQLGVLWNFALLDFLVYRSGKP 341

Query: 62  KS-FLETVRYGVMYFMLSILNYAFYVKLLLTFQGLQPLLATVLSAVSSMLFVFLLYIRFM 120
                  + +  +     +      +   +   G+ P+ ATV+S V      FLL    +
Sbjct: 342 GRGAGRLLGFAALSNADLLARIPLMML-FVEQAGMGPVPATVISLVVVFALRFLLVDTLI 400

Query: 121 T 121
            
Sbjct: 401 Y 401



 Score = 34.5 bits (78), Expect = 5.0,   Method: Composition-based stats.
 Identities = 12/64 (18%), Positives = 22/64 (34%), Gaps = 1/64 (1%)

Query: 59  LRRKSFLETVRYGVMYFMLSILNYAFYVKLLLTFQGLQPLLATVLSAVSSMLFVFLLYIR 118
                    V +G++     + N    +  L     L   +A VL+    +L+ F L   
Sbjct: 275 RTSDKRARMVAFGLIGVSGFVPNL-LALWALTGATTLHYAVAEVLANQLGVLWNFALLDF 333

Query: 119 FMTR 122
            + R
Sbjct: 334 LVYR 337


>gi|322390178|ref|ZP_08063710.1| GtrA family protein [Streptococcus parasanguinis ATCC 903]
 gi|321143138|gb|EFX38584.1| GtrA family protein [Streptococcus parasanguinis ATCC 903]
          Length = 350

 Score = 59.9 bits (144), Expect = 1e-07,   Method: Composition-based stats.
 Identities = 12/127 (9%), Positives = 45/127 (35%), Gaps = 8/127 (6%)

Query: 2   KQCIIFIINIVVVFFIDVMGFFILMKCGAD------PFYSRIFSIAVAFLVTWIPSRLFI 55
           K    F ++ +  F +D + +   +              +   +   + +  +  ++  +
Sbjct: 216 KDMFKFALSSLSSFIVDYLVYAFFLFVMMAVPISLRILLANGIARVTSSIFNYSTNKHLV 275

Query: 56  FLKLRRKSFLETVRYGVMYFMLSILNYAFYVKLLLTFQGLQPLLATVLSAVSSMLFVFLL 115
           F      +   +  +G+   +   +     ++L  T  GL  L++ ++      L  +++
Sbjct: 276 FKNKDSVAKTGSGYFGL--ALGLFILDTLLIRLFYTAFGLNLLISKIVVGFLLFLVSWVI 333

Query: 116 YIRFMTR 122
             + + +
Sbjct: 334 QKKVIFK 340


>gi|118472347|ref|YP_890585.1| membrane protein [Mycobacterium smegmatis str. MC2 155]
 gi|118173634|gb|ABK74530.1| membrane protein [Mycobacterium smegmatis str. MC2 155]
          Length = 135

 Score = 59.9 bits (144), Expect = 1e-07,   Method: Composition-based stats.
 Identities = 16/122 (13%), Positives = 45/122 (36%), Gaps = 4/122 (3%)

Query: 3   QCIIFIINIVVVFFIDVMGFFILMKCGADPFYSRIFSIAVAFLVTWIPSRLFIFLKLRRK 62
           Q   FI+   +   +D   + +L+  G     ++  S        ++ +R + F     K
Sbjct: 14  QAFRFIVTGGLSAIVDFGLYVLLLAAGLHVNVAKTLSFVAGTTTAYLINRRWTFQAPPSK 73

Query: 63  SFLETVRYGVMYFMLSILNYAFYVKLLLTFQ--GLQPLLATVLSAVSSMLFVFLLYIRFM 120
           +    +   V+Y +   +         + +     +  +A V++  ++ +  F++    +
Sbjct: 74  A--RFIAVCVLYAVTYAVQVGINYVFYMAWDEKPWRVPVAFVIAQGTATVINFIVQRAVI 131

Query: 121 TR 122
            R
Sbjct: 132 FR 133


>gi|330993340|ref|ZP_08317275.1| GtrA family protein [Gluconacetobacter sp. SXCC-1]
 gi|329759370|gb|EGG75879.1| GtrA family protein [Gluconacetobacter sp. SXCC-1]
          Length = 175

 Score = 59.9 bits (144), Expect = 1e-07,   Method: Composition-based stats.
 Identities = 24/125 (19%), Positives = 46/125 (36%), Gaps = 5/125 (4%)

Query: 3   QCIIFIINIVVVFFIDVMGFFILMKCGADPFYSRIFSIAVAFLVTWIPSRLFIFLKLRRK 62
           Q + F I  ++    D    + L         + I +  +A  + W  +RL+ F K   +
Sbjct: 11  QFLKFGIVGLLGLGWDTTAVYSLRPL-VGLTTATIAAYFIAASINWFINRLWTFRKAGNQ 69

Query: 63  SF--LETVRYGVMYFMLSILNYAFYVKLLLTFQG--LQPLLATVLSAVSSMLFVFLLYIR 118
               ++ +R+     +   LN      L          P+LA V  A + M+  F +  +
Sbjct: 70  HHFMVQWLRFLAGNSLGFFLNRGCVFMLFHLSPIFKANPVLALVAGAAAGMMANFHISRK 129

Query: 119 FMTRR 123
            +  R
Sbjct: 130 LVFHR 134


>gi|325520447|gb|EGC99551.1| hypothetical protein B1M_36006 [Burkholderia sp. TJI49]
          Length = 130

 Score = 59.9 bits (144), Expect = 1e-07,   Method: Composition-based stats.
 Identities = 13/122 (10%), Positives = 36/122 (29%), Gaps = 3/122 (2%)

Query: 2   KQCIIFIINIVVVFFIDVMGFFILMKCG-ADPFYSRIFSIAVAFLVTWIPSRLFIFLKLR 60
           ++ + +     +   +      +L+     +   +          V ++ +    F    
Sbjct: 7   RRFVRYASVGAIGTAVQYGTMAMLVSLRACEVVVASCAGAIAGAGVNYLLNYHVTFRATG 66

Query: 61  RKSFLETVRYGVMYFMLSILNYAFYVKLLLTFQGLQPLLATVLSAVSSMLFVFLLYIRFM 120
                  +R+  +      +N    + LL    G   L A  +S V  ++  +     + 
Sbjct: 67  AHCAT-ALRFFSVAVPGIAVN-GALMWLLSHRGGWPWLPAQCMSTVIVLVTTYTANSLWT 124

Query: 121 TR 122
            R
Sbjct: 125 FR 126



 Score = 34.5 bits (78), Expect = 5.1,   Method: Composition-based stats.
 Identities = 10/58 (17%), Positives = 22/58 (37%), Gaps = 1/58 (1%)

Query: 5   IIFIINIVVVFFIDVMGFFILMK-CGADPFYSRIFSIAVAFLVTWIPSRLFIFLKLRR 61
           + F    V    ++    ++L    G     ++  S  +  + T+  + L+ F   RR
Sbjct: 73  LRFFSVAVPGIAVNGALMWLLSHRGGWPWLPAQCMSTVIVLVTTYTANSLWTFRMRRR 130


>gi|312868353|ref|ZP_07728553.1| glycosyltransferase, group 2 family protein [Streptococcus
           parasanguinis F0405]
 gi|311096098|gb|EFQ54342.1| glycosyltransferase, group 2 family protein [Streptococcus
           parasanguinis F0405]
          Length = 350

 Score = 59.9 bits (144), Expect = 1e-07,   Method: Composition-based stats.
 Identities = 12/127 (9%), Positives = 45/127 (35%), Gaps = 8/127 (6%)

Query: 2   KQCIIFIINIVVVFFIDVMGFFILMKCGAD------PFYSRIFSIAVAFLVTWIPSRLFI 55
           K    F ++ +  F +D + +   +              +   +   + +  +  ++  +
Sbjct: 216 KDMFKFALSSLSSFIVDYLVYAFFLFVMMAVPISLRILLANGIARVTSSIFNYSTNKHLV 275

Query: 56  FLKLRRKSFLETVRYGVMYFMLSILNYAFYVKLLLTFQGLQPLLATVLSAVSSMLFVFLL 115
           F      +   +  +G+   +   +     ++L  T  GL  L++ ++      L  +++
Sbjct: 276 FKNKDSVAKTGSGYFGL--ALGLFILDTLLIRLFYTAFGLNLLISKIVVGFLLFLVSWVI 333

Query: 116 YIRFMTR 122
             + + +
Sbjct: 334 QKKVIFK 340


>gi|311115194|ref|YP_003986415.1| hypothetical protein HMPREF0421_21310 [Gardnerella vaginalis ATCC
           14019]
 gi|310946688|gb|ADP39392.1| conserved hypothetical protein [Gardnerella vaginalis ATCC 14019]
          Length = 194

 Score = 59.9 bits (144), Expect = 1e-07,   Method: Composition-based stats.
 Identities = 18/129 (13%), Positives = 51/129 (39%), Gaps = 10/129 (7%)

Query: 1   MKQCIIFIINIVVVFFIDVMGFFILMKCGADPFYSRIFSIAVAFLVTWIPSRLFIFLKL- 59
           ++Q + F I  ++   IDV+   +L+    +   +   S  ++ +  +I S  ++F    
Sbjct: 30  IEQVVKFGIVGIIALIIDVVLLNLLLLVHLNNVVAGTISFIISLIFNYIASMKYVFKHRE 89

Query: 60  RRKSFLETVRYGVMYFMLSILNYAFYVKLLLTFQ---------GLQPLLATVLSAVSSML 110
               ++E + + +   +  ++N A      L             L+  +  +++ V   +
Sbjct: 90  DMARWMELLIFIISAVIGLLINDAIIWLSTLGMAQTLRGTAIYMLRTNIGKLIATVVVAV 149

Query: 111 FVFLLYIRF 119
           + F++    
Sbjct: 150 WNFVIRKWL 158


>gi|227892647|ref|ZP_04010452.1| GtrA family membrane protein [Lactobacillus ultunensis DSM 16047]
 gi|227865518|gb|EEJ72939.1| GtrA family membrane protein [Lactobacillus ultunensis DSM 16047]
          Length = 138

 Score = 59.9 bits (144), Expect = 1e-07,   Method: Composition-based stats.
 Identities = 17/123 (13%), Positives = 45/123 (36%), Gaps = 2/123 (1%)

Query: 3   QCIIFIINIVVVFFIDVMGFFILMKCGADPFYSRIFSIAVAFLVTWIPSRLFIFLKLRRK 62
           Q + +++  V+   +D   + IL     +   + I S     +  +  +    F    R 
Sbjct: 15  QLVKYVLIGVLGLVVDFGIYTILTHFKMNVEIANIISSTCGIINNFFWNSYANFKVHDR- 73

Query: 63  SFLETVRYGVMYFMLSILNYAFYVKLLLTFQGLQPLLATVLSAVSSMLFVFLLYIRFMTR 122
             L  + Y ++  + +I      + + +T      L+  +++   + L  F++      R
Sbjct: 74  LILRFISYFLVGQITTIFT-TISLFIFVTKMCFPHLIVKIIATFVATLIQFVINKIITFR 132

Query: 123 RVY 125
           +  
Sbjct: 133 KSK 135


>gi|261885924|ref|ZP_06009963.1| GtrA family protein [Campylobacter fetus subsp. venerealis str.
           Azul-94]
          Length = 126

 Score = 59.9 bits (144), Expect = 1e-07,   Method: Composition-based stats.
 Identities = 17/119 (14%), Positives = 45/119 (37%), Gaps = 3/119 (2%)

Query: 4   CIIFIINIVVVFFIDVMGFFILMKCGADPFYSRIFSIAVAFLVTWIPSRLFIFLKLRRKS 63
            + ++   V+   +     F LM  G     S +       + ++  ++ F F    R +
Sbjct: 8   FLRYLCVGVLNTIVGFGIIFTLMYIGYSAEISNLIGYMCGIIFSYFMNKFFTFNTKNR-T 66

Query: 64  FLETVRYGVMYFMLSILNYAFYVKLLLTFQGLQPLLATVLSAVSSMLFVFLLYIRFMTR 122
             E +++ +   +  +LN       L    G+   +A + +  +  +  FL+   ++ +
Sbjct: 67  KKEFIKFIIAMLISYVLNLLMLKTCL--SLGINAYIAQLFAGAAYTVSGFLISKFWVFK 123


>gi|257865353|ref|ZP_05645006.1| dolichol-phosphate mannosyltransferase [Enterococcus casseliflavus
           EC30]
 gi|257871683|ref|ZP_05651336.1| dolichol-phosphate mannosyltransferase [Enterococcus casseliflavus
           EC10]
 gi|325568973|ref|ZP_08145266.1| GtrA family protein [Enterococcus casseliflavus ATCC 12755]
 gi|257799287|gb|EEV28339.1| dolichol-phosphate mannosyltransferase [Enterococcus casseliflavus
           EC30]
 gi|257805847|gb|EEV34669.1| dolichol-phosphate mannosyltransferase [Enterococcus casseliflavus
           EC10]
 gi|325158011|gb|EGC70167.1| GtrA family protein [Enterococcus casseliflavus ATCC 12755]
          Length = 346

 Score = 59.9 bits (144), Expect = 1e-07,   Method: Composition-based stats.
 Identities = 15/124 (12%), Positives = 50/124 (40%), Gaps = 8/124 (6%)

Query: 4   CIIFIINIVVVFFIDVMGFFILMKCGA-----DPFYSRIFSIAVAFLVTWIPSRLFIFLK 58
            + ++ + VV FF+DV+ + +L+   +         + + +  ++ +V +  +R  +F +
Sbjct: 225 FLKYLFSSVVSFFVDVIAYALLIHFLSVIDLSSIVIASLGARLISAIVNYYINRELVFGQ 284

Query: 59  LRRKSFLETVRYGVMYFMLSILNYAFYVKLLLTFQGLQPLLATVLSAVSSMLFVFLLYIR 118
             +      ++Y ++  +  +L+      + L       +L  +        F + +   
Sbjct: 285 RTKN---SMLQYFLLVIVQILLSSFLVYLIYLILPIGDSVLLKIGVDCLLFFFSYHVQKN 341

Query: 119 FMTR 122
            + +
Sbjct: 342 VIFK 345


>gi|161507297|ref|YP_001577251.1| hypothetical protein lhv_2405 [Lactobacillus helveticus DPC 4571]
 gi|160348286|gb|ABX26960.1| hypothetical protein lhv_2405 [Lactobacillus helveticus DPC 4571]
 gi|323466823|gb|ADX70510.1| GtrA-like protein [Lactobacillus helveticus H10]
          Length = 138

 Score = 59.9 bits (144), Expect = 1e-07,   Method: Composition-based stats.
 Identities = 14/126 (11%), Positives = 46/126 (36%), Gaps = 2/126 (1%)

Query: 3   QCIIFIINIVVVFFIDVMGFFILMKCGADPFYSRIFSIAVAFLVTWIPSRLFIFLKLRRK 62
           Q + +++  ++   +D   + IL     +   + I S     +  +  +    F      
Sbjct: 15  QLVKYVLIGILGLVVDFGIYTILTYFKVNVEIANIISSTCGIINNFFWNSYTNFKVHDH- 73

Query: 63  SFLETVRYGVMYFMLSILNYAFYVKLLLTFQGLQPLLATVLSAVSSMLFVFLLYIRFMTR 122
             +  + Y ++  + ++      + + +   G   L+  +++   + L  F++      +
Sbjct: 74  LIVRFISYFLVGQITTVFT-TLSLFIFVNQLGYPHLIVKIVATFVATLIQFIINKIITFK 132

Query: 123 RVYFIK 128
           +V   K
Sbjct: 133 KVRNNK 138


>gi|239813193|ref|YP_002942103.1| GtrA family protein [Variovorax paradoxus S110]
 gi|239799770|gb|ACS16837.1| GtrA family protein [Variovorax paradoxus S110]
          Length = 135

 Score = 59.9 bits (144), Expect = 1e-07,   Method: Composition-based stats.
 Identities = 25/127 (19%), Positives = 48/127 (37%), Gaps = 7/127 (5%)

Query: 2   KQCIIFIINIVVVFFIDVMGFFILMKCGADPFYSRIFSIAVAFLVTWIPSRLFIFLKLR- 60
           ++ + F +  V+   +DV   ++        + +R+ S   A   TW  +R + F   R 
Sbjct: 5   REFLAFAVVGVIGLVVDVAVLYLAAPL-LGWYGARVLSFLAAATTTWALNRRYTFAARRA 63

Query: 61  ----RKSFLETVRYGVMYFMLSILNYAFYVKLLLTFQG-LQPLLATVLSAVSSMLFVFLL 115
                    E + Y       +++NY  YV +L   +G   P L     + + M   FL 
Sbjct: 64  LGAATPIVREYLGYLATMLGGAVVNYGAYVLVLHWLEGPWVPALGVAAGSCAGMAVNFLA 123

Query: 116 YIRFMTR 122
               + +
Sbjct: 124 ARHLVFK 130


>gi|225351228|ref|ZP_03742251.1| hypothetical protein BIFPSEUDO_02820 [Bifidobacterium
           pseudocatenulatum DSM 20438]
 gi|225158684|gb|EEG71926.1| hypothetical protein BIFPSEUDO_02820 [Bifidobacterium
           pseudocatenulatum DSM 20438]
          Length = 178

 Score = 59.9 bits (144), Expect = 1e-07,   Method: Composition-based stats.
 Identities = 16/128 (12%), Positives = 41/128 (32%), Gaps = 13/128 (10%)

Query: 5   IIFIINIVVVFFIDVMGFFILMK-CGADPFYSRIFSIAVAFLVTWIPSRLFIFLKL-RRK 62
           + F +  V+ F ID     +L+         +   S  ++ +  +I S   +F       
Sbjct: 1   MKFGLVGVIAFIIDWGILNLLVGVFRMHNVLAATISFIISLIFNYIASMKLVFKHRDDMA 60

Query: 63  SFLETVRYGVMYFMLSILNYAFYVKLLLTFQGLQPL-----------LATVLSAVSSMLF 111
            ++E + + +   +   +N A              +           +  +++    M++
Sbjct: 61  RWMEILIFVIGALIGLFMNDAIIWISTYGMNHDAYVSQSTEYLIRTNVGKLIATAVVMVW 120

Query: 112 VFLLYIRF 119
            FL     
Sbjct: 121 NFLTRKWL 128


>gi|121592980|ref|YP_984876.1| GtrA family protein [Acidovorax sp. JS42]
 gi|120605060|gb|ABM40800.1| GtrA family protein [Acidovorax sp. JS42]
          Length = 127

 Score = 59.5 bits (143), Expect = 1e-07,   Method: Composition-based stats.
 Identities = 31/124 (25%), Positives = 52/124 (41%), Gaps = 3/124 (2%)

Query: 3   QCIIFIINIVVVFFIDVMGFFILMKCG-ADPFYSRIFSIAVAFLVTWIPSRLFIFLKLRR 61
           + + F +     F +D      +++ G  +PF +R+ S   A   TW  +R F F    +
Sbjct: 4   RLLRFGLVGTAGFVVDAGLLQTMVQWGGVNPFLARLGSFMAAATATWWLNRCFTFRVGSQ 63

Query: 62  KSFLETVRYGVMYFMLSILNYAFYVKLLLTFQGL--QPLLATVLSAVSSMLFVFLLYIRF 119
            S  E +RY     +  ++NY  Y  LLL       QP L     +++ M   +    RF
Sbjct: 64  ASAGEWMRYVTTMVLGGLVNYGAYAALLLWLPLAMRQPWLGVAFGSLAGMAVNYYTSSRF 123

Query: 120 MTRR 123
           +  R
Sbjct: 124 VFAR 127


>gi|296453343|ref|YP_003660486.1| GtrA family protein [Bifidobacterium longum subsp. longum JDM301]
 gi|296182774|gb|ADG99655.1| GtrA family protein [Bifidobacterium longum subsp. longum JDM301]
          Length = 178

 Score = 59.5 bits (143), Expect = 1e-07,   Method: Composition-based stats.
 Identities = 17/128 (13%), Positives = 42/128 (32%), Gaps = 13/128 (10%)

Query: 5   IIFIINIVVVFFIDVMGFFILM-KCGADPFYSRIFSIAVAFLVTWIPSRLFIFLKL-RRK 62
           + F I  V+ F ID     +L+         +   S  ++ +  ++ S  F+F       
Sbjct: 1   MKFGIVGVIAFVIDWGILNLLVGIFHMHNVLAATISFIISLIFNYLASMKFVFKHRDDMA 60

Query: 63  SFLETVRYGVMYFMLSILNYAFYVKLLLTFQGLQPL-----------LATVLSAVSSMLF 111
            ++E + +     +   +N A              +           +  +++    M++
Sbjct: 61  RWMEILIFVAGAVVGLFMNDAIIWISTYGMNHDAYVSQHAEYLLRTNIGKLVATAVVMIW 120

Query: 112 VFLLYIRF 119
            FL+    
Sbjct: 121 NFLIRKWL 128


>gi|241114364|ref|YP_002973839.1| GtrA family protein [Ralstonia pickettii 12D]
 gi|309783185|ref|ZP_07677901.1| GtrA family protein [Ralstonia sp. 5_7_47FAA]
 gi|240868937|gb|ACS66595.1| GtrA family protein [Ralstonia pickettii 12D]
 gi|308918063|gb|EFP63744.1| GtrA family protein [Ralstonia sp. 5_7_47FAA]
          Length = 131

 Score = 59.5 bits (143), Expect = 1e-07,   Method: Composition-based stats.
 Identities = 19/119 (15%), Positives = 48/119 (40%), Gaps = 3/119 (2%)

Query: 3   QCIIFIINIVVVFFIDVMGFFILMKCGADPFYSRIFSIAVAFLVTWIPSRLFIFLKLRRK 62
           +   ++ +  V      +  + L++ G +P      +  V  ++ +  SR ++F    + 
Sbjct: 6   RFYRYLASGGVSTAAHYLTLYALVQMGTEPVLGSTIAALVGLVLNYSVSRRWVFDASAK- 64

Query: 63  SFLETVRYGVMYFMLSILNYAFYVKLLLTFQGLQPLLATVLSAVSSMLFVFLLYIRFMT 121
                 R+ +++ +  ++N   +    L   G   L+A V +    +L  F L+ R+  
Sbjct: 65  IPETLARFALVWMLALLINA--WALASLLALGFHYLVAQVTATGVLVLINFNLHRRWTF 121



 Score = 33.7 bits (76), Expect = 7.5,   Method: Composition-based stats.
 Identities = 9/57 (15%), Positives = 21/57 (36%)

Query: 4   CIIFIINIVVVFFIDVMGFFILMKCGADPFYSRIFSIAVAFLVTWIPSRLFIFLKLR 60
              F +  ++   I+      L+  G     +++ +  V  L+ +   R + F   R
Sbjct: 69  LARFALVWMLALLINAWALASLLALGFHYLVAQVTATGVLVLINFNLHRRWTFSGAR 125


>gi|328882417|emb|CCA55656.1| sugar translocase [Streptomyces venezuelae ATCC 10712]
          Length = 155

 Score = 59.5 bits (143), Expect = 1e-07,   Method: Composition-based stats.
 Identities = 14/119 (11%), Positives = 48/119 (40%), Gaps = 4/119 (3%)

Query: 1   MKQCIIFIINIVVVFFIDVMGFFILMKCGADPFYSRIFSIAVAFLVTWIPSRLFIFLKLR 60
           + +   F +   V         ++L+      F +   +  ++ + ++  +  F +    
Sbjct: 13  LAEIFRFGLVGGVNTGTFFGC-YLLLHPWMPYFAAYSLAFVLSMIGSFFLNTYFTY--RT 69

Query: 61  RKSFLETVRYGVMYFMLSILNYAFYVKLLLTFQGLQPLLATVLSAVSSMLFVFLLYIRF 119
           R ++ +   + +      ++        L+T+ G+   +A +++AV ++ F +++  R 
Sbjct: 70  RPTWKKFALFPLTNVTNYLVQSVGLYA-LVTWAGMDDRIAPLVAAVVAIPFTYVISQRI 127


>gi|46190558|ref|ZP_00121383.2| COG2246: Predicted membrane protein [Bifidobacterium longum DJO10A]
 gi|189440130|ref|YP_001955211.1| hypothetical protein BLD_1268 [Bifidobacterium longum DJO10A]
 gi|227545651|ref|ZP_03975700.1| conserved hypothetical protein [Bifidobacterium longum subsp.
           infantis ATCC 55813]
 gi|239622673|ref|ZP_04665704.1| conserved hypothetical protein [Bifidobacterium longum subsp.
           infantis CCUG 52486]
 gi|322690351|ref|YP_004219921.1| hypothetical protein BLLJ_0159 [Bifidobacterium longum subsp.
           longum JCM 1217]
 gi|189428565|gb|ACD98713.1| Hypothetical membrane protein [Bifidobacterium longum DJO10A]
 gi|227213767|gb|EEI81606.1| conserved hypothetical protein [Bifidobacterium longum subsp.
           infantis ATCC 55813]
 gi|239514670|gb|EEQ54537.1| conserved hypothetical protein [Bifidobacterium longum subsp.
           infantis CCUG 52486]
 gi|291517596|emb|CBK71212.1| Predicted membrane protein [Bifidobacterium longum subsp. longum
           F8]
 gi|320455207|dbj|BAJ65829.1| conserved hypothetical protein [Bifidobacterium longum subsp.
           longum JCM 1217]
          Length = 178

 Score = 59.5 bits (143), Expect = 1e-07,   Method: Composition-based stats.
 Identities = 17/128 (13%), Positives = 42/128 (32%), Gaps = 13/128 (10%)

Query: 5   IIFIINIVVVFFIDVMGFFILM-KCGADPFYSRIFSIAVAFLVTWIPSRLFIFLKL-RRK 62
           + F I  V+ F ID     +L+         +   S  ++ +  ++ S  F+F       
Sbjct: 1   MKFGIVGVIAFVIDWGILNLLVGIFHMHNVLAATVSFIISLIFNYLASMKFVFKHRDDMA 60

Query: 63  SFLETVRYGVMYFMLSILNYAFYVKLLLTFQGLQPL-----------LATVLSAVSSMLF 111
            ++E + +     +   +N A              +           +  +++    M++
Sbjct: 61  RWMEILIFVAGAVVGLFMNDAIIWISTYGMNHDAYVSQHAEYLLRTNIGKLVATAVVMIW 120

Query: 112 VFLLYIRF 119
            FL+    
Sbjct: 121 NFLIRKWL 128


>gi|254442698|ref|ZP_05056174.1| hypothetical protein VDG1235_932 [Verrucomicrobiae bacterium
           DG1235]
 gi|198257006|gb|EDY81314.1| hypothetical protein VDG1235_932 [Verrucomicrobiae bacterium
           DG1235]
          Length = 133

 Score = 59.5 bits (143), Expect = 1e-07,   Method: Composition-based stats.
 Identities = 22/122 (18%), Positives = 44/122 (36%), Gaps = 4/122 (3%)

Query: 3   QCIIFIINIVVVFFIDVMGFFILMKCGA-DPFYSRIFSIAVAFLVTWIPSRLFIFLKLRR 61
           Q   F+I   +   ID   + +L +  A D  +++  S A  F   +   + F F     
Sbjct: 10  QAARFLIVSGISLSIDYGVYALLSELTALDSSWAKRISFACIFFWGYFAHKYFTFKNRGF 69

Query: 62  KSFLETVRYGVMYFMLSILNYAFYVKLLLTFQGLQPLLATVLSAVSSMLFVFLLYIRFMT 121
            +  E  R+ ++Y     +N   +           P  A + +      + F+    F+ 
Sbjct: 70  SAT-EPARFALLYLSGWAINSVVHDYASTHPGASTP--AFLAATFVWACWNFIGQKFFVF 126

Query: 122 RR 123
           R+
Sbjct: 127 RK 128


>gi|225570155|ref|ZP_03779180.1| hypothetical protein CLOHYLEM_06251 [Clostridium hylemonae DSM
           15053]
 gi|225160950|gb|EEG73569.1| hypothetical protein CLOHYLEM_06251 [Clostridium hylemonae DSM
           15053]
          Length = 172

 Score = 59.5 bits (143), Expect = 1e-07,   Method: Composition-based stats.
 Identities = 17/133 (12%), Positives = 51/133 (38%), Gaps = 10/133 (7%)

Query: 1   MKQCIIFIINIVVVFFIDVMGFFILMKCGA--------DPFYSRIFSIAVAFLVTWIPSR 52
           ++Q I F I       I    +  ++            D   ++  + +++ L ++  +R
Sbjct: 37  IEQFIRFGIVGFSNTIISYSIYAAILLFLQKNKLIPRIDYILAQFIAFSLSVLWSFYWNR 96

Query: 53  LFIFLKLRRKSF--LETVRYGVMYFMLSILNYAFYVKLLLTFQGLQPLLATVLSAVSSML 110
             +F       F     ++  + Y    I+  +    + +   G+  ++A +++ + S+ 
Sbjct: 97  KCVFNAENENIFWPRALLKTYISYGFTGIVLNSILSIVWVRCFGMPKIIAPIINLLISVP 156

Query: 111 FVFLLYIRFMTRR 123
             F+L   +  ++
Sbjct: 157 LNFVLNKFWAFKK 169


>gi|328882845|emb|CCA56084.1| putative integral membrane protein [Streptomyces venezuelae ATCC
           10712]
          Length = 171

 Score = 59.5 bits (143), Expect = 1e-07,   Method: Composition-based stats.
 Identities = 13/96 (13%), Positives = 29/96 (30%), Gaps = 4/96 (4%)

Query: 31  DPFYSRIFSIAVAFLVTWIPSRLFIFLKLRRK-SFLETVRYGVMYFMLSILNYAFYVKLL 89
               + + +  VA +  ++  R F +    +     E   + +   +  ++         
Sbjct: 46  PMVRASLIATVVAIVFNYVGFRYFTYRDRDKSGRTKEMSLFLLFSVVGMVIENGVLYTAT 105

Query: 90  LTFQGLQPLLA---TVLSAVSSMLFVFLLYIRFMTR 122
             F    PL +            LF F  Y  ++ R
Sbjct: 106 YGFGWDGPLASNFFKFFGIGIGTLFRFWSYRTWVFR 141


>gi|15894299|ref|NP_347648.1| hypothetical protein CA_C1012 [Clostridium acetobutylicum ATCC 824]
 gi|15023921|gb|AAK78988.1|AE007616_10 Uncharacterized membrane protein, homolog of YNGA/YWCD B.suntilis
           [Clostridium acetobutylicum ATCC 824]
 gi|325508427|gb|ADZ20063.1| Conserved hypothetical protein [Clostridium acetobutylicum EA 2018]
          Length = 151

 Score = 59.5 bits (143), Expect = 1e-07,   Method: Composition-based stats.
 Identities = 23/126 (18%), Positives = 52/126 (41%), Gaps = 4/126 (3%)

Query: 2   KQCIIFIINIVVVFFIDVMGFFIL-MKCGADPFYSRIFSIAVAFLVTWIPSRLFIFLKLR 60
           K  I F+    +   +D   F I     G +   S+I S +   L +++ ++ + F   R
Sbjct: 18  KHLIKFVCVGCLNTLVDFGMFSIFNSLLGINYIISQIISYSSGTLNSYLFNKFWTFTDTR 77

Query: 61  --RKSFLETVRYGVMYFMLSILNYAFYVKLLLTFQGLQPLLATVLSAVSSMLFVFLLYIR 118
             +K+  E +++ V+      ++       L+         A ++S V + +  FL Y  
Sbjct: 78  TKKKTISEIIQFIVVNAASLGVSLVGLSL-LINNSHFNSFFAKIISMVLAQVVNFLGYRF 136

Query: 119 FMTRRV 124
           ++  ++
Sbjct: 137 WVFGKI 142


>gi|212716782|ref|ZP_03324910.1| hypothetical protein BIFCAT_01721 [Bifidobacterium catenulatum DSM
           16992]
 gi|212660486|gb|EEB21061.1| hypothetical protein BIFCAT_01721 [Bifidobacterium catenulatum DSM
           16992]
          Length = 178

 Score = 59.5 bits (143), Expect = 1e-07,   Method: Composition-based stats.
 Identities = 15/128 (11%), Positives = 41/128 (32%), Gaps = 13/128 (10%)

Query: 5   IIFIINIVVVFFIDVMGFFILMK-CGADPFYSRIFSIAVAFLVTWIPSRLFIFLKL-RRK 62
           + F +  V+ F ID     +L+         +   S  ++ +  ++ S   +F       
Sbjct: 1   MKFGLVGVIAFIIDWGILNLLVGVFRMHNVLAATISFVISLIFNYVASMKLVFKHRDDMA 60

Query: 63  SFLETVRYGVMYFMLSILNYAFYVKLLLTFQGLQPL-----------LATVLSAVSSMLF 111
            ++E + + +   +   +N A              +           +  +++    M++
Sbjct: 61  RWMEILIFVIGALIGLFMNDAIIWISTYGMNHDAYVSQSTEYLIRTNVGKLIATAVVMVW 120

Query: 112 VFLLYIRF 119
            FL     
Sbjct: 121 NFLTRKWL 128


>gi|296139648|ref|YP_003646891.1| glycosyl transferase family 2 [Tsukamurella paurometabola DSM
           20162]
 gi|296027782|gb|ADG78552.1| glycosyl transferase family 2 [Tsukamurella paurometabola DSM
           20162]
          Length = 415

 Score = 59.5 bits (143), Expect = 1e-07,   Method: Composition-based stats.
 Identities = 14/127 (11%), Positives = 41/127 (32%), Gaps = 8/127 (6%)

Query: 1   MKQCIIFIINIVVVFFIDVMGFFILMKCGADPFYSRIFSIAVAFLVTWIPSRLFIFLKLR 60
           + Q   F +  +    +     ++ +        +   ++ +  +     +R F F    
Sbjct: 286 IGQLARFAVVGLAST-VAYAVLYLALHSAIGAQAANFAALLITAVGNIAANRAFTFGVRG 344

Query: 61  RKSFLE-----TVRYGVMYFMLSILNYAFYVKLLLTFQGLQPLLATVLSAVSSMLFVFLL 115
           R+  +       V + V + + +              + LQ L   V++ + + +  F+ 
Sbjct: 345 RRGAMRHHTQGLVVFLVTWALTAGSLALLATAAPAASRELQ-LAVLVIANLVATVLRFVG 403

Query: 116 YIRFMTR 122
               + R
Sbjct: 404 MR-LIFR 409


>gi|163794340|ref|ZP_02188312.1| hypothetical protein BAL199_21774 [alpha proteobacterium BAL199]
 gi|159180508|gb|EDP65029.1| hypothetical protein BAL199_21774 [alpha proteobacterium BAL199]
          Length = 130

 Score = 59.5 bits (143), Expect = 2e-07,   Method: Composition-based stats.
 Identities = 26/123 (21%), Positives = 48/123 (39%), Gaps = 3/123 (2%)

Query: 2   KQCIIFIINIVVVFFIDVMGFFILMKCG-ADPFYSRIFSIAVAFLVTWIPSRLFIFLKLR 60
           +Q + F    +V           L++ G  DP  + +       LV ++ +R  +F   R
Sbjct: 10  RQFVGFATVGMVGLVAHYSALTGLVELGGVDPVVASVIGFLAGALVNYVLNRRLVFRSDR 69

Query: 61  RKSFLETVRYGVMYFMLSILNYAFYVKLLLTFQGLQPLLATVLSAVSSMLFVFLLYIRFM 120
                   R+  +     +LN    + LL+   G+  L+A V+     + + FLL   + 
Sbjct: 70  AHRA-AGPRFFAVAASGLVLN-GLLMTLLVDHLGVFYLVAQVMVTGGLVFWHFLLNKFWT 127

Query: 121 TRR 123
            RR
Sbjct: 128 FRR 130


>gi|257874945|ref|ZP_05654598.1| dolichol-phosphate mannosyltransferase [Enterococcus casseliflavus
           EC20]
 gi|257809111|gb|EEV37931.1| dolichol-phosphate mannosyltransferase [Enterococcus casseliflavus
           EC20]
          Length = 346

 Score = 59.5 bits (143), Expect = 2e-07,   Method: Composition-based stats.
 Identities = 15/124 (12%), Positives = 50/124 (40%), Gaps = 8/124 (6%)

Query: 4   CIIFIINIVVVFFIDVMGFFILMKCGA-----DPFYSRIFSIAVAFLVTWIPSRLFIFLK 58
            + ++ + VV FF+DV+ + +L+   +         + + +  ++ +V +  +R  +F +
Sbjct: 225 FLKYLFSSVVSFFVDVIAYALLIHFLSVIDLSSIVIASLGARLISAIVNYYINRELVFGQ 284

Query: 59  LRRKSFLETVRYGVMYFMLSILNYAFYVKLLLTFQGLQPLLATVLSAVSSMLFVFLLYIR 118
             +      ++Y ++  +  +L+      + L       +L  +        F + +   
Sbjct: 285 RTKN---SMLQYFLLVIVQILLSSFLVYLIYLILPIGDSVLLKIGVDCLLFFFSYHVQKN 341

Query: 119 FMTR 122
            + +
Sbjct: 342 VIFK 345


>gi|302553819|ref|ZP_07306161.1| dolichol-phosphate mannosyltransferase [Streptomyces
           viridochromogenes DSM 40736]
 gi|302471437|gb|EFL34530.1| dolichol-phosphate mannosyltransferase [Streptomyces
           viridochromogenes DSM 40736]
          Length = 397

 Score = 59.5 bits (143), Expect = 2e-07,   Method: Composition-based stats.
 Identities = 19/123 (15%), Positives = 46/123 (37%), Gaps = 3/123 (2%)

Query: 1   MKQCIIFIINIVVVFFIDVMGFFILMKCGADPFYSRIFSIAVAFLVTWIPSRLFIF--LK 58
           + + I F +  +  F  +++G + L   G     + I +  +     ++     +F   +
Sbjct: 256 VARMIGFGLIGLTGFLPNLVGLWALNTLGMHYVPAEILANQLGVAWNFVLIEHLLFRERR 315

Query: 59  LRRKSFLETVRYGVMYFMLSILNYAFYVKLLLTFQGLQPLLATVLSAVSSMLFVFLLYIR 118
             R+ +    R+ ++     +L        +  F  L  L AT L+ V++ +  F     
Sbjct: 316 RHRRWWDRAGRFALLANADLVLRIPLIALFVHQF-HLGVLSATALALVTTFVLRFAGTEA 374

Query: 119 FMT 121
            + 
Sbjct: 375 LVY 377



 Score = 33.7 bits (76), Expect = 8.9,   Method: Composition-based stats.
 Identities = 8/63 (12%), Positives = 21/63 (33%), Gaps = 2/63 (3%)

Query: 59  LRRKSFLETVRYGVMYFMLSILNYAFYVKLLLTFQGLQPLLATVLSAVSSMLFVFLLYIR 118
                    + +G++     + N        L   G+  + A +L+    + + F+L   
Sbjct: 251 RTASPVARMIGFGLIGLTGFLPNLVGLWA--LNTLGMHYVPAEILANQLGVAWNFVLIEH 308

Query: 119 FMT 121
            + 
Sbjct: 309 LLF 311


>gi|163757709|ref|ZP_02164798.1| hypothetical conserved membrane protein [Hoeflea phototrophica
           DFL-43]
 gi|162285211|gb|EDQ35493.1| hypothetical conserved membrane protein [Hoeflea phototrophica
           DFL-43]
          Length = 128

 Score = 59.5 bits (143), Expect = 2e-07,   Method: Composition-based stats.
 Identities = 41/122 (33%), Positives = 67/122 (54%), Gaps = 1/122 (0%)

Query: 1   MKQCIIFIINIVVVFFIDVMGFFILMKCGA-DPFYSRIFSIAVAFLVTWIPSRLFIFLKL 59
           MK+   F+    V F +D+   ++L++    DPF +R  +I  A + ++I +R F F   
Sbjct: 1   MKRLSFFLFAGAVGFVVDMGVLWLLLELKMLDPFTARAPAIGAALVCSYIINRTFTFGAS 60

Query: 60  RRKSFLETVRYGVMYFMLSILNYAFYVKLLLTFQGLQPLLATVLSAVSSMLFVFLLYIRF 119
            R   +E VRYG +  + +++NY+ Y  LLL   GL P LA +  + S+ LF +L Y RF
Sbjct: 61  HRNVAVEGVRYGGVGLVSTLINYSVYSGLLLLLPGLSPYLALIFGSGSATLFAYLGYSRF 120

Query: 120 MT 121
           + 
Sbjct: 121 VF 122


>gi|213965682|ref|ZP_03393875.1| membrane protein [Corynebacterium amycolatum SK46]
 gi|213951633|gb|EEB63022.1| membrane protein [Corynebacterium amycolatum SK46]
          Length = 172

 Score = 59.5 bits (143), Expect = 2e-07,   Method: Composition-based stats.
 Identities = 23/128 (17%), Positives = 49/128 (38%), Gaps = 10/128 (7%)

Query: 3   QCIIFIINIVVVFFIDVMGFFILMKC-GADPFYSRIFSIAVAFLVTWIPSRLFIFLKLRR 61
           Q + FII+ V+   +D    FI++   GA  F+ +        +  +I +  + F    +
Sbjct: 45  QMMRFIISGVIAAVVDFGLTFIMLNLFGATNFWGKTVGWVFGTITAYIINSRWTF--KSK 102

Query: 62  KSFLETVRYGVMYFMLSILNYAFYVK---LLLTFQGLQPLLAT----VLSAVSSMLFVFL 114
            S  + +   V+Y +        +      L+   G     A     V++   + +  F+
Sbjct: 103 SSAKKVLAVAVLYLITYATQVGIFNVLQPWLVESWGWNAQWAQFGAFVVAQGVATVINFI 162

Query: 115 LYIRFMTR 122
           +   F+ R
Sbjct: 163 IQRVFIFR 170


>gi|323139049|ref|ZP_08074108.1| GtrA family protein [Methylocystis sp. ATCC 49242]
 gi|322395709|gb|EFX98251.1| GtrA family protein [Methylocystis sp. ATCC 49242]
          Length = 126

 Score = 59.1 bits (142), Expect = 2e-07,   Method: Composition-based stats.
 Identities = 22/122 (18%), Positives = 41/122 (33%), Gaps = 3/122 (2%)

Query: 2   KQCIIFIINIVVVFFIDVMGFFILMK-CGADPFYSRIFSIAVAFLVTWIPSRLFIFLKLR 60
           +Q   +    V    +       L++  G     + +       +V ++ +R   F   R
Sbjct: 5   RQLATYASVGVGATIVHYAILVGLVEGAGWRAVPATLCGYVAGGVVAYMLNRRHTFASDR 64

Query: 61  RKSFLETVRYGVMYFMLSILNYAFYVKLLLTFQGLQPLLATVLSAVSSMLFVFLLYIRFM 120
                   R+ ++ F    L YA      +   G   L A V++ V +M   F L   + 
Sbjct: 65  PHGEATW-RFALVAFAGFCLTYALMSL-FVERWGAPYLPAQVVTTVIAMFMTFALNRAWT 122

Query: 121 TR 122
            R
Sbjct: 123 FR 124


>gi|300853646|ref|YP_003778630.1| hypothetical protein CLJU_c04460 [Clostridium ljungdahlii DSM
           13528]
 gi|300433761|gb|ADK13528.1| putative membrane protein [Clostridium ljungdahlii DSM 13528]
          Length = 139

 Score = 59.1 bits (142), Expect = 2e-07,   Method: Composition-based stats.
 Identities = 21/124 (16%), Positives = 50/124 (40%), Gaps = 4/124 (3%)

Query: 1   MKQCIIFIINIVVVFFIDVMGFFILMK-CGADPFYSRIFSIAVAFLVTWIPSRLFIF--L 57
           +K    F    V+   ID   F +     G     S++   +   + ++I ++ + F   
Sbjct: 16  LKLLSRFSATGVINTIIDFAVFTLCQSVFGLHYTISQVIGYSFGVINSFIFNKKWTFEYK 75

Query: 58  KLRRKSFLETVRYGVMYFMLSILNYAFYVKLLLTFQGLQPLLATVLSAVSSMLFVFLLYI 117
              +K   E  ++ ++  +  I     ++K L+    L   L+ ++  + + +  FLLY 
Sbjct: 76  SSGKKVIREVSQFAIVNLISLISTL-VFMKFLINDFNLNVYLSKIIVTLIAQVINFLLYK 134

Query: 118 RFMT 121
            ++ 
Sbjct: 135 IWVF 138


>gi|320100864|ref|YP_004176456.1| GtrA family protein [Desulfurococcus mucosus DSM 2162]
 gi|319753216|gb|ADV64974.1| GtrA family protein [Desulfurococcus mucosus DSM 2162]
          Length = 247

 Score = 59.1 bits (142), Expect = 2e-07,   Method: Composition-based stats.
 Identities = 10/129 (7%), Positives = 35/129 (27%), Gaps = 9/129 (6%)

Query: 1   MKQCIIFIINIVVVFFIDVMGFFILMKCGADPF-----YSRIFSIAVAFLVTWIPSRLFI 55
           + +   FI        +++    +  +            +       + L  +     + 
Sbjct: 115 VNRVARFIAVGASGVAVNLAVAELSHRLLQGNPLIANPIASTAGFEASVLWNFTLHEEWT 174

Query: 56  FLKLR---RKSFLETVRYGVMYFMLSILNYAFYVKLLLTFQGLQPLLATVLSAVSSMLFV 112
           F       +   +  ++Y +      +    F+  ++  + G    L   +  +      
Sbjct: 175 FKDAGLSSKGRLVRLIKYHLASIASWMSQ-VFFATVMPIYLGTPFWLGQAVGVLVGFTVN 233

Query: 113 FLLYIRFMT 121
           F+L   +  
Sbjct: 234 FILGYIYTW 242


>gi|320531164|ref|ZP_08032155.1| hypothetical protein HMPREF9057_00013 [Actinomyces sp. oral taxon
           171 str. F0337]
 gi|320136633|gb|EFW28590.1| hypothetical protein HMPREF9057_00013 [Actinomyces sp. oral taxon
           171 str. F0337]
          Length = 270

 Score = 59.1 bits (142), Expect = 2e-07,   Method: Composition-based stats.
 Identities = 20/118 (16%), Positives = 44/118 (37%), Gaps = 3/118 (2%)

Query: 4   CIIFIINIVVVFFIDVMGFFILMKCGADPFYSRIFSIAVAFLVTWIPSRLFIFLKLRRKS 63
            + F+   +  F ID +   ++     +   + + +  V+    +  +R  +F   R   
Sbjct: 152 LLRFMGASLASFGIDWLSVMVIFATTGNLLVAVVGARLVSGTANFFMNRR-VFRARRGTV 210

Query: 64  FLETVRYGVMYFMLSILNYAFYVKLLLTFQGLQPLLATVLSAVSSMLFVFLLYIRFMT 121
               VRY V+   L   +Y       LT  G+   +A +L   +  +  ++   R + 
Sbjct: 211 VRTAVRYTVLAVSLLAASYLVLKA--LTTVGIPLGIAKILGDGAIYVASYVAQRRLVF 266


>gi|313203110|ref|YP_004041767.1| gtra family protein [Paludibacter propionicigenes WB4]
 gi|312442426|gb|ADQ78782.1| GtrA family protein [Paludibacter propionicigenes WB4]
          Length = 139

 Score = 59.1 bits (142), Expect = 2e-07,   Method: Composition-based stats.
 Identities = 18/121 (14%), Positives = 49/121 (40%), Gaps = 3/121 (2%)

Query: 3   QCIIFIINIVVVFFIDVMGFFILMK-CGADPFYSRIFSIAVAFLVTWIPSRLFIFLKLRR 61
           + I + +   +   +D+  F+++ K  G +   S I S ++A +  +I +  F F    R
Sbjct: 16  RFIKYGLVGCLGLLVDMAVFYVMNKKLGINYVISNITSSSLAVVHNFILNSYFTFNVTDR 75

Query: 62  KSFLETVRYGVMYFMLSILNYAFYVKLLLTFQGLQPLLATVLSAVSSMLFVFLLYIRFMT 121
           K     + +  +  +   ++    +   +    L  +++ ++S +   L  +    +   
Sbjct: 76  K-LRRFLAFYAIALVGMAVSTGLLIL-FIDLLKLDSMISKLISIIIVALLQYFFNNKLTF 133

Query: 122 R 122
           R
Sbjct: 134 R 134


>gi|182419516|ref|ZP_02950767.1| putative conserved hypothetical protein [Clostridium butyricum
           5521]
 gi|237666305|ref|ZP_04526292.1| GtrA family protein [Clostridium butyricum E4 str. BoNT E BL5262]
 gi|182376646|gb|EDT74219.1| putative conserved hypothetical protein [Clostridium butyricum
           5521]
 gi|237658395|gb|EEP55948.1| GtrA family protein [Clostridium butyricum E4 str. BoNT E BL5262]
          Length = 328

 Score = 59.1 bits (142), Expect = 2e-07,   Method: Composition-based stats.
 Identities = 16/122 (13%), Positives = 46/122 (37%), Gaps = 4/122 (3%)

Query: 2   KQCIIFIINIVVVFFIDVMGFFILMKCGADPFYSRIFSIAVAFLVTWIPSRLFIFLKLRR 61
           K+   F+I   +   I+ + F  +         S +     A  ++++ +   +F +   
Sbjct: 202 KEFFTFLIVGGINT-INGIVFSYVYSLFLGVNVSFVLGYVTAMTISYLLNSTLVFKED-- 258

Query: 62  KSFLETVRYGVMYFMLSILNYAFYVKLLLTFQGLQPLLATVLSAVSSMLFVFLLYIRFMT 121
              ++ +++ + Y    I+    +V +         L+   L+A+  +   F++   F  
Sbjct: 259 MGVIKYIKFCISYIPNFIIQN-IFVLIFYNMLHWNKLIVFALAAIVGVPVTFIIMKFFAF 317

Query: 122 RR 123
            +
Sbjct: 318 NK 319


>gi|296331463|ref|ZP_06873935.1| putative integral inner membrane protein [Bacillus subtilis subsp.
           spizizenii ATCC 6633]
 gi|296151578|gb|EFG92455.1| putative integral inner membrane protein [Bacillus subtilis subsp.
           spizizenii ATCC 6633]
          Length = 134

 Score = 59.1 bits (142), Expect = 2e-07,   Method: Composition-based stats.
 Identities = 17/128 (13%), Positives = 53/128 (41%), Gaps = 5/128 (3%)

Query: 2   KQCIIFIINIVVVFFIDVMGFFILMKC-GADPFYSRIFSIAVAFLVTWIPSRLFIFLKLR 60
           ++ I++II  V    +++  F+IL++    D   + + +  ++ L  +I ++L++F +  
Sbjct: 4   REMIMYIIMGVFTTIVNIASFYILVEIMNMDYKAATVAAWILSVLFAYITNKLYVFQQKT 63

Query: 61  R---KSFLETVRYGVMYFMLSILNYAFYVKLLLTFQGLQPLLATVLSAVSSMLFVFLLYI 117
                   E   +  +  +   ++    + +L+        LA +L     ++  +    
Sbjct: 64  HDLQSLIKEITAFFSVRVLSLGIDLG-MMIILVGQFNTNETLAKILDNAVIVVVNYAASK 122

Query: 118 RFMTRRVY 125
             + ++  
Sbjct: 123 WLVFKKTK 130


>gi|120406568|ref|YP_956397.1| GtrA family protein [Mycobacterium vanbaalenii PYR-1]
 gi|119959386|gb|ABM16391.1| GtrA family protein [Mycobacterium vanbaalenii PYR-1]
          Length = 131

 Score = 59.1 bits (142), Expect = 2e-07,   Method: Composition-based stats.
 Identities = 16/122 (13%), Positives = 44/122 (36%), Gaps = 4/122 (3%)

Query: 3   QCIIFIINIVVVFFIDVMGFFILMKCGADPFYSRIFSIAVAFLVTWIPSRLFIFLKLRRK 62
           Q   F++   +   +D   +  L+  G     ++  S        ++ +R + F     K
Sbjct: 10  QIWRFVVTGGLSAVVDFGLYVALLAAGLHVNIAKTLSFVAGTTTAYLINRRWTFQAAPSK 69

Query: 63  SFLETVRYGVMYFMLSILNYAFYVKLLLTF--QGLQPLLATVLSAVSSMLFVFLLYIRFM 120
           +    +    +Y +   +         + F  Q  +  +A V++  ++ +  F++    +
Sbjct: 70  A--RFIAVVALYAVTYAVQVGINYVFYMEFEDQPWRVPVAFVIAQGTATVINFIVQRAVI 127

Query: 121 TR 122
            R
Sbjct: 128 FR 129


>gi|260461892|ref|ZP_05810137.1| GtrA family protein [Mesorhizobium opportunistum WSM2075]
 gi|259032139|gb|EEW33405.1| GtrA family protein [Mesorhizobium opportunistum WSM2075]
          Length = 151

 Score = 59.1 bits (142), Expect = 2e-07,   Method: Composition-based stats.
 Identities = 14/119 (11%), Positives = 34/119 (28%), Gaps = 1/119 (0%)

Query: 3   QCIIFIINIVVVFFIDVMGFFILMKCGADPFYSRIFSIAVAFLVTWIPSRLFIFLKLRRK 62
           + + F    ++   +        +  G     S     A    + +  +R + F      
Sbjct: 14  RMLRFGAVGLLNTALGYTLILAGLWLGLGDIVSNAAGYAAGLTLGFFLNRRWTFTAAGGF 73

Query: 63  SFLETVRYGVMYFMLSILNYAFYVKLLLTFQGLQPLLATVLSAVSSMLFVFLLYIRFMT 121
                VRY + + +    N    +  +       P +  +       +  +L   RF+ 
Sbjct: 74  RPGTAVRYAITFIVAYSANLGIVIAAMSAGIIENPFV-HLAGNCLYTVIFYLGSSRFVF 131


>gi|153833379|ref|ZP_01986046.1| conserved hypothetical protein [Vibrio harveyi HY01]
 gi|148870388|gb|EDL69314.1| conserved hypothetical protein [Vibrio harveyi HY01]
          Length = 140

 Score = 59.1 bits (142), Expect = 2e-07,   Method: Composition-based stats.
 Identities = 26/125 (20%), Positives = 54/125 (43%), Gaps = 4/125 (3%)

Query: 1   MKQCIIFIINIVVVFFIDVMGFFILMKC-GADPFYSRIFSIAVAFLVTWIPSRLFIFLKL 59
           +     F +   + F +D + F +L    G +   +R  +   A   TW+ +R   F + 
Sbjct: 13  LSSLKRFALVGGIGFVVDTLIFSLLFHVAGLELMAARSIAFLFAATTTWLGNRRLTFSQA 72

Query: 60  RRK-SFLETVRYGVMYFMLSILNYAFYVKLLLTF--QGLQPLLATVLSAVSSMLFVFLLY 116
            +   F + +++     + ++ N+A +    L F  QG   LLA  L  +  M+  +LL 
Sbjct: 73  DKHNPFYQWLKFMASACISAVPNFATFKGWTLMFGTQGYMVLLALALGILVGMMSNYLLS 132

Query: 117 IRFMT 121
            +++ 
Sbjct: 133 SKWVF 137


>gi|328468673|gb|EGF39663.1| hypothetical protein AAULH_04744 [Lactobacillus helveticus MTCC
           5463]
          Length = 136

 Score = 59.1 bits (142), Expect = 2e-07,   Method: Composition-based stats.
 Identities = 13/121 (10%), Positives = 44/121 (36%), Gaps = 2/121 (1%)

Query: 3   QCIIFIINIVVVFFIDVMGFFILMKCGADPFYSRIFSIAVAFLVTWIPSRLFIFLKLRRK 62
           Q + +++  V+   +D   + IL     +   + I S     +  +  +    F      
Sbjct: 15  QLVKYVLIGVLGLVVDFGIYTILTYFKVNVEIANIISSTCGIINNFFWNSYTNFKVHDH- 73

Query: 63  SFLETVRYGVMYFMLSILNYAFYVKLLLTFQGLQPLLATVLSAVSSMLFVFLLYIRFMTR 122
             +  + Y ++  + ++      + + +   G   L+  +++   + L  F++      +
Sbjct: 74  LIVRFISYFLVGQITTVFT-TLSLFIFVNQLGYPHLIVKIVATFVATLIQFIINKIITFK 132

Query: 123 R 123
           +
Sbjct: 133 K 133


>gi|300869500|ref|ZP_07114082.1| glycosyl transferase family protein [Oscillatoria sp. PCC 6506]
 gi|300332473|emb|CBN59280.1| glycosyl transferase family protein [Oscillatoria sp. PCC 6506]
          Length = 434

 Score = 59.1 bits (142), Expect = 2e-07,   Method: Composition-based stats.
 Identities = 22/130 (16%), Positives = 53/130 (40%), Gaps = 10/130 (7%)

Query: 2   KQCIIFIINIVVVFFIDVM-GFFILMKCGAD----PFYSRIFSIAVAFLVTWIPSRLFIF 56
           ++   F+I   V   I+++  F+++ K G +       + + SI  + L ++   R++++
Sbjct: 8   QKIFKFLIGGGVAATINLLLIFWMIEKLGFNTPVLRNIANVISIEFSLLASFFIYRIWVW 67

Query: 57  LKL----RRKSFLETVRYGVMYFMLSILNYAFYVKLLLTFQGLQPLLATVLSAVSSMLFV 112
                  R   + +   Y +      I    F V  LL +  +   + T++    S    
Sbjct: 68  PGGAWTIREVLWRQIPLYHLSAGTSVIARI-FLVFPLLDWLKINYAVNTLIGVFLSASIN 126

Query: 113 FLLYIRFMTR 122
           +L+  R + +
Sbjct: 127 YLISDRLVFK 136


>gi|315038032|ref|YP_004031600.1| Dolichyl-phosphate beta-D-mannosyltransferase [Lactobacillus
           amylovorus GRL 1112]
 gi|325956484|ref|YP_004291896.1| Dolichyl-phosphate beta-D-mannosyltransferase [Lactobacillus
           acidophilus 30SC]
 gi|312276165|gb|ADQ58805.1| Dolichyl-phosphate beta-D-mannosyltransferase [Lactobacillus
           amylovorus GRL 1112]
 gi|325333049|gb|ADZ06957.1| Dolichyl-phosphate beta-D-mannosyltransferase [Lactobacillus
           acidophilus 30SC]
 gi|327183312|gb|AEA31759.1| Dolichyl-phosphate beta-D-mannosyltransferase [Lactobacillus
           amylovorus GRL 1118]
          Length = 136

 Score = 59.1 bits (142), Expect = 2e-07,   Method: Composition-based stats.
 Identities = 16/122 (13%), Positives = 46/122 (37%), Gaps = 2/122 (1%)

Query: 3   QCIIFIINIVVVFFIDVMGFFILMKCGADPFYSRIFSIAVAFLVTWIPSRLFIFLKLRRK 62
           Q I +++   +   +D   + IL     +   + + S     +  ++ +    F      
Sbjct: 15  QLIKYVLIGFLGLIVDFGVYTILTHFKMNVELANVISSTCGIINNFLWNSYTNFKVHDH- 73

Query: 63  SFLETVRYGVMYFMLSILNYAFYVKLLLTFQGLQPLLATVLSAVSSMLFVFLLYIRFMTR 122
            F+  + Y  +  + ++      + + +T  G   L+  V++   + L  F++      +
Sbjct: 74  LFMRFISYFGVGQITTVFT-TVSLFIFVTRLGYSHLIVKVIATFVATLIQFIVNKTITFK 132

Query: 123 RV 124
           +V
Sbjct: 133 KV 134


>gi|254421284|ref|ZP_05035002.1| GtrA-like protein [Synechococcus sp. PCC 7335]
 gi|196188773|gb|EDX83737.1| GtrA-like protein [Synechococcus sp. PCC 7335]
          Length = 161

 Score = 59.1 bits (142), Expect = 2e-07,   Method: Composition-based stats.
 Identities = 24/147 (16%), Positives = 50/147 (34%), Gaps = 25/147 (17%)

Query: 1   MKQCIIFIINIVVVFFIDVMGFFIL-MKCGADPFYSRIFSIAVAFLVTWIPSRLFIF--- 56
           + + + F I      F+D++ F++L  + G     S + SI  A +  +  +  + F   
Sbjct: 12  LGRLLQFGIVGFSGVFVDLIVFYLLRTEIGMTRSLSILLSIEAAIINNFFWNDAWTFADI 71

Query: 57  ---LKLRRKSFLETVRYGVMYFMLSILNYAFYVKLLL------------------TFQGL 95
               K         +++  +  + ++L Y      LL                       
Sbjct: 72  AQQQKGWPARLQRFLKFHSVCLIGAVLQYLLIEGFLLLPFAQQIPALVSQVAVGKWASAA 131

Query: 96  QPLLATVLSAVSSMLFVFLLYIRFMTR 122
              +A V++     L+ F L +R   R
Sbjct: 132 DEYVAKVIAITLVTLWNFWLNLRLSWR 158


>gi|289578122|ref|YP_003476749.1| GtrA family protein [Thermoanaerobacter italicus Ab9]
 gi|289527835|gb|ADD02187.1| GtrA family protein [Thermoanaerobacter italicus Ab9]
          Length = 139

 Score = 59.1 bits (142), Expect = 2e-07,   Method: Composition-based stats.
 Identities = 20/124 (16%), Positives = 48/124 (38%), Gaps = 4/124 (3%)

Query: 1   MKQCIIFIINIVVVFFIDVMGFFILMKC-GADPFYSRIFSIAVAFLVTWIPSRLFIF--L 57
           +K    F    +    ID   F +  K  G +  +S+    +   + +++ +R + F   
Sbjct: 16  LKHISRFGTVGIANTLIDFFVFTVFYKIIGVNYVFSQAIGYSCGVINSFVFNRKWTFEVK 75

Query: 58  KLRRKSFLETVRYGVMYFMLSILNYAFYVKLLLTFQGLQPLLATVLSAVSSMLFVFLLYI 117
                 F E V++ V   +  ++        L+    L   ++ ++  + + +  FLLY 
Sbjct: 76  NANNNIFWEFVKFLVSNLISLVITMLVIDY-LVKNLQLNVYISKIIVTLIAQVINFLLYK 134

Query: 118 RFMT 121
            ++ 
Sbjct: 135 LWVF 138


>gi|148272203|ref|YP_001221764.1| hypothetical protein CMM_1023 [Clavibacter michiganensis subsp.
           michiganensis NCPPB 382]
 gi|147830133|emb|CAN01062.1| conserved membrane protein [Clavibacter michiganensis subsp.
           michiganensis NCPPB 382]
          Length = 156

 Score = 59.1 bits (142), Expect = 2e-07,   Method: Composition-based stats.
 Identities = 21/123 (17%), Positives = 43/123 (34%), Gaps = 5/123 (4%)

Query: 5   IIFIINIVVVFFID---VMGFFILMKCGADPFYSRIFSIAVAFLVTWIPSRLFIFLKLRR 61
           + F++       +       F++L           + + AV   + +   R  +F     
Sbjct: 30  VAFLLVGGFNTVLGTAWFALFYLLWGHTIPYPLVLVIAWAVQLPIAFTLHRKLVFRVSGN 89

Query: 62  KSFLETVRYGVMYFMLSILNYAFYVKLLLTFQGLQPLLATVLSAVSSMLFVFLLYIRFMT 121
               +  RY ++  M    N      ++ T   LQP++A VL  +   +  +  +  F  
Sbjct: 90  -LLPDFSRYTLVNLMPLFANMLLLPLVVETTP-LQPIVAQVLVTIVITVASYTGHKFFSF 147

Query: 122 RRV 124
           RR 
Sbjct: 148 RRP 150


>gi|325689370|gb|EGD31375.1| dolichyl-phosphate beta-D-mannosyltransferase [Streptococcus
           sanguinis SK115]
 gi|332358221|gb|EGJ36051.1| dolichyl-phosphate beta-D-mannosyltransferase [Streptococcus
           sanguinis SK1056]
          Length = 349

 Score = 59.1 bits (142), Expect = 2e-07,   Method: Composition-based stats.
 Identities = 15/127 (11%), Positives = 44/127 (34%), Gaps = 8/127 (6%)

Query: 2   KQCIIFIINIVVVFFIDVMGFFILMKCGAD------PFYSRIFSIAVAFLVTWIPSRLFI 55
           K    F +  +  F +D + + + +              +   +   + +  +  ++  +
Sbjct: 218 KNIFKFALTSLSSFVVDYIVYALALLFLTAVPISLRILLANGIARVTSSIFNYSTNKKLV 277

Query: 56  FLKLRRKSFLETVRYGVMYFMLSILNYAFYVKLLLTFQGLQPLLATVLSAVSSMLFVFLL 115
           F             Y  +  +L IL+    ++L     GL  L+  ++  +      +++
Sbjct: 278 FKNDD-SILKTGTGYFSLAVVLFILD-TLLIRLFYAVFGLNLLIVKIIVGILLFTVSWMV 335

Query: 116 YIRFMTR 122
             RF+ +
Sbjct: 336 QKRFIFK 342


>gi|294055916|ref|YP_003549574.1| GtrA family protein [Coraliomargarita akajimensis DSM 45221]
 gi|293615249|gb|ADE55404.1| GtrA family protein [Coraliomargarita akajimensis DSM 45221]
          Length = 148

 Score = 59.1 bits (142), Expect = 2e-07,   Method: Composition-based stats.
 Identities = 29/129 (22%), Positives = 51/129 (39%), Gaps = 11/129 (8%)

Query: 4   CIIFIINIVVVFFIDVMGFFILMKCGADPFYSRIFSIAVAFLVTWIPSRLFIFLK--LRR 61
              F I  V +  ID    ++L+    +P  +R+ S+  +    +I +R F F      R
Sbjct: 18  FARFAIVGVSISLIDAGILYLLIAAQFEPHLARVVSLGASVSAGYILNRYFTFHHLETGR 77

Query: 62  KSFLETVRYGVMYFMLSILNYAFYVKLLLTFQGLQ---------PLLATVLSAVSSMLFV 112
             +   +R+  +  + S LN   Y  +LL  Q +          PLL   +  V+ M F 
Sbjct: 78  ALWNSLLRHYSVNSIGSALNIGVYSLVLLIGQHMGGQVAASATLPLLGVWVGGVAGMTFN 137

Query: 113 FLLYIRFMT 121
           F    + + 
Sbjct: 138 FFFSKKLVF 146


>gi|153814634|ref|ZP_01967302.1| hypothetical protein RUMTOR_00849 [Ruminococcus torques ATCC 27756]
 gi|317501152|ref|ZP_07959358.1| GtrA family protein [Lachnospiraceae bacterium 8_1_57FAA]
 gi|331090103|ref|ZP_08338992.1| hypothetical protein HMPREF1025_02575 [Lachnospiraceae bacterium
           3_1_46FAA]
 gi|145848128|gb|EDK25046.1| hypothetical protein RUMTOR_00849 [Ruminococcus torques ATCC 27756]
 gi|316897539|gb|EFV19604.1| GtrA family protein [Lachnospiraceae bacterium 8_1_57FAA]
 gi|330402565|gb|EGG82134.1| hypothetical protein HMPREF1025_02575 [Lachnospiraceae bacterium
           3_1_46FAA]
          Length = 131

 Score = 59.1 bits (142), Expect = 2e-07,   Method: Composition-based stats.
 Identities = 20/122 (16%), Positives = 51/122 (41%), Gaps = 1/122 (0%)

Query: 3   QCIIFIINIVVVFFIDVMGFFILMKC-GADPFYSRIFSIAVAFLVTWIPSRLFIFLKLRR 61
           Q I F       F ID    F+L +  G     S + S   + +  +I S  ++F   + 
Sbjct: 10  QIIKFGFVGGTAFVIDAGLLFLLTEFCGIHYLISGMISFTASVIYNYILSVKWVFDAKKD 69

Query: 62  KSFLETVRYGVMYFMLSILNYAFYVKLLLTFQGLQPLLATVLSAVSSMLFVFLLYIRFMT 121
            +  +     ++  ++ +     ++ L +    +  +L+ +++ V  M++ F+    F+ 
Sbjct: 70  ANKTQEFIVFIVLSVIGLGINQLFMWLFVDMMHIYYMLSKIIATVIVMVYNFITRKIFLE 129

Query: 122 RR 123
           ++
Sbjct: 130 KK 131


>gi|90409286|ref|ZP_01217385.1| membrane protein, GtrA family protein [Psychromonas sp. CNPT3]
 gi|90309606|gb|EAS37792.1| membrane protein, GtrA family protein [Psychromonas sp. CNPT3]
          Length = 596

 Score = 59.1 bits (142), Expect = 2e-07,   Method: Composition-based stats.
 Identities = 26/117 (22%), Positives = 51/117 (43%), Gaps = 3/117 (2%)

Query: 1   MKQCIIFIINIVVVFFIDVMGFFILMKCGADPFYSRIFSIAVAFLVTWIPSRLFIFLKLR 60
           ++Q I F    V+   +  + F I  +  A    S IFS  +  ++++  +R F+F    
Sbjct: 17  LQQKIRFATVGVINTVVAYLAFMIFYELSARYLISSIFSYFIGMIISYALNRTFVF--RS 74

Query: 61  RKSFLETVRYGVMYFMLSILNYAFYVKLLLTFQGLQPLLATVLSAVSSMLFVFLLYI 117
           +K   + + + V+ F    ++    + LL+ +  L   L   L+   SM   +L Y 
Sbjct: 75  KKEKGQFIPFCVVNFTSLAIS-TVTLFLLVHYAMLHVYLGQGLAVCVSMGINYLGYK 130


>gi|332363229|gb|EGJ41014.1| dolichyl-phosphate beta-D-mannosyltransferase [Streptococcus
           sanguinis SK49]
          Length = 349

 Score = 59.1 bits (142), Expect = 2e-07,   Method: Composition-based stats.
 Identities = 15/127 (11%), Positives = 44/127 (34%), Gaps = 8/127 (6%)

Query: 2   KQCIIFIINIVVVFFIDVMGFFILMKCGAD------PFYSRIFSIAVAFLVTWIPSRLFI 55
           K    F +  +  F +D + + + +              +   +   + +  +  ++  +
Sbjct: 218 KNIFKFALTSLSSFVVDYVVYALALLFLVAVPTSLRILLANGIARVTSSIFNYSTNKRMV 277

Query: 56  FLKLRRKSFLETVRYGVMYFMLSILNYAFYVKLLLTFQGLQPLLATVLSAVSSMLFVFLL 115
           F             Y  +  +L IL+    ++L     GL  L+  ++  +      +++
Sbjct: 278 FKNDD-SILKTGTGYFSLAVVLFILD-TLLIRLFYAVFGLNLLIVKIIVGILLFTVSWMV 335

Query: 116 YIRFMTR 122
             RF+ +
Sbjct: 336 QKRFIFK 342


>gi|170695656|ref|ZP_02886799.1| GtrA family protein [Burkholderia graminis C4D1M]
 gi|170139455|gb|EDT07640.1| GtrA family protein [Burkholderia graminis C4D1M]
          Length = 128

 Score = 59.1 bits (142), Expect = 2e-07,   Method: Composition-based stats.
 Identities = 33/124 (26%), Positives = 56/124 (45%), Gaps = 3/124 (2%)

Query: 3   QCIIFIINIVVVFFIDVMGFFILMKCGADPFYSRIFSIAVAFLVTWIPSRLFIFLKLR-R 61
           Q I F +  VV F  D    ++ + CG  PF+ R+ S   A  VTW  +R + F +   R
Sbjct: 5   QFIRFAVAGVVGFAADAGVLYLALACGLGPFFGRVISFLAAVWVTWQINRRYTFRERAER 64

Query: 62  KSFLETVRYGVMYFMLSILNYAFYVKLLLTF--QGLQPLLATVLSAVSSMLFVFLLYIRF 119
            +++E  RY +     + +NYA Y  ++L+       PL+     +V+ M   F     +
Sbjct: 65  SAWVEWWRYLLSMLTGASVNYAAYTLVILSDSRSSWLPLVGVACGSVAGMFVNFFAAKLW 124

Query: 120 MTRR 123
              +
Sbjct: 125 AFPK 128


>gi|118587542|ref|ZP_01544966.1| teichoic acid glycosylation protein [Oenococcus oeni ATCC BAA-1163]
 gi|118431993|gb|EAV38735.1| teichoic acid glycosylation protein [Oenococcus oeni ATCC BAA-1163]
          Length = 151

 Score = 59.1 bits (142), Expect = 2e-07,   Method: Composition-based stats.
 Identities = 21/126 (16%), Positives = 48/126 (38%), Gaps = 5/126 (3%)

Query: 2   KQCIIFIINIVVVFFIDVMGFFILMKCG-ADPFYSRIFSIAVAFLVTWIPSRLFIFLKLR 60
           +  + +II  V  FFI  + F +L +    D   + I +   A + ++  +R ++F    
Sbjct: 13  RSVVNYIIFGVSAFFISFLVFALLEQLTPMDWATANIIAWIAATIFSYYTNRSYVFNSHH 72

Query: 61  R---KSFLETVRYGVMYFMLSILNYAFYVKLLLTFQGLQPLLATVLSAVSSMLFVFLLYI 117
                  +E  R+ V      I          +   G+  L   +++ +  +   +L+  
Sbjct: 73  EKFLSEAIEMARFFVGRGFTLIAEQLILWIG-IQLLGMYSLTVKLIAQIVVITLNYLISK 131

Query: 118 RFMTRR 123
             + R+
Sbjct: 132 FIVFRK 137


>gi|291298329|ref|YP_003509607.1| GtrA family protein [Stackebrandtia nassauensis DSM 44728]
 gi|290567549|gb|ADD40514.1| GtrA family protein [Stackebrandtia nassauensis DSM 44728]
          Length = 160

 Score = 59.1 bits (142), Expect = 2e-07,   Method: Composition-based stats.
 Identities = 20/130 (15%), Positives = 46/130 (35%), Gaps = 11/130 (8%)

Query: 3   QCIIFIINIVVVFFIDVMGFFILMKCG-ADPFYSRIFSIAVAFLVTWIPSRLFIFLKLRR 61
           +   F+    V +  D+  F   +     +   ++ FS  VA  + ++ +R + +    R
Sbjct: 26  EVGKFMGVGAVAYSFDLALFNAAVYLWAWEALPAKTFSTCVAATIAFVGNRFWTWRHRPR 85

Query: 62  KS-FLETVRYGVMYFMLSILNYAFYVKL---------LLTFQGLQPLLATVLSAVSSMLF 111
                E + Y +   +   +N  +             +L       L+A V+   ++  F
Sbjct: 86  SRLHREYLWYFLFNTIGLGINLLWVWAYEWANGIWPSVLDNPIALNLVANVIGVGTAAAF 145

Query: 112 VFLLYIRFMT 121
            F  Y  ++ 
Sbjct: 146 RFYSYRTWVF 155


>gi|29655138|ref|NP_820830.1| GtrA family protein [Coxiella burnetii RSA 493]
 gi|154706078|ref|YP_001423519.1| GtrA family protein [Coxiella burnetii Dugway 5J108-111]
 gi|161831232|ref|YP_001597676.1| GtrA family protein [Coxiella burnetii RSA 331]
 gi|212211882|ref|YP_002302818.1| GtrA family protein [Coxiella burnetii CbuG_Q212]
 gi|29542407|gb|AAO91344.1| GtrA family protein [Coxiella burnetii RSA 493]
 gi|154355364|gb|ABS76826.1| GtrA family protein [Coxiella burnetii Dugway 5J108-111]
 gi|161763099|gb|ABX78741.1| GtrA family protein [Coxiella burnetii RSA 331]
 gi|212010292|gb|ACJ17673.1| GtrA family protein [Coxiella burnetii CbuG_Q212]
          Length = 149

 Score = 59.1 bits (142), Expect = 2e-07,   Method: Composition-based stats.
 Identities = 24/122 (19%), Positives = 49/122 (40%), Gaps = 3/122 (2%)

Query: 4   CIIFIINIVVVFFIDVMGFFILMKCGADPFYSRIFSIAVAFLVTWIPSRLFIFLKLRRKS 63
            I F+   V+   ID+   ++          ++I S  +A  +TW  +R F F     + 
Sbjct: 14  LIRFLTIGVIGLLIDITFLYLFRH-EMGLIPAKILSYVIAVTITWFLNRCFTFRSQDSRR 72

Query: 64  FLETVRYGVMYFMLSILNYAFYVKLLLTFQ--GLQPLLATVLSAVSSMLFVFLLYIRFMT 121
             E +RY  +Y +   ++   +  L+  +      P+ A +++AV      F     F  
Sbjct: 73  VQEWMRYAFIYAITGCIHVLMFTALVYRYPVLHTHPIFALIITAVVIAFINFGFTKYFAF 132

Query: 122 RR 123
           ++
Sbjct: 133 KK 134


>gi|254822489|ref|ZP_05227490.1| hypothetical protein MintA_21321 [Mycobacterium intracellulare ATCC
           13950]
          Length = 140

 Score = 59.1 bits (142), Expect = 2e-07,   Method: Composition-based stats.
 Identities = 16/121 (13%), Positives = 41/121 (33%), Gaps = 1/121 (0%)

Query: 3   QCIIFIINIVVVFFIDVMGFFILMKCGADPF-YSRIFSIAVAFLVTWIPSRLFIFLKLRR 61
           Q   F++   +   +D   + +L K        ++  S  V  +  ++ +R + F     
Sbjct: 18  QVTRFVVTGGLAGIVDFGLYLLLFKAAHVQVDVAKSISFIVGTITAYLINRRWTFQAPPS 77

Query: 62  KSFLETVRYGVMYFMLSILNYAFYVKLLLTFQGLQPLLATVLSAVSSMLFVFLLYIRFMT 121
            +    V           +         L +Q     +A V++  ++ +  F++    + 
Sbjct: 78  TARFVAVMVLYAITFAVQVGLNHLCLAFLHYQAWAIPVAFVIAQGTATVINFVVQRAVIF 137

Query: 122 R 122
           R
Sbjct: 138 R 138


>gi|169350676|ref|ZP_02867614.1| hypothetical protein CLOSPI_01449 [Clostridium spiroforme DSM 1552]
 gi|169292539|gb|EDS74672.1| hypothetical protein CLOSPI_01449 [Clostridium spiroforme DSM 1552]
          Length = 133

 Score = 59.1 bits (142), Expect = 2e-07,   Method: Composition-based stats.
 Identities = 12/122 (9%), Positives = 50/122 (40%), Gaps = 3/122 (2%)

Query: 1   MKQCIIFIINIVVVFFIDVMGFFILMKC-GADPFYSRIFSIAVAFLVTWIPSRLFIFLKL 59
           +K+ I +II       ++ + +++L+K        + + S   A +  +  +R ++F   
Sbjct: 5   LKELISYIIVGGCTTLVNFIIYWLLIKLVHQGWLVANVISWIGAVIFAFFANRQYVFK-S 63

Query: 60  RRKSFLETVRYGVMYFMLSILNYAFYVKLLLTFQGLQPLLATVLSAVSSMLFVFLLYIRF 119
              +  E  ++ ++     ++       + +    L  +++ +  ++ +++  ++     
Sbjct: 64  ENDASKEAYQFFMLRLATLVVESTLL-FIFIQLFSLDEMISKIFVSIVTVVSNYVFCKFR 122

Query: 120 MT 121
           + 
Sbjct: 123 IF 124


>gi|326803831|ref|YP_004321649.1| GtrA-like protein [Aerococcus urinae ACS-120-V-Col10a]
 gi|326651151|gb|AEA01334.1| GtrA-like protein [Aerococcus urinae ACS-120-V-Col10a]
          Length = 126

 Score = 59.1 bits (142), Expect = 2e-07,   Method: Composition-based stats.
 Identities = 19/119 (15%), Positives = 49/119 (41%), Gaps = 3/119 (2%)

Query: 1   MKQCIIFIINIVVVFFIDVMGFFILMKCGADPFYSRIFSIAVAFLVTWIPSRLFIFLK-- 58
           ++Q + FI+   +   +D + F +L+ C      + + +  ++ +  +  S  F+F    
Sbjct: 2   IRQIMRFILVGGLSTLLDFIVFSLLISCQVHYLGANLCAFMLSLVFNYWASMHFVFQSSF 61

Query: 59  LRRKSFLETVRYGVMYFMLSILNYAFYVKLLLTFQGLQPLLATVLSAVSSMLFVFLLYI 117
            + + + E + + V+     ++        L+    L   LA +   +  M++ FL   
Sbjct: 62  SKEERWREFLLFLVLALSGLLIQELILYL-LIEQLSLDAHLAKLAGILVVMVYNFLSRK 119


>gi|21230032|ref|NP_635949.1| hypothetical protein XCC0557 [Xanthomonas campestris pv. campestris
           str. ATCC 33913]
 gi|66769974|ref|YP_244736.1| hypothetical protein XC_3675 [Xanthomonas campestris pv. campestris
           str. 8004]
 gi|21111552|gb|AAM39873.1| conserved hypothetical protein [Xanthomonas campestris pv.
           campestris str. ATCC 33913]
 gi|66575306|gb|AAY50716.1| conserved hypothetical protein [Xanthomonas campestris pv.
           campestris str. 8004]
          Length = 137

 Score = 59.1 bits (142), Expect = 2e-07,   Method: Composition-based stats.
 Identities = 17/123 (13%), Positives = 38/123 (30%), Gaps = 2/123 (1%)

Query: 2   KQCIIFIINIVVVFFIDVMGFFILMKCGADPFYSRIFSIAVAFLVTWIPSRLFIFLKLRR 61
           +Q   F +   +   +D   F      G     + +        + +  +  F F +   
Sbjct: 15  RQGGQFAMIGALQLAVDCGIFIACTAAGMPAVPANLLGRISGATLGFWLNGRFTFAQQGD 74

Query: 62  KS--FLETVRYGVMYFMLSILNYAFYVKLLLTFQGLQPLLATVLSAVSSMLFVFLLYIRF 119
               +    R+ VM+  L++++       +      Q  LA  L      +  F +    
Sbjct: 75  ARLGWQRFARFAVMWLALTVISTWLLSATVDLVGLRQAWLAKPLVEGGLAIVSFFVGRHV 134

Query: 120 MTR 122
           + R
Sbjct: 135 VYR 137


>gi|291455884|ref|ZP_06595274.1| hypothetical membrane protein [Bifidobacterium breve DSM 20213]
 gi|291382293|gb|EFE89811.1| hypothetical membrane protein [Bifidobacterium breve DSM 20213]
          Length = 178

 Score = 58.8 bits (141), Expect = 2e-07,   Method: Composition-based stats.
 Identities = 18/128 (14%), Positives = 42/128 (32%), Gaps = 13/128 (10%)

Query: 5   IIFIINIVVVFFIDVMGFFILMK-CGADPFYSRIFSIAVAFLVTWIPSRLFIFLKL-RRK 62
           + F I  V+ F ID     +L+         +   S  ++ +  ++ S  F+F       
Sbjct: 1   MKFGIVGVIAFVIDWGILNLLVGVFHMHNVLAATISFIISLIFNYLASMKFVFKHRDDMA 60

Query: 63  SFLETVRYGVMYFMLSILNYAFYVKLLLTFQGLQPL-----------LATVLSAVSSMLF 111
            ++E V +     +   +N A              +           +  +++    M++
Sbjct: 61  RWMEIVIFVAGAVVGLFMNDAIIWISTYGMNHDAFVSQHAEYLLRTNVGKLVATAVVMVW 120

Query: 112 VFLLYIRF 119
            FL+    
Sbjct: 121 NFLIRKWL 128


>gi|147677800|ref|YP_001212015.1| hypothetical protein PTH_1465 [Pelotomaculum thermopropionicum SI]
 gi|146273897|dbj|BAF59646.1| predicted membrane protein [Pelotomaculum thermopropionicum SI]
          Length = 142

 Score = 58.8 bits (141), Expect = 2e-07,   Method: Composition-based stats.
 Identities = 24/135 (17%), Positives = 49/135 (36%), Gaps = 8/135 (5%)

Query: 1   MKQCIIFIINIVVVFFIDVMGFFILMKCGA-----DPFYSRIFSIAVAFLVTWIPSRLFI 55
           M Q   F     V  FID   +F+++K            ++ FS     + ++  +R + 
Sbjct: 6   MFQLCKFAAVGCVNTFIDWAVYFVILKIFPAESALFYSAAKAFSYFCGVVNSFFLNRCWT 65

Query: 56  FLK-LRRKSFLETVRYGVMYFMLSILNYAFYVKLLLTFQGLQPLLATVLSAVSSMLFVFL 114
           F       S    V++ ++      +N A     +     +   LA   +   + +F F 
Sbjct: 66  FKGVSDEDSGFRFVKFVLVNTAGVGINSA--SIYMFLIFNMDHALALFFATFIAFIFNFT 123

Query: 115 LYIRFMTRRVYFIKK 129
           L   ++ R+   + K
Sbjct: 124 LNKLWVFRKGKLLAK 138


>gi|300934263|ref|ZP_07149519.1| hypothetical protein CresD4_09344 [Corynebacterium resistens DSM
           45100]
          Length = 145

 Score = 58.8 bits (141), Expect = 2e-07,   Method: Composition-based stats.
 Identities = 23/121 (19%), Positives = 45/121 (37%)

Query: 2   KQCIIFIINIVVVFFIDVMGFFILMKCGADPFYSRIFSIAVAFLVTWIPSRLFIFLKLRR 61
           K+   F++  VV    D     +L+  G   F +R  S  V  +V +  +  + F   R 
Sbjct: 15  KKASTFLLIGVVGALFDYGTRTLLLHLGIPAFTARGCSYIVGSVVAYYLNSFYTFDGNRS 74

Query: 62  KSFLETVRYGVMYFMLSILNYAFYVKLLLTFQGLQPLLATVLSAVSSMLFVFLLYIRFMT 121
            S         ++     + + F V+ L         ++  +S  ++ L  F L   ++ 
Sbjct: 75  ASEKLRAAVVYLFCFAVAVVFDFTVRKLYPDASHILFISWFISQAAATLCNFTLQNFWVF 134

Query: 122 R 122
           R
Sbjct: 135 R 135


>gi|256390049|ref|YP_003111613.1| GtrA family protein [Catenulispora acidiphila DSM 44928]
 gi|256356275|gb|ACU69772.1| GtrA family protein [Catenulispora acidiphila DSM 44928]
          Length = 182

 Score = 58.8 bits (141), Expect = 2e-07,   Method: Composition-based stats.
 Identities = 15/127 (11%), Positives = 45/127 (35%), Gaps = 6/127 (4%)

Query: 1   MKQCIIFIINIVVVFFIDVMGFFI-LMKCGADPFYSRIFSIAVAFLVTWIPSRLFIFLKL 59
           + +   F     V   +++  F + L+   +   ++++ +  VA  V ++ +R + +   
Sbjct: 15  VHELSKFGAVGAVALVVNMGVFNVYLLAAPSKQIFAKVVATVVATCVAYVGNRYWTYKDR 74

Query: 60  RR-KSFLETVRYGVMYFMLSILNYAFYVKLLLTFQ----GLQPLLATVLSAVSSMLFVFL 114
            +     E + + ++  + +++   F                 + +        MLF   
Sbjct: 75  DKIDRHREMLFFFLINGVAAVIEVMFVFISKYGLGQDGTLAVNIASYFFGLPLGMLFRLY 134

Query: 115 LYIRFMT 121
            Y  F+ 
Sbjct: 135 CYRTFVF 141


>gi|165924123|ref|ZP_02219955.1| GtrA family protein [Coxiella burnetii RSA 334]
 gi|165916429|gb|EDR35033.1| GtrA family protein [Coxiella burnetii RSA 334]
          Length = 149

 Score = 58.8 bits (141), Expect = 2e-07,   Method: Composition-based stats.
 Identities = 24/122 (19%), Positives = 49/122 (40%), Gaps = 3/122 (2%)

Query: 4   CIIFIINIVVVFFIDVMGFFILMKCGADPFYSRIFSIAVAFLVTWIPSRLFIFLKLRRKS 63
            I F+   V+   ID+   ++          ++I S  +A  +TW  +R F F     + 
Sbjct: 14  LIRFLTIGVIGLLIDITFLYLFRH-EMGLIPAKILSYLIAVTITWFLNRCFTFRSQDSRR 72

Query: 64  FLETVRYGVMYFMLSILNYAFYVKLLLTFQ--GLQPLLATVLSAVSSMLFVFLLYIRFMT 121
             E +RY  +Y +   ++   +  L+  +      P+ A +++AV      F     F  
Sbjct: 73  VQEWMRYAFIYAITGCIHVLMFTALVYRYPVLHTHPIFALIITAVVIAFINFGFTKYFAF 132

Query: 122 RR 123
           ++
Sbjct: 133 KK 134


>gi|145594665|ref|YP_001158962.1| glycosyl transferase family protein [Salinispora tropica CNB-440]
 gi|145304002|gb|ABP54584.1| glycosyl transferase, family 2 [Salinispora tropica CNB-440]
          Length = 410

 Score = 58.8 bits (141), Expect = 2e-07,   Method: Composition-based stats.
 Identities = 13/121 (10%), Positives = 45/121 (37%), Gaps = 5/121 (4%)

Query: 2   KQCIIFIINIVVVFFIDVMGFFILMKCGADPFYSRIFSIAVAFLVTWIPSRLFIFLKLRR 61
           +Q   F +  V    +  +  ++ ++       + + ++ +  +     +R   F    R
Sbjct: 283 RQLARFAVVGVAST-VAYLLLYVSVRGVLGAQPANLLALLITAVANTAANRRLTFGVTGR 341

Query: 62  ----KSFLETVRYGVMYFMLSILNYAFYVKLLLTFQGLQPLLATVLSAVSSMLFVFLLYI 117
               +  L+ +    +   L+  + A    +++    +  L+  V + +++ +  F+L  
Sbjct: 342 RHAGRHHLQGLVAFGLGLALTSGSLALLHAVVVAPARVVELVVLVAANLAATVLRFVLLR 401

Query: 118 R 118
            
Sbjct: 402 Y 402


>gi|256397930|ref|YP_003119494.1| GtrA family protein [Catenulispora acidiphila DSM 44928]
 gi|256364156|gb|ACU77653.1| GtrA family protein [Catenulispora acidiphila DSM 44928]
          Length = 157

 Score = 58.8 bits (141), Expect = 2e-07,   Method: Composition-based stats.
 Identities = 22/123 (17%), Positives = 48/123 (39%), Gaps = 6/123 (4%)

Query: 4   CIIFIINIVVVFFIDVMGFFILMKCGADPFY-SRIFSIAVAFLVTWIPSRLFIFLKLRRK 62
            + +  +       + +  F+       P + +   +  +AF V +  +R+  F     +
Sbjct: 13  FVRYAFSGGSALVTEEVVLFLTHGLLKFPLWLATGLAYLIAFGVNFSINRMLTFADHGAR 72

Query: 63  ---SFLETVRYGVMYFMLSILNYAFYVKLLLTFQGLQPLLATVLSAVSSMLFVFLLYIRF 119
                 +TVR+ ++  +   +         LT  G+  L+A  LS V   L+ F LY  +
Sbjct: 73  EGAVHKQTVRFALLVSVNLGVTQVLMYS--LTGAGVNYLIAKPLSTVVITLYNFWLYKHW 130

Query: 120 MTR 122
           + +
Sbjct: 131 VFK 133


>gi|33239834|ref|NP_874776.1| hypothetical protein Pro0382 [Prochlorococcus marinus subsp.
           marinus str. CCMP1375]
 gi|33237360|gb|AAP99428.1| Uncharacterized conserved membrane protein [Prochlorococcus marinus
           subsp. marinus str. CCMP1375]
          Length = 125

 Score = 58.8 bits (141), Expect = 2e-07,   Method: Composition-based stats.
 Identities = 14/121 (11%), Positives = 47/121 (38%), Gaps = 3/121 (2%)

Query: 3   QCIIFIINIVVVFFIDVM-GFFILMKCGADPFYSRIFSIAVAFLVTWIPSRLFIFLKLRR 61
           + I ++    +   I              +P  S I    +  + ++I ++ ++F     
Sbjct: 6   ELIKYLAVGFINTCIGYSTILSCETLLKLNPQLSNIIGYLIGIVCSFILNKRYVFRSRGN 65

Query: 62  KSFLETVRYGVMYFMLSILNYAFYVKLLLTFQGLQPLLATVLSAVSSMLFVFLLYIRFMT 121
           K   + +++ + + +   +N +     +L  Q +   +A   + +S  +  ++L   ++ 
Sbjct: 66  KKISQFIKFLLGFLLAYTINLSTL--NILLEQSINSPIAQGFAMLSYTITFYILCKLYIF 123

Query: 122 R 122
           +
Sbjct: 124 K 124


>gi|255523857|ref|ZP_05390821.1| GtrA family protein [Clostridium carboxidivorans P7]
 gi|255512419|gb|EET88695.1| GtrA family protein [Clostridium carboxidivorans P7]
          Length = 1024

 Score = 58.8 bits (141), Expect = 3e-07,   Method: Composition-based stats.
 Identities = 15/116 (12%), Positives = 49/116 (42%), Gaps = 3/116 (2%)

Query: 4   CIIFIINIVVVFFIDVMGFFILMKCGADPFYSRIFSIAVAFLVTWIPSRLFIFLKLRRKS 63
            + F I  V+      + + +L+        S   +  ++ + ++  +  F F    + +
Sbjct: 22  FLRFGIIGVINTVHYYIWYLLLLWVTVPYVVSHTIAFTLSMIGSYFLNCFFTFKV--KPT 79

Query: 64  FLETVRYGVMYFMLSILNYAFYVKLLLTFQGLQPLLATVLSAVSSMLFVFLLYIRF 119
             + ++Y +      +++  F + LL+    + P +A +L+++  +   F++  + 
Sbjct: 80  LKKFIKYPLTTLANYLIS-TFSLVLLVRILKVSPSIAALLASILPIPITFIMTHKI 134


>gi|134096813|ref|YP_001102474.1| GtrA-like protein [Saccharopolyspora erythraea NRRL 2338]
 gi|291005143|ref|ZP_06563116.1| GtrA-like protein [Saccharopolyspora erythraea NRRL 2338]
 gi|133909436|emb|CAL99548.1| GtrA-like protein [Saccharopolyspora erythraea NRRL 2338]
          Length = 149

 Score = 58.8 bits (141), Expect = 3e-07,   Method: Composition-based stats.
 Identities = 20/125 (16%), Positives = 42/125 (33%), Gaps = 5/125 (4%)

Query: 3   QCIIFIINIVVVFFIDVMGF-FILMKCGADPFYSRIFSIAVAFLVTWIPSRLFIFLKLRR 61
           Q I F++       ID   +  +L   G   + S+  S  +    +++ +R F F     
Sbjct: 24  QLIRFVVVGGGCAIIDYGTYMALLAGLGWPAWVSKTISFILGTTASYLINRKFTFSGAGT 83

Query: 62  K----SFLETVRYGVMYFMLSILNYAFYVKLLLTFQGLQPLLATVLSAVSSMLFVFLLYI 117
                          + F +++      + L   +   Q  L  V++     L  F++  
Sbjct: 84  GNAGAKAGAFAVLYTVTFFVNVGTNQLLIWLTSPYANWQFTLIWVVAQGLGTLINFVMLK 143

Query: 118 RFMTR 122
             + R
Sbjct: 144 WVVFR 148


>gi|324994177|gb|EGC26091.1| dolichyl-phosphate beta-D-mannosyltransferase [Streptococcus
           sanguinis SK678]
          Length = 349

 Score = 58.8 bits (141), Expect = 3e-07,   Method: Composition-based stats.
 Identities = 12/127 (9%), Positives = 43/127 (33%), Gaps = 8/127 (6%)

Query: 2   KQCIIFIINIVVVFFIDVMGFFILMKCGAD------PFYSRIFSIAVAFLVTWIPSRLFI 55
           K    F +  +  F +D + + + +   A          +   +   + +  +  ++  +
Sbjct: 218 KNIFKFALTSLSSFVVDYIVYALALLFLASVPTSLRILLANGIARVTSSIFNYSTNKRLV 277

Query: 56  FLKLRRKSFLETVRYGVMYFMLSILNYAFYVKLLLTFQGLQPLLATVLSAVSSMLFVFLL 115
           F          T  + +   +  +      ++L     G+  L+  ++  +      +++
Sbjct: 278 FKNNDSILKTGTGYFSLAAALFILDT--LLIRLFYAVFGINLLIVKIIVGILLFTVSWMV 335

Query: 116 YIRFMTR 122
             RF+ +
Sbjct: 336 QKRFIFK 342


>gi|184201631|ref|YP_001855838.1| hypothetical protein KRH_19850 [Kocuria rhizophila DC2201]
 gi|183581861|dbj|BAG30332.1| hypothetical membrane protein [Kocuria rhizophila DC2201]
          Length = 158

 Score = 58.8 bits (141), Expect = 3e-07,   Method: Composition-based stats.
 Identities = 17/135 (12%), Positives = 49/135 (36%), Gaps = 15/135 (11%)

Query: 2   KQCIIFIINIVVVFFIDVMGFFILMK--CGADPFYSRIFSIAVAFLVTWIPSRLFIFLKL 59
           K+ + F+    + + I +   F+L        P  + + +  +A +V++  ++ + F   
Sbjct: 16  KRQMRFLAVGGICYLITIGINFLLKWTVLEEKPTTALLIATTIASVVSYSLNKRWSFSSR 75

Query: 60  R-RKSFLETVRYGVMYFMLSILNYAFYVK------------LLLTFQGLQPLLATVLSAV 106
             +   +E   + V+  +  ++N                   LL  +    +   +L   
Sbjct: 76  GSKHPGVEAFLFAVVTGIGIVINSVPLYISRYALGFEHPPHSLLFQEVADFVSGPILGTA 135

Query: 107 SSMLFVFLLYIRFMT 121
            +M+F ++     + 
Sbjct: 136 LAMVFRWMAMDLIVF 150


>gi|183602873|ref|ZP_02964233.1| conserved hypothetical membrane protein [Bifidobacterium animalis
           subsp. lactis HN019]
 gi|219682716|ref|YP_002469099.1| GtrA-like protein [Bifidobacterium animalis subsp. lactis AD011]
 gi|241190292|ref|YP_002967686.1| hypothetical protein Balac_0231 [Bifidobacterium animalis subsp.
           lactis Bl-04]
 gi|241195698|ref|YP_002969253.1| hypothetical protein Balat_0231 [Bifidobacterium animalis subsp.
           lactis DSM 10140]
 gi|183217874|gb|EDT88525.1| conserved hypothetical membrane protein [Bifidobacterium animalis
           subsp. lactis HN019]
 gi|219620366|gb|ACL28523.1| GtrA-like protein [Bifidobacterium animalis subsp. lactis AD011]
 gi|240248684|gb|ACS45624.1| hypothetical protein Balac_0231 [Bifidobacterium animalis subsp.
           lactis Bl-04]
 gi|240250252|gb|ACS47191.1| hypothetical protein Balat_0231 [Bifidobacterium animalis subsp.
           lactis DSM 10140]
 gi|289178011|gb|ADC85257.1| Monosaccharide translocase (flippase type) [Bifidobacterium
           animalis subsp. lactis BB-12]
 gi|295793279|gb|ADG32814.1| hypothetical protein BalV_0226 [Bifidobacterium animalis subsp.
           lactis V9]
          Length = 185

 Score = 58.4 bits (140), Expect = 3e-07,   Method: Composition-based stats.
 Identities = 14/132 (10%), Positives = 41/132 (31%), Gaps = 13/132 (9%)

Query: 1   MKQCIIFIINIVVVFFIDVMGFFILMK-CGADPFYSRIFSIAVAFLVTWIPSRLFIFLKL 59
           ++Q + F +   + F ID     +L+         +   S  ++ +  +  S  ++F   
Sbjct: 5   IEQILKFGVVGAIAFIIDWGILNLLVGVFHMHNVIAGTISFFISLVFNYFASMKYVFKHR 64

Query: 60  -RRKSFLETVRYGVMYFMLSILNYAFYVKLLLTFQGLQPL-----------LATVLSAVS 107
                ++E   +     +   LN                +           +  +++ V 
Sbjct: 65  PDMARWMEMAIFLFSSLVGLFLNALIIWLSTYGMNRDAFITQHAEYLLRTNMGKLVATVI 124

Query: 108 SMLFVFLLYIRF 119
             ++ F++    
Sbjct: 125 VAIWNFIIRKWL 136



 Score = 34.1 bits (77), Expect = 6.6,   Method: Composition-based stats.
 Identities = 10/62 (16%), Positives = 32/62 (51%), Gaps = 1/62 (1%)

Query: 61  RKSFLETVRYGVMYFMLSILNYAFYVKLLLTFQGLQPLLATVLSAVSSMLFVFLLYIRFM 120
           RK   + +++GV+  +  I+++      L+    +  ++A  +S   S++F +   ++++
Sbjct: 2   RKLIEQILKFGVVGAIAFIIDWGILNL-LVGVFHMHNVIAGTISFFISLVFNYFASMKYV 60

Query: 121 TR 122
            +
Sbjct: 61  FK 62


>gi|87301980|ref|ZP_01084814.1| putative glycosyl transferase [Synechococcus sp. WH 5701]
 gi|87283548|gb|EAQ75503.1| putative glycosyl transferase [Synechococcus sp. WH 5701]
          Length = 366

 Score = 58.4 bits (140), Expect = 3e-07,   Method: Composition-based stats.
 Identities = 15/123 (12%), Positives = 38/123 (30%), Gaps = 3/123 (2%)

Query: 2   KQCIIFIINIVVVFFIDVMGFFILMK-CGADPFYSRIFSIAVAFLVTWIPSRLFIFLKLR 60
           ++ I F +  +    + ++    LM   G     +   ++ VA    ++ +    F   R
Sbjct: 241 RRAISFALVGLSGVAVQMLVVQALMGGTGLVFKQALPIAVVVAASSNYLINNALTFRFQR 300

Query: 61  RKSFLETVRYGVMYFMLSILNYA--FYVKLLLTFQGLQPLLATVLSAVSSMLFVFLLYIR 118
           ++             + S+   A                 LA +   +   ++ +    R
Sbjct: 301 QQGSALLKGLLKFLLVASLPVLANVGVASTFYNLVSRNTFLAQLAGILVVFVWNYAASSR 360

Query: 119 FMT 121
           F+ 
Sbjct: 361 FVW 363


>gi|153206201|ref|ZP_01945464.1| GtrA family protein [Coxiella burnetii 'MSU Goat Q177']
 gi|212217827|ref|YP_002304614.1| GtrA family protein [Coxiella burnetii CbuK_Q154]
 gi|120577331|gb|EAX33955.1| GtrA family protein [Coxiella burnetii 'MSU Goat Q177']
 gi|212012089|gb|ACJ19469.1| GtrA family protein [Coxiella burnetii CbuK_Q154]
          Length = 149

 Score = 58.4 bits (140), Expect = 3e-07,   Method: Composition-based stats.
 Identities = 24/122 (19%), Positives = 49/122 (40%), Gaps = 3/122 (2%)

Query: 4   CIIFIINIVVVFFIDVMGFFILMKCGADPFYSRIFSIAVAFLVTWIPSRLFIFLKLRRKS 63
            I F+   V+   ID+   ++          ++I S  +A  +TW  +R F F     + 
Sbjct: 14  LIRFLTIGVIGLLIDITFLYLFRH-EMGLIPAKILSYVIAVTITWFLNRCFTFRSQDSRR 72

Query: 64  FLETVRYGVMYFMLSILNYAFYVKLLLTFQ--GLQPLLATVLSAVSSMLFVFLLYIRFMT 121
             E +RY  +Y +   ++   +  L+  +      P+ A +++AV      F     F  
Sbjct: 73  VQEWMRYAFIYAITGCIHVLMFTALVYRYPVFHTHPIFALIITAVVIAFINFGFTKYFAF 132

Query: 122 RR 123
           ++
Sbjct: 133 KK 134


>gi|46562183|ref|YP_009109.1| GtrA family protein, selenocysteine-containing [Desulfovibrio
           vulgaris str. Hildenborough]
 gi|46447720|gb|AAS94386.1| GtrA family protein, selenocysteine-containing [Desulfovibrio
           vulgaris str. Hildenborough]
          Length = 385

 Score = 58.4 bits (140), Expect = 3e-07,   Method: Composition-based stats.
 Identities = 23/120 (19%), Positives = 42/120 (35%), Gaps = 3/120 (2%)

Query: 4   CIIFIINIVVVFFIDVMGFFILMKCGADPFYSRIFSIAVAFLVTWIPSRLFIFLKLRRKS 63
            + F I+ ++ F ID + F       +    S +F+   A    +  +R  +F   RR S
Sbjct: 224 FLRFNISALLTFAIDYLVFGAFFALSSSVGLSIVFARLCAGAFNYTVNREIVFRSTRRHS 283

Query: 64  FLETVRYGVMYFMLSILNYAFYVKLLLTFQGLQPLLATVLSAVSSMLFVFLLYIRFMTRR 123
               +    +  M SI   +      L   G     A +       LF F++    +  +
Sbjct: 284 VTLLLYALTVLLMGSIAYVSIKA---LAASGTNVYAAKIFIECVLFLFSFIIQRELIFTK 340


>gi|296166915|ref|ZP_06849332.1| membrane protein [Mycobacterium parascrofulaceum ATCC BAA-614]
 gi|295897792|gb|EFG77381.1| membrane protein [Mycobacterium parascrofulaceum ATCC BAA-614]
          Length = 142

 Score = 58.4 bits (140), Expect = 3e-07,   Method: Composition-based stats.
 Identities = 17/121 (14%), Positives = 44/121 (36%), Gaps = 1/121 (0%)

Query: 3   QCIIFIINIVVVFFIDVMGFFILMK-CGADPFYSRIFSIAVAFLVTWIPSRLFIFLKLRR 61
           Q   F++   +   +D   + +L +  G     ++  S  V  +  ++ +R + F     
Sbjct: 20  QVTRFVVTGGLAGIVDFGLYLLLYQAVGVQVDLAKATSFVVGTITAYLINRRWTFQAAPS 79

Query: 62  KSFLETVRYGVMYFMLSILNYAFYVKLLLTFQGLQPLLATVLSAVSSMLFVFLLYIRFMT 121
            +    V           +        LL ++G    +A V++  ++ +  F++    + 
Sbjct: 80  TARFVAVMILYGVTFAVQVGLNHLSLALLHYRGWAIPVAFVIAQGTATVINFIVQRAVIF 139

Query: 122 R 122
           R
Sbjct: 140 R 140


>gi|331694094|ref|YP_004330333.1| GtrA family protein [Pseudonocardia dioxanivorans CB1190]
 gi|326948783|gb|AEA22480.1| GtrA family protein [Pseudonocardia dioxanivorans CB1190]
          Length = 146

 Score = 58.4 bits (140), Expect = 3e-07,   Method: Composition-based stats.
 Identities = 19/128 (14%), Positives = 43/128 (33%), Gaps = 4/128 (3%)

Query: 1   MKQCIIFIINIVVVFFIDVMGFFILM-KCGADPFYSRIFSIAVAFLVTWIPSRLFIFLKL 59
           + Q   F+   V    +D   + +L+   G DP  ++  S  +     ++ +R F F + 
Sbjct: 4   VGQLTRFVAVGVASAAVDYGVYQLLLLAVGMDPHVAKGISFILGTTTAYLLNRRFTFTEA 63

Query: 60  RRKSFLETVRYGVMYFMLSILNYAFYVKLLLTFQGLQP--LLATVLSAVSSMLFVFLLYI 117
                     +  +Y     +N       L     +     +A V++   +    F++  
Sbjct: 64  G-GGTGRFAGFVALYATTFAINVGVNALALALLPQMPLRTSVAWVIAQACATAINFVMLR 122

Query: 118 RFMTRRVY 125
             + R   
Sbjct: 123 TVVFRVPK 130


>gi|296241954|ref|YP_003649441.1| GtrA family protein [Thermosphaera aggregans DSM 11486]
 gi|296094538|gb|ADG90489.1| GtrA family protein [Thermosphaera aggregans DSM 11486]
          Length = 255

 Score = 58.4 bits (140), Expect = 3e-07,   Method: Composition-based stats.
 Identities = 15/137 (10%), Positives = 33/137 (24%), Gaps = 14/137 (10%)

Query: 3   QCIIFIINIVVVFFIDVMGFFILMKCGADPFYS--------RIFSIAVAFLVTWIPSRLF 54
           + + FII       +++    ++         +               + L  +I    +
Sbjct: 120 RVLKFIIVGAAGSIVNLAVAQLIFHQLTGIGVADLVKNPFSSFAGFESSVLFNFILHEKW 179

Query: 55  IFLKLR-----RKSFLETVRYGVMYFMLSILNYAFYVKLLLTFQGLQPLLATVLSAVSSM 109
            F         +      V+Y                  L    G+   LA +   +   
Sbjct: 180 TFADASIDRRFKNVIARLVKYHGASIASFSSQI-LLATTLPILLGMVFWLAQLTGIIVGF 238

Query: 110 LFVFLLYIRFMTRRVYF 126
              F+L   +   R   
Sbjct: 239 ALNFILGYMYTWSRSRL 255


>gi|288921838|ref|ZP_06416054.1| Dolichyl-phosphate beta-D-mannosyltransferase [Frankia sp. EUN1f]
 gi|288346816|gb|EFC81129.1| Dolichyl-phosphate beta-D-mannosyltransferase [Frankia sp. EUN1f]
          Length = 477

 Score = 58.4 bits (140), Expect = 3e-07,   Method: Composition-based stats.
 Identities = 7/70 (10%), Positives = 23/70 (32%), Gaps = 1/70 (1%)

Query: 6   IFIINIVVVFFIDVMGFFILMKC-GADPFYSRIFSIAVAFLVTWIPSRLFIFLKLRRKSF 64
            F +  +     ++   ++L    G +   +      VA +  +    L ++    R   
Sbjct: 298 RFALIGISGLLPNLATTWLLHHAAGLNYLVAATVGTQVAIVWNFAGCELLVWHGRERVPL 357

Query: 65  LETVRYGVMY 74
              + + ++ 
Sbjct: 358 RRFLPFLLIN 367


>gi|282899687|ref|ZP_06307651.1| GtrA family protein [Cylindrospermopsis raciborskii CS-505]
 gi|281195566|gb|EFA70499.1| GtrA family protein [Cylindrospermopsis raciborskii CS-505]
          Length = 151

 Score = 58.4 bits (140), Expect = 3e-07,   Method: Composition-based stats.
 Identities = 21/132 (15%), Positives = 52/132 (39%), Gaps = 11/132 (8%)

Query: 1   MKQCIIFIINIVVVFFIDVMGFFILMK-CGADPFYSRIFSIAVAFLVTWIPSRLFIFLK- 58
           + + I F +       +D+ GF+ L    G +   S + S  +A +  +  + ++ F   
Sbjct: 14  ISRLIRFALVGFSGVIVDLGGFYFLHSLLGLNLTPSSMLSTELAIINNFFWNDIWTFGDV 73

Query: 59  --------LRRKSFLETVRYGVMYFMLSILNYAFYVKLLLTFQGLQPLLATVLSAVSSML 110
                             ++ ++  +  ILN +  V  L+    +   LA +++ +  + 
Sbjct: 74  VQKENLVLDNSHRLQRFFKFNLICLLGLILN-SLIVNFLVYKFAINAYLAKLIAIICVIS 132

Query: 111 FVFLLYIRFMTR 122
           + F + +RF  +
Sbjct: 133 WNFGMNMRFNWQ 144


>gi|237740248|ref|ZP_04570729.1| dolichol-phosphate mannosyltransferase [Fusobacterium sp. 2_1_31]
 gi|229422265|gb|EEO37312.1| dolichol-phosphate mannosyltransferase [Fusobacterium sp. 2_1_31]
          Length = 360

 Score = 58.4 bits (140), Expect = 3e-07,   Method: Composition-based stats.
 Identities = 15/129 (11%), Positives = 50/129 (38%), Gaps = 11/129 (8%)

Query: 4   CIIFIINIVVVFFIDVMGFFILMKCGADP---------FYSRIFSIAVAFLVTWIPSRLF 54
            + +I + V  F +D++ F  ++                 + + +  ++    +  ++ F
Sbjct: 233 FLKYIASAVSSFILDILSFKWILALLLAFRNIEGAAVITIATVVARIISSTFNFYLNKKF 292

Query: 55  IFLKLRRKSFLETVRYGVMYFMLSILNYAFYVKLLLTFQGLQPLLATVLSAVSSMLFVFL 114
           +F    + +    ++Y  +  +  +++ AF+V L+            ++      L  + 
Sbjct: 293 VFKYE-KNTKKSLLKYYSLCAVQMLIS-AFFVTLVWKHTKYPETSIKIVVDSILFLLSYF 350

Query: 115 LYIRFMTRR 123
           +  R++ +R
Sbjct: 351 IQQRWVFKR 359


>gi|324990256|gb|EGC22194.1| dolichyl-phosphate beta-D-mannosyltransferase [Streptococcus
           sanguinis SK353]
          Length = 349

 Score = 58.4 bits (140), Expect = 3e-07,   Method: Composition-based stats.
 Identities = 16/127 (12%), Positives = 45/127 (35%), Gaps = 8/127 (6%)

Query: 2   KQCIIFIINIVVVFFIDVMGFFILMKCGAD------PFYSRIFSIAVAFLVTWIPSRLFI 55
           K    F +  +  F +D + + + +   A          +   +   + +  +  ++  +
Sbjct: 218 KNIFKFALTSLSSFVVDYIVYALALLFLAAVPTSLRILLANGIARVTSSIFNYSTNKRLV 277

Query: 56  FLKLRRKSFLETVRYGVMYFMLSILNYAFYVKLLLTFQGLQPLLATVLSAVSSMLFVFLL 115
           F             Y  +  +L IL+    ++L     GL  L+  ++  +      +++
Sbjct: 278 FKNDD-SILKTGTGYFSLAVVLFILD-TLLIRLFYAVFGLNLLIVKIIVGILIFTVSWMV 335

Query: 116 YIRFMTR 122
             RF+ +
Sbjct: 336 QKRFIFK 342


>gi|237653915|ref|YP_002890229.1| GtrA family protein [Thauera sp. MZ1T]
 gi|237625162|gb|ACR01852.1| GtrA family protein [Thauera sp. MZ1T]
          Length = 140

 Score = 58.4 bits (140), Expect = 3e-07,   Method: Composition-based stats.
 Identities = 20/122 (16%), Positives = 44/122 (36%), Gaps = 2/122 (1%)

Query: 1   MKQCIIFIINIVVVFFIDVMGFFILMKCGADPFYSRIFSIAVAFLVTWIPSRLFIFLKLR 60
           + Q + +    +    +  + +  L   G     +      +  + T++ ++ + F    
Sbjct: 7   LGQFVRYATVGLASNVVLYLAYLALTATGVGAKLAMSVLYLLGVVQTFVFNKRWSFRHGG 66

Query: 61  RKSFLETVRYGVMYFMLSILNYAFYVKLLLTFQGLQPLLATVLSAVSSMLFVFLLYIRFM 120
                  VRY + Y    +LN    +  L+   G    L   +S V   + +FLL   ++
Sbjct: 67  MHG-PAFVRYCLSYAAGYLLNLVALMV-LVDRMGHPHQLVQGVSIVVLAILLFLLQKFWV 124

Query: 121 TR 122
            R
Sbjct: 125 FR 126


>gi|323353403|ref|ZP_08087936.1| dolichyl-phosphate beta-D-mannosyltransferase [Streptococcus
           sanguinis VMC66]
 gi|322121349|gb|EFX93112.1| dolichyl-phosphate beta-D-mannosyltransferase [Streptococcus
           sanguinis VMC66]
 gi|325688470|gb|EGD30488.1| dolichyl-phosphate beta-D-mannosyltransferase [Streptococcus
           sanguinis SK72]
          Length = 349

 Score = 58.4 bits (140), Expect = 3e-07,   Method: Composition-based stats.
 Identities = 16/127 (12%), Positives = 45/127 (35%), Gaps = 8/127 (6%)

Query: 2   KQCIIFIINIVVVFFIDVMGFFILMKCGAD------PFYSRIFSIAVAFLVTWIPSRLFI 55
           K    F +  +  F +D + + + +   A          +   +   + +  +  ++  +
Sbjct: 218 KNIFKFALTSLSSFVVDYIVYALALLFLAAVPTSLRILLANGIARVTSSIFNYSTNKRLV 277

Query: 56  FLKLRRKSFLETVRYGVMYFMLSILNYAFYVKLLLTFQGLQPLLATVLSAVSSMLFVFLL 115
           F             Y  +  +L IL+    ++L     GL  L+  ++  +      +++
Sbjct: 278 FKNDD-SILKTGTGYFSLAVVLFILD-TLLIRLFYAVFGLNLLIVKIIVGILLFTVSWMV 335

Query: 116 YIRFMTR 122
             RF+ +
Sbjct: 336 QKRFIFK 342


>gi|300780059|ref|ZP_07089915.1| membrane protein [Corynebacterium genitalium ATCC 33030]
 gi|300534169|gb|EFK55228.1| membrane protein [Corynebacterium genitalium ATCC 33030]
          Length = 152

 Score = 58.4 bits (140), Expect = 3e-07,   Method: Composition-based stats.
 Identities = 17/131 (12%), Positives = 49/131 (37%), Gaps = 5/131 (3%)

Query: 2   KQCIIFIINIVVVFFIDVMGFFILMK-CGADPFYSRIFSIAVAFLVTWIPSRLFIFLKL- 59
           +Q + F+I  +    +D    ++L    G     +++       LV ++ +  F F    
Sbjct: 15  RQLLRFVIIGIFCAMLDFGLTYLLDHSFGFTRVSAKVVGWCFGTLVAYLLNSRFTFQAKI 74

Query: 60  -RRKSFLETVRYGVMYFMLSILNYAF--YVKLLLTFQGLQPLLATVLSAVSSMLFVFLLY 116
             +++    + Y   + +   L +     +  L      +  +A V++   + +  F+L 
Sbjct: 75  TGKRALAVFILYASTFGIQVFLYWITNPPLIALGIEDPWKDFIAFVIAQGVATITNFILQ 134

Query: 117 IRFMTRRVYFI 127
              + ++   +
Sbjct: 135 RVLIFKQPTKV 145


>gi|302545395|ref|ZP_07297737.1| putative dolichol-phosphate mannosyltransferase [Streptomyces
           hygroscopicus ATCC 53653]
 gi|302463013|gb|EFL26106.1| putative dolichol-phosphate mannosyltransferase [Streptomyces
           himastatinicus ATCC 53653]
          Length = 234

 Score = 58.4 bits (140), Expect = 3e-07,   Method: Composition-based stats.
 Identities = 24/124 (19%), Positives = 46/124 (37%), Gaps = 4/124 (3%)

Query: 3   QCIIFIINIVVVFFIDVMGFFILMK-CGADPFYSRIFSIAVAFLVTWIPSRLFIFLKLR- 60
           + + F +     F  ++   ++L    G     + I +     L  ++     +  + R 
Sbjct: 112 RLLAFALIGASGFLPNLAALWLLTGPAGMHYVPAEILANQAGLLWNFVLVDTLLHHRHRA 171

Query: 61  -RKSFLETVRYGVMYFMLSILNYAFYVKLLLTFQGLQPLLATVLSAVSSMLFVFLLYIRF 119
            R        + ++     I      +  L++  GL PL AT LS V+     FLL  + 
Sbjct: 172 ERPRGARLTGFALLGNADLIARIPLTML-LVSTFGLSPLPATALSLVAVFFLRFLLVDKL 230

Query: 120 MTRR 123
           + RR
Sbjct: 231 VYRR 234


>gi|262193746|ref|YP_003264955.1| GtrA family protein [Haliangium ochraceum DSM 14365]
 gi|262077093|gb|ACY13062.1| GtrA family protein [Haliangium ochraceum DSM 14365]
          Length = 184

 Score = 58.4 bits (140), Expect = 3e-07,   Method: Composition-based stats.
 Identities = 14/154 (9%), Positives = 49/154 (31%), Gaps = 34/154 (22%)

Query: 2   KQCIIFIINIVVVFFIDVMGFFILMKCGADPFYSRIFSIAVAFLVTWIPSRLFIFLKLRR 61
           ++ + F I       +++    +L         +   +I ++ L  +  + L+ F  +  
Sbjct: 17  RRFLKFAIVGASGVLVNLGCLALLRALSVQINLASAIAIELSLLSNFAVNYLWTFRDVSG 76

Query: 62  KSFLETVRYGVMYFMLSILNYAFYVKLLLTFQ---------------------------- 93
               + +R+ ++    ++  ++ +V + + +                             
Sbjct: 77  GWLRQALRFHLVCLGGAVFQFSSFVIMNVVWMLLLWSGDARTEYFAGADTMFERWLWRPL 136

Query: 94  ------GLQPLLATVLSAVSSMLFVFLLYIRFMT 121
                 G    L+ ++     M++ +LL   +  
Sbjct: 137 MSPPEVGAWVFLSQLIGIGCGMVWNYLLNFYWTW 170


>gi|157149757|ref|YP_001449639.1| dolichol-phosphate mannosyltransferase [Streptococcus gordonii str.
           Challis substr. CH1]
 gi|157074551|gb|ABV09234.1| Dolichol-phosphate mannosyltransferase [Streptococcus gordonii str.
           Challis substr. CH1]
          Length = 347

 Score = 58.4 bits (140), Expect = 3e-07,   Method: Composition-based stats.
 Identities = 16/127 (12%), Positives = 44/127 (34%), Gaps = 8/127 (6%)

Query: 2   KQCIIFIINIVVVFFIDVMGFFILMKC------GADPFYSRIFSIAVAFLVTWIPSRLFI 55
           K    F ++ +  F +D + + + +              +   +   + +  +  ++  +
Sbjct: 216 KDMFKFALSSLSSFIVDYLVYAVALLFLVAVPTTLRILLANGIARVTSSIFNYSTNKKLV 275

Query: 56  FLKLRRKSFLETVRYGVMYFMLSILNYAFYVKLLLTFQGLQPLLATVLSAVSSMLFVFLL 115
           F             Y  +   L IL+    ++L     G+  LL  +L  +      +L+
Sbjct: 276 FKNED-SIAKTGSGYFGLALGLFILD-TLLIRLFYAVFGINLLLVKILVGILLFSLSWLI 333

Query: 116 YIRFMTR 122
             +F+ +
Sbjct: 334 QKKFIFK 340


>gi|328913898|gb|AEB65494.1| teichoic acid glycosylation protein [Bacillus amyloliquefaciens
           LL3]
          Length = 150

 Score = 58.4 bits (140), Expect = 3e-07,   Method: Composition-based stats.
 Identities = 19/128 (14%), Positives = 56/128 (43%), Gaps = 5/128 (3%)

Query: 2   KQCIIFIINIVVVFFIDVMGFFILMK-CGADPFYSRIFSIAVAFLVTWIPSRLFIFLKLR 60
           ++ +++II  V    ++++ F+IL      D   + + +  ++ L  ++ ++L++F +  
Sbjct: 19  REIMMYIIMGVFTTIVNIVSFYILTSVFQMDYKMATVAAWILSVLFAYVTNKLYVFQQKT 78

Query: 61  ---RKSFLETVRYGVMYFMLSILNYAFYVKLLLTFQGLQPLLATVLSAVSSMLFVFLLYI 117
              R    E   +  +  +   ++ A  + LL++   +   LA +   V  ++  +    
Sbjct: 79  AGMRSLMKELTAFFSVRVLSLGIDLA-MMILLVSQFHMNETLAKIADNVIIVVVNYAASK 137

Query: 118 RFMTRRVY 125
             + R+  
Sbjct: 138 WIVFRKAK 145


>gi|317131261|ref|YP_004090575.1| GtrA family protein [Ethanoligenens harbinense YUAN-3]
 gi|315469240|gb|ADU25844.1| GtrA family protein [Ethanoligenens harbinense YUAN-3]
          Length = 146

 Score = 58.4 bits (140), Expect = 3e-07,   Method: Composition-based stats.
 Identities = 15/122 (12%), Positives = 42/122 (34%), Gaps = 1/122 (0%)

Query: 1   MKQCIIFIINIVVVFFIDVMGFFILMKCGADPFYSRIFSIAVAFLVTWIPSRLFIFLKLR 60
           + Q   F         + +  +++ +   AD   + +   + +    ++ + +F+F    
Sbjct: 18  LYQLAGFCAVGASGLLVMMAAYYLFLAFHADKQVANLAGFSASTAYAYLMNFVFVFQAKT 77

Query: 61  RKSFLETVRYGVMYFMLSILNYAFYVKLLLTFQGLQPLLATVLSAVSSMLFVFLLYIRFM 120
                  V++  +Y  L   +             +  LL  +L+++      FL    ++
Sbjct: 78  VPPKRAAVKFFALYIALYFFSAYMVHV-FTDLLHISVLLIPILNSILITPPSFLGSKYWV 136

Query: 121 TR 122
            R
Sbjct: 137 FR 138


>gi|261252547|ref|ZP_05945120.1| hypothetical protein VIA_002571 [Vibrio orientalis CIP 102891]
 gi|260935938|gb|EEX91927.1| hypothetical protein VIA_002571 [Vibrio orientalis CIP 102891]
          Length = 129

 Score = 58.4 bits (140), Expect = 3e-07,   Method: Composition-based stats.
 Identities = 27/126 (21%), Positives = 54/126 (42%), Gaps = 3/126 (2%)

Query: 3   QCIIFIINIVVVFFIDVMGFFILMKCGADPFY-SRIFSIAVAFLVTWIPSRLFIFLKLRR 61
           +   F +   + F  D   F +       P   SR+ +  VA  VTW  +R F F    R
Sbjct: 4   RLAKFALVGGIGFIADACAFALCFYLLEIPLIGSRLIAFVVAATVTWFGNRTFTFASQDR 63

Query: 62  KSFLETVRYGVMYFMLSILNYAFYVKLLLTFQ--GLQPLLATVLSAVSSMLFVFLLYIRF 119
               + +++  +  + +I N+  +  +LL F   G+ P+ A V+  +  M+  +L    +
Sbjct: 64  ALAKQWLKFMSVACISAIPNFLAFKTILLLFGETGVMPMAALVVGVLVGMVSNYLFSSLW 123

Query: 120 MTRRVY 125
           +  + +
Sbjct: 124 VFNKAH 129


>gi|171741457|ref|ZP_02917264.1| hypothetical protein BIFDEN_00542 [Bifidobacterium dentium ATCC
           27678]
 gi|283455199|ref|YP_003359763.1| hypothetical protein BDP_0259 [Bifidobacterium dentium Bd1]
 gi|306823737|ref|ZP_07457111.1| conserved hypothetical protein [Bifidobacterium dentium ATCC 27679]
 gi|171277071|gb|EDT44732.1| hypothetical protein BIFDEN_00542 [Bifidobacterium dentium ATCC
           27678]
 gi|283101833|gb|ADB08939.1| hypothetical membrane-spanning protein [Bifidobacterium dentium
           Bd1]
 gi|304552735|gb|EFM40648.1| conserved hypothetical protein [Bifidobacterium dentium ATCC 27679]
          Length = 178

 Score = 58.4 bits (140), Expect = 3e-07,   Method: Composition-based stats.
 Identities = 16/128 (12%), Positives = 40/128 (31%), Gaps = 13/128 (10%)

Query: 5   IIFIINIVVVFFIDVMGFFILMK-CGADPFYSRIFSIAVAFLVTWIPSRLFIFLKL-RRK 62
           + F +  V+ F ID     +L+         +   S  ++ +  +  S   +F       
Sbjct: 1   MKFGLVGVIAFVIDWGILNLLVGVFHMHNVIAATISFIISLIFNYTASMKLVFKPRDDMA 60

Query: 63  SFLETVRYGVMYFMLSILNYAFYVKLLLTFQGLQPL-----------LATVLSAVSSMLF 111
            ++E + + V   +  ++N A              +           +  + +    M++
Sbjct: 61  RWMEILIFVVGAVIGLLMNDALIWVSTYGMNHDAFVTQHTEYLIRTNVGKLFATAVVMVW 120

Query: 112 VFLLYIRF 119
            FL     
Sbjct: 121 NFLTRKWL 128


>gi|194016551|ref|ZP_03055165.1| cell wall teichoic acid glycosylation protein GtcA [Bacillus
           pumilus ATCC 7061]
 gi|194012024|gb|EDW21592.1| cell wall teichoic acid glycosylation protein GtcA [Bacillus
           pumilus ATCC 7061]
          Length = 143

 Score = 58.4 bits (140), Expect = 3e-07,   Method: Composition-based stats.
 Identities = 16/128 (12%), Positives = 54/128 (42%), Gaps = 5/128 (3%)

Query: 2   KQCIIFIINIVVVFFIDVMGFFILMK-CGADPFYSRIFSIAVAFLVTWIPSRLFIFLKLR 60
           ++ +++++  V    ++++ F++ ++    D   + + S   A L  +I ++ ++F +  
Sbjct: 13  QEVVMYLVMGVCTTIVNIVSFYLFVEMFSMDYKTATVVSWVFAVLFAYITNKKYVFKQKA 72

Query: 61  R---KSFLETVRYGVMYFMLSILNYAFYVKLLLTFQGLQPLLATVLSAVSSMLFVFLLYI 117
           R       E   +  +  M   ++    +   +T   L   +A +L     ++  ++   
Sbjct: 73  RDTKSLMRELSSFFSVRLMSLGVDLGLMIL-FVTQMALNETVAKILVNFVIVVVNYVASK 131

Query: 118 RFMTRRVY 125
            F+ ++  
Sbjct: 132 WFVFKKTK 139


>gi|156937234|ref|YP_001435030.1| glycosyl transferase family protein [Ignicoccus hospitalis KIN4/I]
 gi|156566218|gb|ABU81623.1| glycosyl transferase, family 2 [Ignicoccus hospitalis KIN4/I]
          Length = 365

 Score = 58.4 bits (140), Expect = 3e-07,   Method: Composition-based stats.
 Identities = 11/121 (9%), Positives = 38/121 (31%), Gaps = 10/121 (8%)

Query: 1   MKQCIIFIINIVVVFFIDVMGFFILMKC-------GADPFYSRIFSIAVAFLVTWIPSRL 53
           + + + F         ++    + + +              + +     + +  ++    
Sbjct: 237 LNRMLTFAAVGASGIVVNEGALYAVYELLGAKSLGALGLAAAGLAGFEASVVYNFLLHER 296

Query: 54  FIFLKLRR-KSFLETVRYGVMYFMLSILNYAFYVKLLLTFQGLQPLLATVLSAVSSMLFV 112
             F   R+       + Y     + +    AF +   LT+ G+  L++ ++  V  +   
Sbjct: 297 VTFKDRRKGSVVKRFLHYEAASVLGAAAQLAFLLG--LTYAGVHYLISNLIGIVVGLGIR 354

Query: 113 F 113
           +
Sbjct: 355 Y 355


>gi|226305937|ref|YP_002765897.1| hypothetical protein RER_24500 [Rhodococcus erythropolis PR4]
 gi|226185054|dbj|BAH33158.1| hypothetical membrane protein [Rhodococcus erythropolis PR4]
          Length = 148

 Score = 58.4 bits (140), Expect = 4e-07,   Method: Composition-based stats.
 Identities = 22/124 (17%), Positives = 42/124 (33%), Gaps = 5/124 (4%)

Query: 3   QCIIFIINIVVVFFIDVMGFFILMKCGAD---PFYSRIFSIAVAFLVTWIPSRLFIFLKL 59
           Q I F I  V    I    F I      +      + I + +++ L+ ++  R  +F   
Sbjct: 21  QPIAFAIVGVANTAIGYGLFVIWSLILDNKDLYQVAVIGAYSISVLIAFVLHRTLVFRVR 80

Query: 60  RRKSFLETVRYGVMYFMLSILNYAFYVKLLLTFQGLQPLLATVLSAVSSMLFVFLLYIRF 119
                 +   + V+     +LN      + ++     PL A  +  +      F  +  F
Sbjct: 81  GH-VARDLGAFIVVNSGGLVLNL-ILGTIAVSILHAPPLPAQAVVMLIVAGVSFFGHRYF 138

Query: 120 MTRR 123
             RR
Sbjct: 139 SFRR 142


>gi|254253066|ref|ZP_04946384.1| hypothetical protein BDAG_02316 [Burkholderia dolosa AUO158]
 gi|124895675|gb|EAY69555.1| hypothetical protein BDAG_02316 [Burkholderia dolosa AUO158]
          Length = 192

 Score = 58.4 bits (140), Expect = 4e-07,   Method: Composition-based stats.
 Identities = 10/127 (7%), Positives = 46/127 (36%), Gaps = 7/127 (5%)

Query: 2   KQCIIFIINIVVVFFIDVMGFFILMKCGADPFYSRIFSIAVAFLVTWIPSRLFIFLKLRR 61
           ++ ++F++       ++     +L         + + +     +  ++ ++LF+F +  +
Sbjct: 63  RKFLLFLLTGGFAAAVNWGSR-MLYNLWMPYSAAIVVAYVTGMITAFVLAKLFVFTESTQ 121

Query: 62  KSFLETVRYGVMYFMLSILNYAF------YVKLLLTFQGLQPLLATVLSAVSSMLFVFLL 115
            +      + ++  +     +        YV   +        +A ++  +  +   ++ 
Sbjct: 122 STGRSAFFFTLVNVVAVFQTWVVSVGLAYYVFPAIGLHWHDRDIAHLVGVIVPVFSSYIG 181

Query: 116 YIRFMTR 122
           + +F  R
Sbjct: 182 HKKFSFR 188


>gi|119897042|ref|YP_932255.1| hypothetical protein azo0751 [Azoarcus sp. BH72]
 gi|119669455|emb|CAL93368.1| conserved hypothetical membrane protein [Azoarcus sp. BH72]
          Length = 133

 Score = 58.0 bits (139), Expect = 4e-07,   Method: Composition-based stats.
 Identities = 25/120 (20%), Positives = 47/120 (39%), Gaps = 3/120 (2%)

Query: 3   QCIIFIINIVVVFFIDVMGFFILMKCG-ADPFYSRIFSIAVAFLVTWIPSRLFIFLKLRR 61
           + + F     V           L++ G ADP    +    +  LV +  +R  +F    R
Sbjct: 8   RFVRFATVGAVGTLAHYSLLLALVEGGGADPVVGSVAGFVLGALVNYGLNRKLVF-ASER 66

Query: 62  KSFLETVRYGVMYFMLSILNYAFYVKLLLTFQGLQPLLATVLSAVSSMLFVFLLYIRFMT 121
                  R+  +  +  + N A  ++LL+   G+Q LLA VL+    M++ +     +  
Sbjct: 67  AHTEALPRFFAVAGLGLVWN-ALLMRLLVHALGMQYLLAQVLTTALLMIWHYGANALWTF 125


>gi|116490487|ref|YP_810031.1| GtcA family membrane protein [Oenococcus oeni PSU-1]
 gi|290889886|ref|ZP_06552973.1| hypothetical protein AWRIB429_0363 [Oenococcus oeni AWRIB429]
 gi|116091212|gb|ABJ56366.1| Conserved membrane protein, GtcA family [Oenococcus oeni PSU-1]
 gi|290480496|gb|EFD89133.1| hypothetical protein AWRIB429_0363 [Oenococcus oeni AWRIB429]
          Length = 151

 Score = 58.0 bits (139), Expect = 4e-07,   Method: Composition-based stats.
 Identities = 21/126 (16%), Positives = 48/126 (38%), Gaps = 5/126 (3%)

Query: 2   KQCIIFIINIVVVFFIDVMGFFILMKCG-ADPFYSRIFSIAVAFLVTWIPSRLFIFLKLR 60
           +  + +II  V  FFI  + F +L +    D   + I +   A + ++  +R ++F    
Sbjct: 13  RSVVNYIIFGVSAFFISFLVFALLEQLTPMDWATANIVAWIAATIFSYYTNRSYVFNSHH 72

Query: 61  R---KSFLETVRYGVMYFMLSILNYAFYVKLLLTFQGLQPLLATVLSAVSSMLFVFLLYI 117
                  +E  R+ V      I          +   G+  L   +++ +  +   +L+  
Sbjct: 73  EKFLSEAIEMARFFVGRGFTLIAEQLILWIG-IQLLGMYSLTVKLIAQIVVITLNYLISK 131

Query: 118 RFMTRR 123
             + R+
Sbjct: 132 FIVFRK 137


>gi|298242872|ref|ZP_06966679.1| GtrA family protein [Ktedonobacter racemifer DSM 44963]
 gi|297555926|gb|EFH89790.1| GtrA family protein [Ktedonobacter racemifer DSM 44963]
          Length = 165

 Score = 58.0 bits (139), Expect = 4e-07,   Method: Composition-based stats.
 Identities = 18/130 (13%), Positives = 44/130 (33%), Gaps = 11/130 (8%)

Query: 3   QCIIFIINIVVVFFIDVMGFFIL-----MKCGADPFYSRIFSIAVAFLVTWIPSRLFIFL 57
           Q + F +   V   +D++    L                + + +     +++ ++ + F 
Sbjct: 32  QVVRFGLVGGVNTGLDLLALNALLLLLPTNRTWLILAYNVVAYSFGAFNSFLLNKYWTFR 91

Query: 58  KLRRKSFLETVRYGVMYFMLSILNYAFYVK------LLLTFQGLQPLLATVLSAVSSMLF 111
             +  S+ E  R+    F+  ++N              +    L   L+ VL+ + S   
Sbjct: 92  NKQSMSWHELTRFACTTFLGMVVNTMLVWVIRTFPHPFVQSITLWTNLSKVLAIIVSASI 151

Query: 112 VFLLYIRFMT 121
            FL    ++ 
Sbjct: 152 SFLGMRLWVF 161


>gi|255531376|ref|YP_003091748.1| GtrA family protein [Pedobacter heparinus DSM 2366]
 gi|255344360|gb|ACU03686.1| GtrA family protein [Pedobacter heparinus DSM 2366]
          Length = 145

 Score = 58.0 bits (139), Expect = 4e-07,   Method: Composition-based stats.
 Identities = 17/120 (14%), Positives = 39/120 (32%), Gaps = 2/120 (1%)

Query: 3   QCIIFIINIVVVFFIDVMGFFILM-KCGADPFYSRIFSIAVAFLVTWIPSRLFIFLKLRR 61
           + I F +   V   +D    ++   K     + +      +A    +  +R + F     
Sbjct: 25  KLIKFGLVGFVGLTVDFSITYLCKEKLRIHKYIASSLGFTIATAANYRLNRYWTFASHEA 84

Query: 62  KSFLETVRYGVMYFMLSILNYAFYVKLLLTFQGLQPLLATVLSAVSSMLFVFLLYIRFMT 121
            S  +  +Y ++  +   L+    + LL         +A   + V   L+ F     +  
Sbjct: 85  ASMTQFGKYFMICLVGLTLSN-ILIYLLNDKLKWDFYVAKASAIVIVSLWNFFANYLYTF 143


>gi|227549570|ref|ZP_03979619.1| membrane protein [Corynebacterium lipophiloflavum DSM 44291]
 gi|227078334|gb|EEI16297.1| membrane protein [Corynebacterium lipophiloflavum DSM 44291]
          Length = 167

 Score = 58.0 bits (139), Expect = 4e-07,   Method: Composition-based stats.
 Identities = 21/126 (16%), Positives = 46/126 (36%), Gaps = 5/126 (3%)

Query: 2   KQCIIFIINIVVVFFIDVMGFFILMKCGA-DPFYSRIFSIAVAFLVTWIPSRLFIFLKL- 59
           +Q + F+I  V    ID    + L +        S++       L+ ++ +  F F    
Sbjct: 14  RQLVPFLIIGVGCAVIDFGITYGLTELSPLSRDLSKVVGWCFGTLIAYVLNSRFAFQAAV 73

Query: 60  RRKSFLETVRYGVMYFMLSILNYAFYVKLLLTFQGLQPL---LATVLSAVSSMLFVFLLY 116
             K     +      F + +L Y    + L+    + P     + V++   + +  F+L 
Sbjct: 74  TVKKAGAVLLLYASTFAVQVLLYNITERPLIALGFVNPWKDATSFVIAQGVATVTNFVLQ 133

Query: 117 IRFMTR 122
            R + +
Sbjct: 134 RRVIFK 139


>gi|197302551|ref|ZP_03167606.1| hypothetical protein RUMLAC_01279 [Ruminococcus lactaris ATCC
           29176]
 gi|197298449|gb|EDY32994.1| hypothetical protein RUMLAC_01279 [Ruminococcus lactaris ATCC
           29176]
          Length = 141

 Score = 58.0 bits (139), Expect = 4e-07,   Method: Composition-based stats.
 Identities = 16/124 (12%), Positives = 41/124 (33%), Gaps = 7/124 (5%)

Query: 5   IIFIINIVVVFFIDVMGFFILMK-CGADPFYSRIFSIAVAFLVTWIPSRLFIFLKLRRKS 63
           + F++  V+   +     F L    G   + S   +  V  +V++  ++ F F   ++  
Sbjct: 14  VKFLLVGVINTLVGTGTMFGLYNCLGCSYWVSSAGNYIVGSIVSYFLNKYFTFKNHQKS- 72

Query: 64  FLETVRYGVMYFMLSILNYAFYVKLLLTFQG-----LQPLLATVLSAVSSMLFVFLLYIR 118
               +++ V      ++ Y     +            Q  +A +      +   +L    
Sbjct: 73  AKTVLKFVVNIAGCYLVAYGLAKPVAAWIFSGFSVKTQENIAMLAGMCIFVGMNYLGQRF 132

Query: 119 FMTR 122
            + R
Sbjct: 133 VVFR 136


>gi|329954873|ref|ZP_08295890.1| GtrA-like protein [Bacteroides clarus YIT 12056]
 gi|328526977|gb|EGF53988.1| GtrA-like protein [Bacteroides clarus YIT 12056]
          Length = 126

 Score = 58.0 bits (139), Expect = 4e-07,   Method: Composition-based stats.
 Identities = 17/121 (14%), Positives = 42/121 (34%), Gaps = 1/121 (0%)

Query: 3   QCIIFIINIVVVFFIDVMGFFILM-KCGADPFYSRIFSIAVAFLVTWIPSRLFIFLKLRR 61
           +   F +   +   I  +  +I+M     +   S + +  +A    +I  + +IF   ++
Sbjct: 6   RICRFAVIGTLNALITAITIWIMMDGLDINYMLSNVTAYILAQTHNFIWCKYWIFPTEKK 65

Query: 62  KSFLETVRYGVMYFMLSILNYAFYVKLLLTFQGLQPLLATVLSAVSSMLFVFLLYIRFMT 121
            +    V    + F ++      ++  L+        LA  L         FL+  +   
Sbjct: 66  SNTWRQVLLFSIAFGMAYCAQFLFLIGLVEGLNCDEYLAQFLGLFVYGGVNFLMNRKVTF 125

Query: 122 R 122
           +
Sbjct: 126 K 126


>gi|226303725|ref|YP_002763683.1| hypothetical protein RER_02360 [Rhodococcus erythropolis PR4]
 gi|226182840|dbj|BAH30944.1| hypothetical membrane protein [Rhodococcus erythropolis PR4]
          Length = 127

 Score = 58.0 bits (139), Expect = 4e-07,   Method: Composition-based stats.
 Identities = 13/120 (10%), Positives = 41/120 (34%)

Query: 3   QCIIFIINIVVVFFIDVMGFFILMKCGADPFYSRIFSIAVAFLVTWIPSRLFIFLKLRRK 62
           Q + F+    +   +D   + +L+  G     ++  S        ++ +R + F     +
Sbjct: 6   QIVRFVATGGLSAVVDYGLYVLLLALGLPRVAAKSLSFVAGTTTAYLINRRWTFKAEPSR 65

Query: 63  SFLETVRYGVMYFMLSILNYAFYVKLLLTFQGLQPLLATVLSAVSSMLFVFLLYIRFMTR 122
           +    V           +     +  +      +  LA V++  ++ +  F++    + +
Sbjct: 66  ARFIAVVALYAVTFAVQVGLNELMVHVFDEHWWRTPLAFVIAQGTATVINFIVQRAVIFK 125


>gi|227496401|ref|ZP_03926689.1| dolichyl-phosphate beta-D-mannosyltransferase [Actinomyces
           urogenitalis DSM 15434]
 gi|226834086|gb|EEH66469.1| dolichyl-phosphate beta-D-mannosyltransferase [Actinomyces
           urogenitalis DSM 15434]
          Length = 371

 Score = 58.0 bits (139), Expect = 4e-07,   Method: Composition-based stats.
 Identities = 19/119 (15%), Positives = 42/119 (35%), Gaps = 4/119 (3%)

Query: 4   CIIFIINIVVVFFIDVMGFFILMKCGADPFYSRIFSIAVAFLVTWIPSRLFIFLKLRRKS 63
            + F    +  F +D +   ++     +   S + +  ++    +  +R     +     
Sbjct: 254 LLRFTAASLASFAVDYLALALVHLLTGNLLVSVVTARIISGTANFFMNRRVF--RATGAL 311

Query: 64  FLETVRYGVMYFMLSILNYAFYVKLLLTFQGLQPLLATVLSAVSSMLFVFLLYIRFMTR 122
                RY  +   L   +YA       T  GL  +LA  ++ V+  L  + +  R + R
Sbjct: 312 GRTAARYVALAVALVAASYAGLWAT--TSIGLPLVLAKPVTDVALYLASYRIQHRVVFR 368


>gi|322375276|ref|ZP_08049789.1| putative glycosyl transferase, group 2 family [Streptococcus sp.
           C300]
 gi|321279539|gb|EFX56579.1| putative glycosyl transferase, group 2 family [Streptococcus sp.
           C300]
          Length = 347

 Score = 58.0 bits (139), Expect = 4e-07,   Method: Composition-based stats.
 Identities = 14/127 (11%), Positives = 47/127 (37%), Gaps = 8/127 (6%)

Query: 2   KQCIIFIINIVVVFFIDVMGFFI------LMKCGADPFYSRIFSIAVAFLVTWIPSRLFI 55
           K  + F ++    F +D + + +       +  G     S   +   + +  +  ++  +
Sbjct: 216 KNILKFALSSFSSFIVDYVVYALSILCLSFIPTGLRVLLSNGLARVTSSIFNFSTNKKLV 275

Query: 56  FLKLRRKSFLETVRYGVMYFMLSILNYAFYVKLLLTFQGLQPLLATVLSAVSSMLFVFLL 115
           F          +  +G+   +   +     ++L  +  G+  L+A ++  +   +  + +
Sbjct: 276 FKNKASSFKTGSGYFGL--AVGLFILDTILIRLFNSSLGVNLLIAKIVVGIMLFILSWTV 333

Query: 116 YIRFMTR 122
             RF+ +
Sbjct: 334 QTRFIFK 340


>gi|293376693|ref|ZP_06622917.1| glycosyltransferase, group 2 family protein [Turicibacter sanguinis
           PC909]
 gi|325842421|ref|ZP_08167680.1| glycosyltransferase, group 2 family protein [Turicibacter sp. HGF1]
 gi|292644684|gb|EFF62770.1| glycosyltransferase, group 2 family protein [Turicibacter sanguinis
           PC909]
 gi|325489649|gb|EGC92012.1| glycosyltransferase, group 2 family protein [Turicibacter sp. HGF1]
          Length = 364

 Score = 58.0 bits (139), Expect = 4e-07,   Method: Composition-based stats.
 Identities = 15/126 (11%), Positives = 46/126 (36%), Gaps = 8/126 (6%)

Query: 4   CIIFIINIVVVFFIDVMGFFILMKCGADP------FYSRIFSIAVAFLVTWIPSRLFIFL 57
            + FI++    F ID+  F + +              + + +  V+ +  ++ ++  +F 
Sbjct: 228 FLKFILSSFASFIIDISFFTLFISILKGMSGLNYIMIATVLARIVSSVANFMVNKNTVFN 287

Query: 58  KLRRKSFLETVRYGVMYFMLSILNYAFYVKLLLTFQGLQPLLATVLSAVSSMLFVFLLYI 117
                     ++Y  +  +  +++    V  L     +  +   ++  V   L  F +  
Sbjct: 288 LKENS-ISTAIKYYCLCIIQMLIS-GVGVTYLFKVSEMNEVGLKLIVDVLLFLLSFQIQR 345

Query: 118 RFMTRR 123
            ++ +R
Sbjct: 346 EWVFKR 351


>gi|117927613|ref|YP_872164.1| GtrA family protein [Acidothermus cellulolyticus 11B]
 gi|117648076|gb|ABK52178.1| GtrA family protein [Acidothermus cellulolyticus 11B]
          Length = 162

 Score = 58.0 bits (139), Expect = 4e-07,   Method: Composition-based stats.
 Identities = 22/130 (16%), Positives = 42/130 (32%), Gaps = 9/130 (6%)

Query: 1   MKQCIIFIINIVVVFFIDVMGFFILMK----CGADPFYSRIFSIAVAFLVTWIPSRLFIF 56
           + +   F +  ++ F +DV  F +L             ++  S A A    +  +R + +
Sbjct: 15  VHEVAKFGVVGLLAFVVDVGLFNVLRGDGGPLHNKVITAKAISTAAAATFAYFANRHWTW 74

Query: 57  LKL-RRKSFLETVRYGVMYFMLSILNYAFYVKLLLTFQ----GLQPLLATVLSAVSSMLF 111
               R     E V + V   +   +  A                  + A  +  V   LF
Sbjct: 75  RHRARTGIRREYVLFFVFNGIGLAIAEACLAISHYGLGFHSKLADNISANGIGLVLGTLF 134

Query: 112 VFLLYIRFMT 121
            F  Y R++ 
Sbjct: 135 RFWSYRRWVF 144


>gi|320530489|ref|ZP_08031547.1| GtrA-like protein [Selenomonas artemidis F0399]
 gi|320137322|gb|EFW29246.1| GtrA-like protein [Selenomonas artemidis F0399]
          Length = 130

 Score = 58.0 bits (139), Expect = 4e-07,   Method: Composition-based stats.
 Identities = 18/121 (14%), Positives = 47/121 (38%), Gaps = 2/121 (1%)

Query: 1   MKQCIIFIINIVVVFFIDVMGFFILM-KCGADPFYSRIFSIAVAFLVTWIPSRLFIFLKL 59
           + + + F++     F +D    ++L    G     S   S  V+  + +    + +F   
Sbjct: 7   LYEVLRFVLVGGACFLLDYGLLYVLTGHLGVYYLVSAGISFTVSVFLNYWLCLVCVFRGA 66

Query: 60  RRKSFLETVRYGVMYFMLSILNYAFYVKLLLTFQGLQPLLATVLSAVSSMLFVFLLYIRF 119
             ++    + +         LN    +  L+    +  ++A +++A   ML+ ++L  R 
Sbjct: 67  AAQTHRAKMLFFGSSIAGLGLNQ-LLMWSLVDLLHIHYMIAKLIAAGIVMLWNYVLKRRA 125

Query: 120 M 120
           +
Sbjct: 126 V 126


>gi|300857362|ref|YP_003782346.1| putative GtrA-like protein [Clostridium ljungdahlii DSM 13528]
 gi|300437477|gb|ADK17244.1| putative GtrA-like protein [Clostridium ljungdahlii DSM 13528]
          Length = 128

 Score = 58.0 bits (139), Expect = 4e-07,   Method: Composition-based stats.
 Identities = 19/120 (15%), Positives = 52/120 (43%), Gaps = 2/120 (1%)

Query: 2   KQCIIFIINIVVVFFIDVMGFFILMKCGADPFYSRIFSIAVAFLVTWIPSRLFIFLKLRR 61
           KQ I +  +  +   I ++ + +L+K   D   S   +        ++ +++++F    R
Sbjct: 10  KQFIKYATSGTLNTIITLVIYNLLIKVNVDYIVSNTMAYIFGVANGFVLNKIWVFKADGR 69

Query: 62  KSFLETVRYGVMYFMLSILNYAFYVKLLLTFQGLQPLLATVLSAVSSMLFVFLLYIRFMT 121
            S L   ++ ++  +  I + A     L+    +  +LA V++ + + +  ++L   +  
Sbjct: 70  VSAL-LTKFVIVNLISLIFSTAIL-FCLINNLYINEILAQVIATIITGIVNYILNKLWTF 127


>gi|296120153|ref|ZP_06838706.1| membrane protein [Corynebacterium ammoniagenes DSM 20306]
 gi|295966845|gb|EFG80117.1| membrane protein [Corynebacterium ammoniagenes DSM 20306]
          Length = 152

 Score = 58.0 bits (139), Expect = 4e-07,   Method: Composition-based stats.
 Identities = 17/134 (12%), Positives = 41/134 (30%), Gaps = 7/134 (5%)

Query: 3   QCIIFIINIVVVFFIDVMGFFILMKCGA--DPFYSRIFSIAVAFLVTWIPSRLFIFLKLR 60
           Q   F I   +   ID    +             +R        L  ++ +R + F    
Sbjct: 18  QSTKFAITGGISAVIDASLTWTFQIALELLGNIAARSVGFVFGTLTAYLLNRRWTFRAQP 77

Query: 61  RKSFLETVRY-----GVMYFMLSILNYAFYVKLLLTFQGLQPLLATVLSAVSSMLFVFLL 115
            K     V         +  ++    + F+   L        ++A +L+  ++ +  F +
Sbjct: 78  SKRRFAMVALTYGITYAINIVIYRWAFPFFDHTLDWNSTASLIVAFILAQGTATVINFFV 137

Query: 116 YIRFMTRRVYFIKK 129
               + R    +++
Sbjct: 138 QRWLIFRNAPKVRE 151


>gi|156975063|ref|YP_001445970.1| hypothetical protein VIBHAR_02789 [Vibrio harveyi ATCC BAA-1116]
 gi|156526657|gb|ABU71743.1| hypothetical protein VIBHAR_02789 [Vibrio harveyi ATCC BAA-1116]
          Length = 134

 Score = 58.0 bits (139), Expect = 4e-07,   Method: Composition-based stats.
 Identities = 25/120 (20%), Positives = 52/120 (43%), Gaps = 4/120 (3%)

Query: 6   IFIINIVVVFFIDVMGFFILMKC-GADPFYSRIFSIAVAFLVTWIPSRLFIFLKLRRK-S 63
            F +   + F +D + F +L    G +   +R  +   A   TW+ +R   F +  +   
Sbjct: 12  RFALVGGIGFVVDTLIFSLLFHVAGLELMVARSIAFLFAATTTWLGNRWLTFSQADKHNP 71

Query: 64  FLETVRYGVMYFMLSILNYAFYVKLLLTF--QGLQPLLATVLSAVSSMLFVFLLYIRFMT 121
           F + +++     + ++ N+A +    L F  QG    LA  L  +  M+  +LL  +++ 
Sbjct: 72  FYQWLKFMASACISAVPNFAAFKGWTLMFGTQGYMVFLALALGILVGMMSNYLLSSKWVF 131


>gi|189465656|ref|ZP_03014441.1| hypothetical protein BACINT_02016 [Bacteroides intestinalis DSM
           17393]
 gi|224539963|ref|ZP_03680502.1| hypothetical protein BACCELL_04875 [Bacteroides cellulosilyticus
           DSM 14838]
 gi|189433920|gb|EDV02905.1| hypothetical protein BACINT_02016 [Bacteroides intestinalis DSM
           17393]
 gi|224518417|gb|EEF87522.1| hypothetical protein BACCELL_04875 [Bacteroides cellulosilyticus
           DSM 14838]
          Length = 129

 Score = 58.0 bits (139), Expect = 4e-07,   Method: Composition-based stats.
 Identities = 20/126 (15%), Positives = 47/126 (37%), Gaps = 6/126 (4%)

Query: 2   KQCIIFIINIVVVFFIDVMGFFILM-KCGADPFYSRIFSIAVAFLVTWIPSRLFIF---- 56
           ++   F +   +   I     +++M +   D   S I +  +A    +I  + +IF    
Sbjct: 5   RRIFRFAVIGTLNALIIAAVIWLMMDELDIDYMLSNITAYVIAQTHNFIWCKHWIFPLDD 64

Query: 57  LKLRRKSFLETVRYGVMYFMLSILNYAFYVKLLLTFQGLQPLLATVLSAVSSMLFVFLLY 116
            + +  ++ + + + + + M  +  + F V  L+        LA  L         F++ 
Sbjct: 65  KEKKSNTWRQVLLFSIAFGMAYLAQFLFLVV-LVEALNCDEYLAQFLGLFIYGGVNFIMN 123

Query: 117 IRFMTR 122
            R   R
Sbjct: 124 RRITFR 129


>gi|331266341|ref|YP_004325971.1| glycosyltransferase, putative [Streptococcus oralis Uo5]
 gi|326683013|emb|CBZ00630.1| glycosyltransferase, putative [Streptococcus oralis Uo5]
          Length = 347

 Score = 58.0 bits (139), Expect = 4e-07,   Method: Composition-based stats.
 Identities = 15/127 (11%), Positives = 47/127 (37%), Gaps = 8/127 (6%)

Query: 2   KQCIIFIINIVVVFFIDVMGFFI------LMKCGADPFYSRIFSIAVAFLVTWIPSRLFI 55
           K  + F ++    F +D + + +       +  G     S   +   + +  +  ++  +
Sbjct: 216 KNILKFALSSFSSFIVDYVVYALSILCLSFIPTGLRVLLSNGLARVTSSIFNFSTNKKLV 275

Query: 56  FLKLRRKSFLETVRYGVMYFMLSILNYAFYVKLLLTFQGLQPLLATVLSAVSSMLFVFLL 115
           F          +  +G+   +   +     ++L  +  G+  L+A +L  +   +  + +
Sbjct: 276 FKNKASSFKTGSGYFGL--AVGLFILDTILIRLFNSGLGVNLLIAKILVGIMLFILSWTV 333

Query: 116 YIRFMTR 122
             RF+ +
Sbjct: 334 QTRFIFK 340


>gi|229817551|ref|ZP_04447833.1| hypothetical protein BIFANG_02814 [Bifidobacterium angulatum DSM
           20098]
 gi|229785340|gb|EEP21454.1| hypothetical protein BIFANG_02814 [Bifidobacterium angulatum DSM
           20098]
          Length = 144

 Score = 58.0 bits (139), Expect = 4e-07,   Method: Composition-based stats.
 Identities = 16/124 (12%), Positives = 40/124 (32%), Gaps = 8/124 (6%)

Query: 2   KQCIIFIINIVVVFFIDVMGFFILMKCGADPFYSRIFSIAVAFLVTWIPSRLFIFLKLRR 61
           +  + +++       ++   F +L         +   +I ++    ++ +R   F     
Sbjct: 26  RTLLPYLMVSATQTLVEFGSFTLLHLLTVPSTIANAVAIVLSASYNFLMNRNVTFKSSSN 85

Query: 62  KSFLETVRYGVMYFMLSILNYAFYVKLLLTFQ---GLQPLLATVLSAVSSMLFVFLLYIR 118
                  R  +++  L   NY F   +L       G   +L   L+      + + L   
Sbjct: 86  -----FTRSVILFITLWAWNYLFGSTMLTWLPQNLGWNAILVKFLTMGCQFAWGYPLCKH 140

Query: 119 FMTR 122
            + R
Sbjct: 141 VIFR 144


>gi|308390306|gb|ADO32604.1| truncated glycosyltransferase [Kitasatospora kifunensis]
          Length = 153

 Score = 58.0 bits (139), Expect = 4e-07,   Method: Composition-based stats.
 Identities = 17/126 (13%), Positives = 48/126 (38%), Gaps = 5/126 (3%)

Query: 2   KQCIIFIINIVVVFFIDVMGFFILMKCGADPFYSRIFSIAVAFLVTWIPSRLFIFLKLRR 61
           +Q   F++  V+     +   +++ +   +P  + + ++AV+ +     +R F F     
Sbjct: 29  RQIPSFLVIGVLSTLFYLG-LYVVARMVVNPQAANLIALAVSAVANTAANRRFTFGITGS 87

Query: 62  ----KSFLETVRYGVMYFMLSILNYAFYVKLLLTFQGLQPLLATVLSAVSSMLFVFLLYI 117
               +  L+     V+   LS    A           +  +   +++   + +  FLL  
Sbjct: 88  EGALRHQLQGAVAFVIGLALSSGVLALLDVAAPHASKVVEVGGLIVANGLATVVRFLLMK 147

Query: 118 RFMTRR 123
            ++ ++
Sbjct: 148 VWVFKK 153


>gi|288957727|ref|YP_003448068.1| protein [Azospirillum sp. B510]
 gi|288910035|dbj|BAI71524.1| protein [Azospirillum sp. B510]
          Length = 140

 Score = 58.0 bits (139), Expect = 4e-07,   Method: Composition-based stats.
 Identities = 22/123 (17%), Positives = 43/123 (34%), Gaps = 3/123 (2%)

Query: 3   QCIIFIINIVVVFFIDVMGFFILMKCGADPFYSRIFSIAVAFLVTWIPSRLFIFLKLRR- 61
           Q   F    ++   +D    +  +  G + F +R+ S   A   TW  +R F F      
Sbjct: 16  QFAKFGAVGIIGLLVDTAVLYGGLALGLEFFAARVPSFLAAATATWALNRAFTFRGATSE 75

Query: 62  KSFLETVRYGVMYFMLSILNYAFYVK--LLLTFQGLQPLLATVLSAVSSMLFVFLLYIRF 119
               +  ++     +  ++NY   V     +      P LA    +++ M F F      
Sbjct: 76  PLHRQWAKFIAANAIGGVVNYGVSVGLESGVRLVADHPFLAVAAGSIAGMFFNFAASKHL 135

Query: 120 MTR 122
           + +
Sbjct: 136 VFK 138


>gi|238916080|ref|YP_002929597.1| hypothetical protein EUBELI_00113 [Eubacterium eligens ATCC 27750]
 gi|238871440|gb|ACR71150.1| Hypothetical protein EUBELI_00113 [Eubacterium eligens ATCC 27750]
          Length = 166

 Score = 58.0 bits (139), Expect = 4e-07,   Method: Composition-based stats.
 Identities = 17/131 (12%), Positives = 55/131 (41%), Gaps = 5/131 (3%)

Query: 2   KQCIIFIINIVVVFFIDVMGFFIL-MKCGADPFYSRIFSIAVAFLVTWIPSRLFIFLKLR 60
           K+ ++++   V+   + +  + +  +  G +   + + S  +A L  +  +R+++F    
Sbjct: 37  KEVLLYLFFGVLTTVVSIGSYALFNVAMGINELIANVISWVLAVLFAFFTNRIWVF-AAP 95

Query: 61  RKSFLETVRYGVMYFMLSILNYA---FYVKLLLTFQGLQPLLATVLSAVSSMLFVFLLYI 117
            K+  E ++  V +    +L        + + +T      +L   ++ V  ++  +++  
Sbjct: 96  TKTVEEFMKQLVSFAGGRVLTLVIEEIILLVFITMLHFNSMLIKFIAQVVVIILNYVISK 155

Query: 118 RFMTRRVYFIK 128
             + R+    K
Sbjct: 156 LLVFRKDKSEK 166


>gi|116494258|ref|YP_805992.1| GtcA family membrane protein [Lactobacillus casei ATCC 334]
 gi|239629640|ref|ZP_04672671.1| conserved hypothetical protein [Lactobacillus paracasei subsp.
           paracasei 8700:2]
 gi|301065764|ref|YP_003787787.1| hypothetical protein LCAZH_0648 [Lactobacillus casei str. Zhang]
 gi|116104408|gb|ABJ69550.1| Conserved membrane protein, GtcA family [Lactobacillus casei ATCC
           334]
 gi|239528326|gb|EEQ67327.1| conserved hypothetical protein [Lactobacillus paracasei subsp.
           paracasei 8700:2]
 gi|300438171|gb|ADK17937.1| Conserved membrane protein, GtcA family [Lactobacillus casei str.
           Zhang]
          Length = 135

 Score = 58.0 bits (139), Expect = 4e-07,   Method: Composition-based stats.
 Identities = 17/122 (13%), Positives = 41/122 (33%), Gaps = 1/122 (0%)

Query: 1   MKQCIIFIINIVVVFFIDVMGFFILMKCGADPFYSRIFSIAVAFLVTWIPSRLFIFLKLR 60
           +KQ I F +   V   +  + +  L +       +      +  +     +  ++F    
Sbjct: 5   LKQFIGFGLVGGVNTILTYLIYLTLYQLINP-TAAMGVGYGLTSIFGLFLNDTWVFKAKD 63

Query: 61  RKSFLETVRYGVMYFMLSILNYAFYVKLLLTFQGLQPLLATVLSAVSSMLFVFLLYIRFM 120
           R+          + + L+ +           F  L   LA + + + ++   FLL   ++
Sbjct: 64  RRQLKTVAPRYYLSYGLTFILSLVLTSFWNDFLRLPKPLAPMFALMITVPTNFLLSKFWV 123

Query: 121 TR 122
            R
Sbjct: 124 FR 125


>gi|324992084|gb|EGC24006.1| dolichyl-phosphate beta-D-mannosyltransferase [Streptococcus
           sanguinis SK405]
 gi|332364685|gb|EGJ42454.1| dolichyl-phosphate beta-D-mannosyltransferase [Streptococcus
           sanguinis SK1059]
          Length = 349

 Score = 58.0 bits (139), Expect = 4e-07,   Method: Composition-based stats.
 Identities = 15/127 (11%), Positives = 44/127 (34%), Gaps = 8/127 (6%)

Query: 2   KQCIIFIINIVVVFFIDVMGFFILMKCGAD------PFYSRIFSIAVAFLVTWIPSRLFI 55
           K    F +  +  F +D + + + +              +   +   + +  +  ++  +
Sbjct: 218 KNIFKFALTSLSSFVVDYVVYALALLFLVAVPTSLRILLANGIARVTSSIFNYSTNKRLV 277

Query: 56  FLKLRRKSFLETVRYGVMYFMLSILNYAFYVKLLLTFQGLQPLLATVLSAVSSMLFVFLL 115
           F             Y  +  +L IL+    ++L     GL  L+  ++  +      +++
Sbjct: 278 FKNDD-SILKTGTGYFSLAVVLFILD-TLLIRLFYAVFGLNLLIVKIIVGILLFTASWMV 335

Query: 116 YIRFMTR 122
             RF+ +
Sbjct: 336 QKRFIFK 342


>gi|310829384|ref|YP_003961741.1| hypothetical protein ELI_3831 [Eubacterium limosum KIST612]
 gi|308741118|gb|ADO38778.1| hypothetical protein ELI_3831 [Eubacterium limosum KIST612]
          Length = 134

 Score = 58.0 bits (139), Expect = 5e-07,   Method: Composition-based stats.
 Identities = 18/119 (15%), Positives = 47/119 (39%), Gaps = 2/119 (1%)

Query: 3   QCIIFIINIVVVFFIDVMGFFILM-KCGADPFYSRIFSIAVAFLVTWIPSRLFIFLKLRR 61
           +   F I   V F +D    F L    G +   S   S  V+ +V +    L++F  +++
Sbjct: 15  EIFRFGITGGVSFLVDYGILFALTEFFGVNYLVSSGISFTVSVIVNYFMCILWVFKGVKQ 74

Query: 62  KSFLETVRYGVMYFMLSILNYAFYVKLLLTFQGLQPLLATVLSAVSSMLFVFLLYIRFM 120
                 V +     +   +N    +   +    +  ++A +++ +  M++ ++   + +
Sbjct: 75  NDTKSVVLFIGSSVVGLFINQ-VLMWFFVEKIHIYYMVAKIIATIIVMIWNYVAKRKAV 132


>gi|320108750|ref|YP_004184340.1| family 2 glycosyl transferase [Terriglobus saanensis SP1PR4]
 gi|319927271|gb|ADV84346.1| glycosyl transferase family 2 [Terriglobus saanensis SP1PR4]
          Length = 353

 Score = 58.0 bits (139), Expect = 5e-07,   Method: Composition-based stats.
 Identities = 23/124 (18%), Positives = 47/124 (37%), Gaps = 3/124 (2%)

Query: 4   CIIFIINIVVVFFIDVMGFFILMKCGADPFYSRIFSIAVAFLVTWIPSRLFIFLKLRRKS 63
              F ++ ++   ID +GF +          S  F    + LV +  +R F+F       
Sbjct: 233 LARFFLSSILASGIDFLGFTVAFALTHHLAASVAFGRF-SSLVNFALNRRFVFRNRG-SV 290

Query: 64  FLETVRYGVMYFMLSILNYAFYVKLLLTFQGLQPLLATVLSAVSSMLFVFLLYIRFMTRR 123
            +  +RY  +  +++ L+YA      +        +A +    +  L  F +   F+ RR
Sbjct: 291 TVALLRYYALVILIAFLSYALIWVT-VQRLHWNVFVAKLCVDAALSLMSFSVQRTFIFRR 349

Query: 124 VYFI 127
              +
Sbjct: 350 STAV 353


>gi|284988850|ref|YP_003407404.1| GtrA family protein [Geodermatophilus obscurus DSM 43160]
 gi|284062095|gb|ADB73033.1| GtrA family protein [Geodermatophilus obscurus DSM 43160]
          Length = 185

 Score = 58.0 bits (139), Expect = 5e-07,   Method: Composition-based stats.
 Identities = 19/128 (14%), Positives = 43/128 (33%), Gaps = 9/128 (7%)

Query: 3   QCIIFIINIVVVFFIDVMGFFILMKCGADPFYSRIFSIAVAFLVTWIPSRLFIFLKLR-- 60
           Q   F +  + +  + ++ F +++        + + +   A  V +  S  + +   R  
Sbjct: 10  QIARFALVGLAMTALHLLVFRLVLPWSVPE-AANVIAFLTATQVNFALSYFWTWSARRPV 68

Query: 61  -----RKSFLETVRYGVMYFMLSILNYAFYVKLLLTFQGLQPLLATVLSAVSSMLFVFLL 115
                R      + +     +   +N   +        GL P  + + + V S    FLL
Sbjct: 69  GQETIRSVLRRALLFNGSAALGFGVNAVVFSAA-HRVAGLGPTASALTATVVSAAASFLL 127

Query: 116 YIRFMTRR 123
             R +  R
Sbjct: 128 SSRVVFAR 135


>gi|327459386|gb|EGF05732.1| dolichyl-phosphate beta-D-mannosyltransferase [Streptococcus
           sanguinis SK1]
          Length = 349

 Score = 58.0 bits (139), Expect = 5e-07,   Method: Composition-based stats.
 Identities = 16/127 (12%), Positives = 45/127 (35%), Gaps = 8/127 (6%)

Query: 2   KQCIIFIINIVVVFFIDVMGFFILMKCGAD------PFYSRIFSIAVAFLVTWIPSRLFI 55
           K    F +  +  F +D + + + +   A          +   +   + +  +  ++  +
Sbjct: 218 KNIFKFALTSLSSFVVDYIVYALALLFLAAVPTSLRILLANGIARVTSSIFNYSTNKRLV 277

Query: 56  FLKLRRKSFLETVRYGVMYFMLSILNYAFYVKLLLTFQGLQPLLATVLSAVSSMLFVFLL 115
           F             Y  +  +L IL+    ++L     GL  L+  ++  +      +++
Sbjct: 278 FKNDD-SILKTGTGYFSLAVVLFILD-TLLIRLFYAVFGLNLLIVKIIVGILLFTVSWMV 335

Query: 116 YIRFMTR 122
             RF+ +
Sbjct: 336 QKRFIFK 342


>gi|325697607|gb|EGD39492.1| dolichyl-phosphate beta-D-mannosyltransferase [Streptococcus
           sanguinis SK160]
          Length = 349

 Score = 58.0 bits (139), Expect = 5e-07,   Method: Composition-based stats.
 Identities = 16/127 (12%), Positives = 45/127 (35%), Gaps = 8/127 (6%)

Query: 2   KQCIIFIINIVVVFFIDVMGFFILMKCGAD------PFYSRIFSIAVAFLVTWIPSRLFI 55
           K    F +  +  F +D + + + +   A          +   +   + +  +  ++  +
Sbjct: 218 KNIFKFALTSLSSFVVDYIVYALALLFLAAVPTSLRILLANGIARVTSSIFNYSTNKRLV 277

Query: 56  FLKLRRKSFLETVRYGVMYFMLSILNYAFYVKLLLTFQGLQPLLATVLSAVSSMLFVFLL 115
           F             Y  +  +L IL+    ++L     GL  L+  ++  +      +++
Sbjct: 278 FKNDD-SILKTGTGYFSLAVVLFILD-TLLIRLFYAVFGLNLLIVKIIVGILLFTVSWMV 335

Query: 116 YIRFMTR 122
             RF+ +
Sbjct: 336 QKRFIFK 342


>gi|187928573|ref|YP_001899060.1| GtrA family protein [Ralstonia pickettii 12J]
 gi|187725463|gb|ACD26628.1| GtrA family protein [Ralstonia pickettii 12J]
          Length = 149

 Score = 58.0 bits (139), Expect = 5e-07,   Method: Composition-based stats.
 Identities = 20/120 (16%), Positives = 45/120 (37%), Gaps = 3/120 (2%)

Query: 2   KQCIIFIINIVVVFFIDVMGFFILMKCGADPFYSRIFSIAVAFLVTWIPSRLFIFLKLRR 61
           +    ++++         +  +IL+  G  P            ++ +  SR ++F    +
Sbjct: 5   RIFYRYLLSGGASTATHYLALYILVHSGTTPVVGSTLGAIFGLVLNFTVSRRWVFGAPAK 64

Query: 62  KSFLETVRYGVMYFMLSILNYAFYVKLLLTFQGLQPLLATVLSAVSSMLFVFLLYIRFMT 121
                  R+ +++ +  + N      L     GL  L+A V+S    +L  F L+ R+  
Sbjct: 65  VGAT-LSRFLLVWVLALLFNAWMLAVLF--AAGLHYLVAQVISTGILVLINFNLHRRWTF 121


>gi|328545080|ref|YP_004305189.1| glycosyl transferase, group 2 family protein [polymorphum gilvum
           SL003B-26A1]
 gi|326414822|gb|ADZ71885.1| Glycosyl transferase, group 2 family protein [Polymorphum gilvum
           SL003B-26A1]
          Length = 378

 Score = 58.0 bits (139), Expect = 5e-07,   Method: Composition-based stats.
 Identities = 10/125 (8%), Positives = 35/125 (28%), Gaps = 6/125 (4%)

Query: 3   QCIIFIINIVVVFFIDVMGFFILMKCGADPF-YSRIFSIAVAFLVTWIPSRLFIFLKLRR 61
           + ++F +       + ++     +      F  ++  +  VA    ++ +    +   R 
Sbjct: 255 RFLMFSLVGASGVLVHLLALRAALVALDLEFNVAQTLATFVAMTSNFLLNNRLTYRDRRL 314

Query: 62  ---KSFLETVRYGVMYFMLSILNYAFYVKLLLTFQGLQPLLATVLSAVSSMLFVFLLYIR 118
                    + +  +  +  + N      +          LA    A    ++ +     
Sbjct: 315 TGFGMLRGLLTFYAVCSVGVLANVGVASLIYDQQPVW--WLAGTAGAAMGAVWNYAASSV 372

Query: 119 FMTRR 123
              R+
Sbjct: 373 LTWRK 377


>gi|315222300|ref|ZP_07864206.1| glycosyltransferase, group 2 family protein [Streptococcus
           anginosus F0211]
 gi|315188633|gb|EFU22342.1| glycosyltransferase, group 2 family protein [Streptococcus
           anginosus F0211]
          Length = 347

 Score = 58.0 bits (139), Expect = 5e-07,   Method: Composition-based stats.
 Identities = 15/127 (11%), Positives = 42/127 (33%), Gaps = 8/127 (6%)

Query: 2   KQCIIFIINIVVVFFIDVMGFFILMKC------GADPFYSRIFSIAVAFLVTWIPSRLFI 55
           K    F ++ +  F +D + + + +              +   +   + +  +  ++  +
Sbjct: 216 KDMFKFALSSISSFLVDYIVYALALFVLAAVPTSLKILLANGVARVTSSIFNYSANKKLV 275

Query: 56  FLKLRRKSFLETVRYGVMYFMLSILNYAFYVKLLLTFQGLQPLLATVLSAVSSMLFVFLL 115
           F             Y  +   L IL+    ++L     GL  L+  +L         +L+
Sbjct: 276 FKNKD-SVAKTGTGYFGLALGLFILD-TLLIRLFYASFGLNLLIVKILVGALLFCLSWLV 333

Query: 116 YIRFMTR 122
             + + +
Sbjct: 334 QKKIIFK 340


>gi|332885985|gb|EGK06229.1| hypothetical protein HMPREF9456_00103 [Dysgonomonas mossii DSM
           22836]
          Length = 157

 Score = 57.6 bits (138), Expect = 5e-07,   Method: Composition-based stats.
 Identities = 21/145 (14%), Positives = 47/145 (32%), Gaps = 24/145 (16%)

Query: 1   MKQCIIFIINIVVVFFIDVMGFFILM----------------------KCGADPFYSRIF 38
           +KQ I + +  VV   ID+  +++L+                          D   S I 
Sbjct: 14  IKQLIKYGLVGVVGLVIDMGVYYLLVTKYSVHYPFSVHISTLLGGRMSIGMLDILISNII 73

Query: 39  SIAVAFLVTWIPSRLFIFLKLRRKSFLETVRYGVMYFMLSILNYAFYVKLLLTFQGLQPL 98
           S  +A +  +I +  F F     K       +  +  +  +++        +    +  +
Sbjct: 74  SSTLAVINNFILNSYFTFKVTDNK-LKRFTSFAGIALVGMVISSMLLTL-FIGVMKIDDM 131

Query: 99  LATVLSAVSSMLFVFLLYIRFMTRR 123
           LA   +        F++   F  ++
Sbjct: 132 LAKAFAICIVAAIQFIINKFFTFKQ 156


>gi|218290373|ref|ZP_03494509.1| GtrA family protein [Alicyclobacillus acidocaldarius LAA1]
 gi|218239609|gb|EED06802.1| GtrA family protein [Alicyclobacillus acidocaldarius LAA1]
          Length = 157

 Score = 57.6 bits (138), Expect = 5e-07,   Method: Composition-based stats.
 Identities = 21/131 (16%), Positives = 49/131 (37%), Gaps = 12/131 (9%)

Query: 5   IIFIINIVVVFFIDVMGFFILMKCGADP-----FYSRIFSIAVAFLVTWIPSRLFIFLKL 59
             F++  V+   +D+     L+                  +  A   +++ +R + F  +
Sbjct: 16  FKFLLVGVMNAAVDLGVLNALLLAFPTRSPLVLMAYNTIGVLAAICNSYLWNRFWTFGDI 75

Query: 60  RRKSFLETVRYGVMYFMLSILNYAFYVK---LLLTFQGLQPL----LATVLSAVSSMLFV 112
              S  E +++ +   +  +LN A  V     L+T +GL  +    +A   +   S    
Sbjct: 76  ATGSRREKMKFALQSLVNLVLNDAILVGANDYLVTHRGLPYMLGSNIAKGGAMFVSSSVS 135

Query: 113 FLLYIRFMTRR 123
           ++    F+ +R
Sbjct: 136 YVFMRMFVFKR 146


>gi|262281960|ref|ZP_06059729.1| dolichol-phosphate mannosyltransferase [Streptococcus sp.
           2_1_36FAA]
 gi|262262414|gb|EEY81111.1| dolichol-phosphate mannosyltransferase [Streptococcus sp.
           2_1_36FAA]
          Length = 347

 Score = 57.6 bits (138), Expect = 5e-07,   Method: Composition-based stats.
 Identities = 16/127 (12%), Positives = 44/127 (34%), Gaps = 8/127 (6%)

Query: 2   KQCIIFIINIVVVFFIDVMGFFILMKC------GADPFYSRIFSIAVAFLVTWIPSRLFI 55
           K    F ++ +  F +D + + + +              +   +   + +  +  ++  +
Sbjct: 216 KDMFKFALSSLSSFIVDYLVYAVALLFLVAVPTTLRILLANGIARVTSSIFNYSTNKKLV 275

Query: 56  FLKLRRKSFLETVRYGVMYFMLSILNYAFYVKLLLTFQGLQPLLATVLSAVSSMLFVFLL 115
           F             Y  +   L IL+    ++L     G+  LL  +L  +      +L+
Sbjct: 276 FKNED-SIAKTGSGYFGLALGLFILD-TLLIRLFYVVFGINLLLVKILVGILLFSLSWLI 333

Query: 116 YIRFMTR 122
             +F+ +
Sbjct: 334 QKKFIFK 340


>gi|170781076|ref|YP_001709408.1| hypothetical protein CMS_0642 [Clavibacter michiganensis subsp.
           sepedonicus]
 gi|169155644|emb|CAQ00762.1| putative membrane protein [Clavibacter michiganensis subsp.
           sepedonicus]
          Length = 156

 Score = 57.6 bits (138), Expect = 5e-07,   Method: Composition-based stats.
 Identities = 21/123 (17%), Positives = 44/123 (35%), Gaps = 5/123 (4%)

Query: 5   IIFIINIVVVFFID---VMGFFILMKCGADPFYSRIFSIAVAFLVTWIPSRLFIFLKLRR 61
           I F++       +       F++L           I + AV   V++   R  +F     
Sbjct: 30  IAFLLVGGFNTVLGTAWFALFYLLWGHLIPYPVVLIIAWAVQLPVSFTLHRKLVFKVSGN 89

Query: 62  KSFLETVRYGVMYFMLSILNYAFYVKLLLTFQGLQPLLATVLSAVSSMLFVFLLYIRFMT 121
               +  RY ++  +    N      ++ T   L+P++A +L  +   +  +  +  F  
Sbjct: 90  -LLPDFSRYTLVNLVPLFANMLLLPLVVETTP-LEPIVAQILVTIVITVATYTGHKFFSF 147

Query: 122 RRV 124
           RR 
Sbjct: 148 RRP 150


>gi|307728828|ref|YP_003906052.1| GtrA family protein [Burkholderia sp. CCGE1003]
 gi|307583363|gb|ADN56761.1| GtrA family protein [Burkholderia sp. CCGE1003]
          Length = 152

 Score = 57.6 bits (138), Expect = 5e-07,   Method: Composition-based stats.
 Identities = 24/126 (19%), Positives = 50/126 (39%), Gaps = 5/126 (3%)

Query: 1   MKQCIIFIINIVVVFFIDVMGFFILMKCGADPFYSRIFSIAVAFLVTWIPSRLFIFLKLR 60
           +K+   F +   + F +D    + L K     FY R  S   A   TW+ +R + F   R
Sbjct: 10  LKEIFAFGVVGTIGFIVDTGVLY-LTKAHFGLFYGRATSFVCAAFTTWLINRAWTFKNKR 68

Query: 61  RK--SFLETVRYGVMYFMLSILNYAFYVKLLLTFQGL--QPLLATVLSAVSSMLFVFLLY 116
               +  E   Y ++  +   +NY+ YV  +  +      P++   + +++ M    +  
Sbjct: 69  SSLGAKSEFAVYFLLMLIGGAVNYSAYVITVSKYPIAAVYPIIGVAIGSLAGMFVNLMSS 128

Query: 117 IRFMTR 122
              + +
Sbjct: 129 RMVLFK 134


>gi|125717292|ref|YP_001034425.1| glycosyltransferase [Streptococcus sanguinis SK36]
 gi|125497209|gb|ABN43875.1| Glycosyltransferase, putative [Streptococcus sanguinis SK36]
 gi|327472803|gb|EGF18230.1| dolichyl-phosphate beta-D-mannosyltransferase [Streptococcus
           sanguinis SK408]
          Length = 349

 Score = 57.6 bits (138), Expect = 5e-07,   Method: Composition-based stats.
 Identities = 16/127 (12%), Positives = 45/127 (35%), Gaps = 8/127 (6%)

Query: 2   KQCIIFIINIVVVFFIDVMGFFILMKCGAD------PFYSRIFSIAVAFLVTWIPSRLFI 55
           K    F +  +  F +D + + + +   A          +   +   + +  +  ++  +
Sbjct: 218 KNIFKFALTSLSSFVVDYIVYALALLFLAAVPTSLRILLANGIARVTSSIFNYSTNKKLV 277

Query: 56  FLKLRRKSFLETVRYGVMYFMLSILNYAFYVKLLLTFQGLQPLLATVLSAVSSMLFVFLL 115
           F             Y  +  +L IL+    ++L     GL  L+  ++  +      +++
Sbjct: 278 FKNDD-SILKTGTGYFSLAVVLFILD-TLLIRLFYAVFGLNLLIVKIIVGILLFTVSWMV 335

Query: 116 YIRFMTR 122
             RF+ +
Sbjct: 336 QKRFIFK 342


>gi|15843411|ref|NP_338448.1| hypothetical protein MT3897 [Mycobacterium tuberculosis CDC1551]
 gi|253800837|ref|YP_003033839.1| hypothetical protein TBMG_03836 [Mycobacterium tuberculosis KZN
           1435]
 gi|254233282|ref|ZP_04926608.1| hypothetical protein TBCG_03715 [Mycobacterium tuberculosis C]
 gi|254552904|ref|ZP_05143351.1| hypothetical protein Mtube_21077 [Mycobacterium tuberculosis
           '98-R604 INH-RIF-EM']
 gi|308232568|ref|ZP_07416488.2| conserved membrane protein [Mycobacterium tuberculosis SUMu001]
 gi|308369232|ref|ZP_07417020.2| conserved membrane protein [Mycobacterium tuberculosis SUMu002]
 gi|308371452|ref|ZP_07425027.2| conserved membrane protein [Mycobacterium tuberculosis SUMu003]
 gi|308372655|ref|ZP_07429394.2| conserved membrane protein [Mycobacterium tuberculosis SUMu004]
 gi|308372740|ref|ZP_07429693.2| conserved membrane protein [Mycobacterium tuberculosis SUMu005]
 gi|308373820|ref|ZP_07433758.2| conserved membrane protein [Mycobacterium tuberculosis SUMu006]
 gi|308374983|ref|ZP_07442305.2| conserved membrane protein [Mycobacterium tuberculosis SUMu007]
 gi|308376231|ref|ZP_07438099.2| conserved membrane protein [Mycobacterium tuberculosis SUMu008]
 gi|308378469|ref|ZP_07482694.2| conserved membrane protein [Mycobacterium tuberculosis SUMu009]
 gi|308379618|ref|ZP_07486928.2| conserved membrane protein [Mycobacterium tuberculosis SUMu010]
 gi|308380808|ref|ZP_07491145.2| conserved membrane protein [Mycobacterium tuberculosis SUMu011]
 gi|308406247|ref|ZP_07495702.2| conserved membrane protein [Mycobacterium tuberculosis SUMu012]
 gi|13883778|gb|AAK48262.1| conserved hypothetical protein [Mycobacterium tuberculosis CDC1551]
 gi|124603075|gb|EAY61350.1| hypothetical protein TBCG_03715 [Mycobacterium tuberculosis C]
 gi|253322341|gb|ACT26944.1| conserved membrane protein [Mycobacterium tuberculosis KZN 1435]
 gi|308213672|gb|EFO73071.1| conserved membrane protein [Mycobacterium tuberculosis SUMu001]
 gi|308328405|gb|EFP17256.1| conserved membrane protein [Mycobacterium tuberculosis SUMu002]
 gi|308328809|gb|EFP17660.1| conserved membrane protein [Mycobacterium tuberculosis SUMu003]
 gi|308332652|gb|EFP21503.1| conserved membrane protein [Mycobacterium tuberculosis SUMu004]
 gi|308340144|gb|EFP28995.1| conserved membrane protein [Mycobacterium tuberculosis SUMu005]
 gi|308344130|gb|EFP32981.1| conserved membrane protein [Mycobacterium tuberculosis SUMu006]
 gi|308347932|gb|EFP36783.1| conserved membrane protein [Mycobacterium tuberculosis SUMu007]
 gi|308351800|gb|EFP40651.1| conserved membrane protein [Mycobacterium tuberculosis SUMu008]
 gi|308352583|gb|EFP41434.1| conserved membrane protein [Mycobacterium tuberculosis SUMu009]
 gi|308356535|gb|EFP45386.1| conserved membrane protein [Mycobacterium tuberculosis SUMu010]
 gi|308360483|gb|EFP49334.1| conserved membrane protein [Mycobacterium tuberculosis SUMu011]
 gi|308364001|gb|EFP52852.1| conserved membrane protein [Mycobacterium tuberculosis SUMu012]
 gi|323717655|gb|EGB26857.1| membrane protein [Mycobacterium tuberculosis CDC1551A]
          Length = 142

 Score = 57.6 bits (138), Expect = 5e-07,   Method: Composition-based stats.
 Identities = 18/121 (14%), Positives = 44/121 (36%), Gaps = 1/121 (0%)

Query: 3   QCIIFIINIVVVFFIDVMGFFILMKC-GADPFYSRIFSIAVAFLVTWIPSRLFIFLKLRR 61
           Q + F++   +   +D   + +L K  G     S+  S  V  +  ++ +R + F     
Sbjct: 20  QVMRFVVTGGLAGIVDFGLYVVLYKVAGLQVDLSKAISFIVGTITAYLINRRWTFQAEPS 79

Query: 62  KSFLETVRYGVMYFMLSILNYAFYVKLLLTFQGLQPLLATVLSAVSSMLFVFLLYIRFMT 121
            +    V           +        LL ++     +A V++  ++ +  F++    + 
Sbjct: 80  TARFVAVMLLYGITFAVQVGLNHLCLALLHYRAWAIPVAFVIAQGTATVINFIVQRAVIF 139

Query: 122 R 122
           R
Sbjct: 140 R 140


>gi|306821432|ref|ZP_07455036.1| GtrA family integral membrane protein [Eubacterium yurii subsp.
           margaretiae ATCC 43715]
 gi|304550507|gb|EFM38494.1| GtrA family integral membrane protein [Eubacterium yurii subsp.
           margaretiae ATCC 43715]
          Length = 134

 Score = 57.6 bits (138), Expect = 5e-07,   Method: Composition-based stats.
 Identities = 18/121 (14%), Positives = 48/121 (39%), Gaps = 1/121 (0%)

Query: 3   QCIIFIINIVVVFFIDVMGFFILMKCGADPFYSRIFSIAVAFLVTWIPSRLFIFLKLRRK 62
           + I FI+  ++     +  ++ L+  G +   S   S   + L +++ +   +F      
Sbjct: 13  KFIKFIVVGLINTIFQLGIYYFLLFTGVNYNISFAISFIFSVLFSYVFNNKIVFKVDNVN 72

Query: 63  SFLETVRYGVMYFMLSILNYAFYVKLLLTFQGLQPLLATVLSAVSSMLFVFLLYIRFMTR 122
           S    V+  + Y    +L+        +   G+   +  +++ + +    FLL   F+ +
Sbjct: 73  SKSSLVKIYISYGSTFLLSQIMLYLG-VEKFGISDKIMPIINIIMTTPLNFLLNRYFVFK 131

Query: 123 R 123
           +
Sbjct: 132 K 132


>gi|332363782|gb|EGJ41561.1| dolichyl-phosphate beta-D-mannosyltransferase [Streptococcus
           sanguinis SK355]
          Length = 349

 Score = 57.6 bits (138), Expect = 6e-07,   Method: Composition-based stats.
 Identities = 16/127 (12%), Positives = 45/127 (35%), Gaps = 8/127 (6%)

Query: 2   KQCIIFIINIVVVFFIDVMGFFILMKCGAD------PFYSRIFSIAVAFLVTWIPSRLFI 55
           K    F +  +  F +D + + + +   A          +   +   + +  +  ++  +
Sbjct: 218 KNIFKFALTSLSSFVVDYIVYALALLFLAAVPTSLRILLANGIARVTSSIFNYSTNKRLV 277

Query: 56  FLKLRRKSFLETVRYGVMYFMLSILNYAFYVKLLLTFQGLQPLLATVLSAVSSMLFVFLL 115
           F             Y  +  +L IL+    ++L     GL  L+  ++  +      +++
Sbjct: 278 FKNDD-SILKTGTGYFSLAVVLFILD-TLLIRLFYAVFGLNLLIVKIIVGILLFTVSWMV 335

Query: 116 YIRFMTR 122
             RF+ +
Sbjct: 336 QKRFIFK 342


>gi|332188399|ref|ZP_08390123.1| gtrA-like family protein [Sphingomonas sp. S17]
 gi|332011545|gb|EGI53626.1| gtrA-like family protein [Sphingomonas sp. S17]
          Length = 142

 Score = 57.6 bits (138), Expect = 6e-07,   Method: Composition-based stats.
 Identities = 19/126 (15%), Positives = 42/126 (33%), Gaps = 6/126 (4%)

Query: 1   MKQCIIFIINIVVVFFIDVMGFFILMKCGADP---FYSRIFSIAVAFLVTWIPSRLFIFL 57
           + Q I F I   +   +    +  L            +   S  VA +  +     + F 
Sbjct: 17  LGQLIRFGIAGGLSTVVYSAVYLPLTAWVLPESQAVLAVPPSFLVAVIFGFFLHSAWSFR 76

Query: 58  KLRR--KSFLETVRYGVMYFMLSILNYAFYVKLLLTFQGLQPLLATVLSAVSSMLFVFLL 115
                  S  + +++ V+      LN A +  ++      QP +A +     + +  F L
Sbjct: 77  GHGSRDSSGKQHLKFLVVQGFGLALN-ALFTWIVTGLLHQQPWVALIPVVTITPIATFAL 135

Query: 116 YIRFMT 121
             +++ 
Sbjct: 136 NRQWVF 141


>gi|198274756|ref|ZP_03207288.1| hypothetical protein BACPLE_00915 [Bacteroides plebeius DSM 17135]
 gi|198272203|gb|EDY96472.1| hypothetical protein BACPLE_00915 [Bacteroides plebeius DSM 17135]
          Length = 129

 Score = 57.6 bits (138), Expect = 6e-07,   Method: Composition-based stats.
 Identities = 23/124 (18%), Positives = 44/124 (35%), Gaps = 4/124 (3%)

Query: 3   QCIIFIINIVVVFFIDVMGFFILMKC-GADPFYSRIFSIAVAFLVTWIPSRLFIF---LK 58
           + I F I   +   I     ++LM   G     + I +  VA +  +I  + +IF     
Sbjct: 6   RIIRFAIVGTLNALIAAFVVWLLMHIEGESYIIANICAYIVAQIHNFIWCKYWIFPLETD 65

Query: 59  LRRKSFLETVRYGVMYFMLSILNYAFYVKLLLTFQGLQPLLATVLSAVSSMLFVFLLYIR 118
            ++ S    + + +  F L+      ++ +L+        LA  L         F+   R
Sbjct: 66  DKKNSIWHQMLFFIGAFALAYSAQFLFLLMLVELLHCNEYLAQFLGLFVYGAVNFICNRR 125

Query: 119 FMTR 122
              R
Sbjct: 126 LTFR 129


>gi|294782656|ref|ZP_06747982.1| dolichyl-phosphate beta-D-mannosyltransferase [Fusobacterium sp.
           1_1_41FAA]
 gi|294481297|gb|EFG29072.1| dolichyl-phosphate beta-D-mannosyltransferase [Fusobacterium sp.
           1_1_41FAA]
          Length = 360

 Score = 57.6 bits (138), Expect = 6e-07,   Method: Composition-based stats.
 Identities = 16/129 (12%), Positives = 51/129 (39%), Gaps = 11/129 (8%)

Query: 4   CIIFIINIVVVFFIDVM----GFFILMKCGADP-----FYSRIFSIAVAFLVTWIPSRLF 54
            + +I + +  F +D++       +L+  G          + I +  ++    +  ++ F
Sbjct: 233 FLKYIASAISSFVLDILSFKWILVLLLAFGNIEGASVITIATIVARIISSSFNFYLNKKF 292

Query: 55  IFLKLRRKSFLETVRYGVMYFMLSILNYAFYVKLLLTFQGLQPLLATVLSAVSSMLFVFL 114
           +F    + +    ++Y  +  +  +++ AF+V L+            ++      L  + 
Sbjct: 293 VFKYE-KNTKKSLLKYYSLCAIQMLVS-AFFVTLVWKHTKHSETSIKIVVDSVLFLLSYF 350

Query: 115 LYIRFMTRR 123
           +  R++ +R
Sbjct: 351 IQQRWVFKR 359


>gi|114328940|ref|YP_746097.1| hypothetical protein GbCGDNIH1_2276 [Granulibacter bethesdensis
           CGDNIH1]
 gi|114317114|gb|ABI63174.1| hypothetical membrane spanning protein [Granulibacter bethesdensis
           CGDNIH1]
          Length = 136

 Score = 57.6 bits (138), Expect = 6e-07,   Method: Composition-based stats.
 Identities = 11/128 (8%), Positives = 47/128 (36%), Gaps = 7/128 (5%)

Query: 2   KQCIIFIINIVVVFFIDVMGFFILMKCGADPFYSRIFSIAVAFLVTWIPSRLFIFLKLRR 61
           +Q + F++   +   +++   ++L       + +   +     +  ++ +R+++F +  R
Sbjct: 3   RQFLRFLLTGGIAALVNLGCRYLL-NLVMPFWVAVPIAYLFGMITAYVLARVYVFDESGR 61

Query: 62  KSFLETVRYGVMYFMLSILNYAFY------VKLLLTFQGLQPLLATVLSAVSSMLFVFLL 115
               E  R+ V+      + +         +   +        +A  +  +S +   ++ 
Sbjct: 62  SRASEFRRFAVVNGFALFIVWGVSLALAKGLFPWVGLTWHADDIAHFIGVLSPVAISYVG 121

Query: 116 YIRFMTRR 123
           +  +   +
Sbjct: 122 HRHYTFSK 129


>gi|324999006|ref|ZP_08120118.1| predicted membrane protein [Pseudonocardia sp. P1]
          Length = 134

 Score = 57.6 bits (138), Expect = 6e-07,   Method: Composition-based stats.
 Identities = 20/120 (16%), Positives = 35/120 (29%)

Query: 3   QCIIFIINIVVVFFIDVMGFFILMKCGADPFYSRIFSIAVAFLVTWIPSRLFIFLKLRRK 62
           Q   F+   ++   +D   + + +  G     +R  S      V ++ +R + F      
Sbjct: 13  QAGRFVAVGILGALVDSGVYALALHLGVWVHAARALSFVCGTTVAYVLNRRWAFRVSGGA 72

Query: 63  SFLETVRYGVMYFMLSILNYAFYVKLLLTFQGLQPLLATVLSAVSSMLFVFLLYIRFMTR 122
                           IL        LL        +A VLS        F+L    + R
Sbjct: 73  RRATGYAVLYGTMFFVILGVNALALALLPAAWWAVPVAWVLSQGVGTTCNFVLLRTVVFR 132


>gi|304312196|ref|YP_003811794.1| GtrA-like protein [gamma proteobacterium HdN1]
 gi|301797929|emb|CBL46151.1| GtrA-like protein [gamma proteobacterium HdN1]
          Length = 143

 Score = 57.6 bits (138), Expect = 6e-07,   Method: Composition-based stats.
 Identities = 16/119 (13%), Positives = 37/119 (31%), Gaps = 2/119 (1%)

Query: 3   QCIIFIINIVVVFFIDVMGFFILMKCGADPFYSRIFSIAVAFLVTWIPSRLFIFLKLRRK 62
               ++++      +     ++L++       +          + ++    F F      
Sbjct: 12  HFFRYLLSGGSATVLHWSCMWLLLQLNVHANVATAIGALAGACLNYVLQFHFTFRSS-SS 70

Query: 63  SFLETVRYGVMYFMLSILNYAFYVKLLLTFQGLQPLLATVLSAVSSMLFVFLLYIRFMT 121
                 RY          N +    LL +  G  P+ A +++    +L  F LY R + 
Sbjct: 71  HINTLPRYVAASLTSWSAN-SLLFALLYSALGFPPVFAQLITTACILLLNFTLYRRLVF 128


>gi|322386231|ref|ZP_08059863.1| dolichyl-phosphate beta-D-mannosyltransferase [Streptococcus
           cristatus ATCC 51100]
 gi|321269693|gb|EFX52621.1| dolichyl-phosphate beta-D-mannosyltransferase [Streptococcus
           cristatus ATCC 51100]
          Length = 349

 Score = 57.6 bits (138), Expect = 6e-07,   Method: Composition-based stats.
 Identities = 18/127 (14%), Positives = 45/127 (35%), Gaps = 8/127 (6%)

Query: 2   KQCIIFIINIVVVFFIDVMGFFILMKCGAD------PFYSRIFSIAVAFLVTWIPSRLFI 55
           K    F +  +  F +D M + + +   A          +   +   + +  +  ++  +
Sbjct: 218 KNIFKFALTSLSSFVVDYMVYALALLFLAAVPTSLRILLANGIARVTSSVFNYSTNKKLV 277

Query: 56  FLKLRRKSFLETVRYGVMYFMLSILNYAFYVKLLLTFQGLQPLLATVLSAVSSMLFVFLL 115
           F             Y  +  +L IL+    ++L     GL  LL  ++  +      +++
Sbjct: 278 FKNDD-SILKTGTGYFSLALVLFILD-TLLIRLFYAVFGLNLLLVKIIVGLLLFTVSWMV 335

Query: 116 YIRFMTR 122
             RF+ +
Sbjct: 336 QKRFIFK 342


>gi|225352061|ref|ZP_03743084.1| hypothetical protein BIFPSEUDO_03670 [Bifidobacterium
           pseudocatenulatum DSM 20438]
 gi|225157308|gb|EEG70647.1| hypothetical protein BIFPSEUDO_03670 [Bifidobacterium
           pseudocatenulatum DSM 20438]
          Length = 157

 Score = 57.6 bits (138), Expect = 6e-07,   Method: Composition-based stats.
 Identities = 17/124 (13%), Positives = 40/124 (32%), Gaps = 8/124 (6%)

Query: 2   KQCIIFIINIVVVFFIDVMGFFILMKCGADPFYSRIFSIAVAFLVTWIPSRLFIFLKLRR 61
           K    +++       ++   F +L         +   +I ++    ++ +R   F     
Sbjct: 39  KTLGKYLLVSATQTIVEFGSFTLLHVLSVPSAIANGVAIVLSASYNFLMNRNVTFKSSSN 98

Query: 62  KSFLETVRYGVMYFMLSILNYAFYVKLLLTFQ---GLQPLLATVLSAVSSMLFVFLLYIR 118
                  R   ++ +L + NY F   +L       G   +L   L+      + + L   
Sbjct: 99  -----FGRSVALFMLLWVWNYLFGSIMLAWLPSAFGWNAVLVKFLTMACQFAWGYPLCKE 153

Query: 119 FMTR 122
            + R
Sbjct: 154 VIFR 157


>gi|89097415|ref|ZP_01170304.1| hypothetical protein B14911_27490 [Bacillus sp. NRRL B-14911]
 gi|89087711|gb|EAR66823.1| hypothetical protein B14911_27490 [Bacillus sp. NRRL B-14911]
          Length = 140

 Score = 57.6 bits (138), Expect = 6e-07,   Method: Composition-based stats.
 Identities = 17/124 (13%), Positives = 47/124 (37%), Gaps = 5/124 (4%)

Query: 4   CIIFIINIVVVFFIDVMGFFILMKCGADPFYSRIFSIAVAFLVTWIPSRLFIFLKLRRKS 63
            + F++  ++   I +   +IL+  G   ++S +   A   + ++  ++ + F   +   
Sbjct: 18  LVRFLLVGLINTLIGLGSIYILLLAGTGYWFSTLLGNAAGAVTSYFLNKAYTFKSSQ-PF 76

Query: 64  FLETVRYGVMYFMLSILNYAFYVKLLL----TFQGLQPLLATVLSAVSSMLFVFLLYIRF 119
               + +  +      ++Y+   KL+L             A +L  V   +  +L     
Sbjct: 77  IKSGLLFASLAASCYFISYSLSKKLVLILDNHLAFYPETAAVLLGTVLYTVLNYLGQKYI 136

Query: 120 MTRR 123
           + +R
Sbjct: 137 VFKR 140


>gi|210632606|ref|ZP_03297475.1| hypothetical protein COLSTE_01378 [Collinsella stercoris DSM 13279]
 gi|210159466|gb|EEA90437.1| hypothetical protein COLSTE_01378 [Collinsella stercoris DSM 13279]
          Length = 130

 Score = 57.6 bits (138), Expect = 6e-07,   Method: Composition-based stats.
 Identities = 20/121 (16%), Positives = 43/121 (35%), Gaps = 3/121 (2%)

Query: 1   MKQCIIFIINIVVVFFIDVMGFFILMK-CGADPFYSRIFSIAVAFLVTWIPSRLFIFLKL 59
           + Q   F +  V+   ID     +L      D   +      ++ +  +  S  F+F   
Sbjct: 5   LAQLAKFGVVGVIATVIDFGVMNLLHYGLHLDILIANTAGFIISLVFNYAASMKFVFEHR 64

Query: 60  -RRKSFLETVRYGVMYFMLSILNYAFYVKLLLTFQGLQPLLATVLSAVSSMLFVFLLYIR 118
                  E   + ++  +  +LN    V +L     L+  +A + +    M++ F+    
Sbjct: 65  DGMSRTREFTIFLILSVIGLLLNDGI-VLILNKGVALEANIAKIAATALVMIYNFVTRKI 123

Query: 119 F 119
           F
Sbjct: 124 F 124


>gi|111224245|ref|YP_715039.1| putative dolichyl-phosphate beta-glucosyltransferase [Frankia alni
           ACN14a]
 gi|111151777|emb|CAJ63497.1| Putative dolichyl-phosphate beta-glucosyltransferase [Frankia alni
           ACN14a]
          Length = 401

 Score = 57.2 bits (137), Expect = 6e-07,   Method: Composition-based stats.
 Identities = 19/123 (15%), Positives = 44/123 (35%), Gaps = 5/123 (4%)

Query: 3   QCIIFIINIVVVFFIDVMGFFILMKCGADPFYSRIFSIAVAFLVTWIPSRLFIFLKLRRK 62
           Q   F I   +      +  + L++     F + + ++ V  +     +R F F +  R+
Sbjct: 275 QLGPFAIIGTISTL-SYVVLYALLRAVLSAFDANLLALCVTVVGNTWANRRFTFRRTGRQ 333

Query: 63  SFLETVR----YGVMYFMLSILNYAFYVKLLLTFQGLQPLLATVLSAVSSMLFVFLLYIR 118
            +            +  ++S    A    L  T   L  ++  + S V + +  F+L   
Sbjct: 334 RWARQFVESAMVFGVGLIISSAALAILHLLWQTSGVLSEIVTVLASGVLATIVRFMLLRA 393

Query: 119 FMT 121
           ++ 
Sbjct: 394 WVF 396


>gi|300692345|ref|YP_003753340.1| bactoprenol-linked glucose translocase (gtrA) [Ralstonia
           solanacearum PSI07]
 gi|299079405|emb|CBJ52076.2| putative Bactoprenol-linked glucose translocase (gtrA) [Ralstonia
           solanacearum PSI07]
          Length = 148

 Score = 57.2 bits (137), Expect = 6e-07,   Method: Composition-based stats.
 Identities = 15/121 (12%), Positives = 39/121 (32%), Gaps = 5/121 (4%)

Query: 3   QCIIFIINIVVVFFIDVMG-FFILMKCGADPFYSRIFSIAVAFLVTWIPSRLFIFLKLRR 61
           +   F I+ V    + V+    +++   A P  +   +   A + +++ + L+ F     
Sbjct: 32  RLFRFGISGVTATCVHVVIATSLVVGLSASPVLANGVAFVCATVFSYLMNALWSFSAR-- 89

Query: 62  KSFLETVRYGVMYFMLSILNYAFYVKLLLTFQGLQPLLATVLSAVSSMLFVFLLYIRFMT 121
                 +R+        +L             G    +  V   +      F+L+  +  
Sbjct: 90  PGRDNFLRFLCAAVFGLMLTLTISWVA--QQLGADYWVGLVWILLIVPPITFVLHRSWTF 147

Query: 122 R 122
           +
Sbjct: 148 K 148


>gi|160879490|ref|YP_001558458.1| GtrA family protein [Clostridium phytofermentans ISDg]
 gi|160428156|gb|ABX41719.1| GtrA family protein [Clostridium phytofermentans ISDg]
          Length = 169

 Score = 57.2 bits (137), Expect = 6e-07,   Method: Composition-based stats.
 Identities = 13/126 (10%), Positives = 49/126 (38%), Gaps = 5/126 (3%)

Query: 2   KQCIIFIINIVVVFFIDVMGFFILMK-CGADPFYSRIFSIAVAFLVTWIPSRLFIFLKLR 60
           ++ I + I  V+   ++++ F ++      +   + I +   A    ++ +  ++F    
Sbjct: 40  RETITYAIAGVLTTLVNLITFDLIANKMHVNDLVANIIAWIFAVSFAYVVNNFWVFHSGV 99

Query: 61  RKSFLE---TVRYGVMYFMLSILNYAFYVKLLLTFQGLQPLLATVLSAVSSMLFVFLLYI 117
            K + E    +++     +   +  A      +T+     ++  +  AV  ++  ++   
Sbjct: 100 GKEYKEVEKILKFFGARLVTLGIEEAGI-LCFVTWLHFNNMVVKLGLAVIVIIVNYIFSK 158

Query: 118 RFMTRR 123
            ++  +
Sbjct: 159 LYIFNK 164


>gi|327469254|gb|EGF14726.1| dolichyl-phosphate beta-D-mannosyltransferase [Streptococcus
           sanguinis SK330]
          Length = 349

 Score = 57.2 bits (137), Expect = 6e-07,   Method: Composition-based stats.
 Identities = 14/127 (11%), Positives = 43/127 (33%), Gaps = 8/127 (6%)

Query: 2   KQCIIFIINIVVVFFIDVMGFFILMKCGADP------FYSRIFSIAVAFLVTWIPSRLFI 55
           K    F +  +  F +D + + + +              +   +   + +  +  ++  +
Sbjct: 218 KNIFKFALTSLSSFVVDYIVYALALLFLTAAPTSLRIILANGIARVTSSIFNYSTNKRLV 277

Query: 56  FLKLRRKSFLETVRYGVMYFMLSILNYAFYVKLLLTFQGLQPLLATVLSAVSSMLFVFLL 115
           F             Y  +  +L IL+    ++L      L  L+  ++  +      +++
Sbjct: 278 FKNDD-SILKTGTGYFSLAVVLFILD-TLLIRLFYAVFDLNLLIVKIIVGILLFTVSWMV 335

Query: 116 YIRFMTR 122
             RF+ +
Sbjct: 336 QKRFIFK 342


>gi|229491368|ref|ZP_04385192.1| conserved hypothetical protein [Rhodococcus erythropolis SK121]
 gi|229321653|gb|EEN87450.1| conserved hypothetical protein [Rhodococcus erythropolis SK121]
          Length = 148

 Score = 57.2 bits (137), Expect = 6e-07,   Method: Composition-based stats.
 Identities = 21/124 (16%), Positives = 43/124 (34%), Gaps = 5/124 (4%)

Query: 3   QCIIFIINIVVVFFIDVMGFFILMKCGAD---PFYSRIFSIAVAFLVTWIPSRLFIFLKL 59
           Q I F I  V    I  + F +      +      + I + +++ L+ ++  R  +F   
Sbjct: 21  QPIAFAIVGVANTAIGYVLFVVWSLILDNKDLYQVAVIGAYSISVLIAFVLHRTLVFRVR 80

Query: 60  RRKSFLETVRYGVMYFMLSILNYAFYVKLLLTFQGLQPLLATVLSAVSSMLFVFLLYIRF 119
                 +   + V+     +LN      + ++     PL A  +  +      F  +  F
Sbjct: 81  GH-VARDLGAFIVVNSGGLVLNL-ILGTIAVSILHAPPLPAQAVVMLIVAGVSFFGHRYF 138

Query: 120 MTRR 123
             RR
Sbjct: 139 SFRR 142


>gi|191637592|ref|YP_001986758.1| Conserved membrane protein, GtcA family [Lactobacillus casei BL23]
 gi|190711894|emb|CAQ65900.1| Conserved membrane protein, GtcA family [Lactobacillus casei BL23]
 gi|327381642|gb|AEA53118.1| hypothetical protein LC2W_0784 [Lactobacillus casei LC2W]
 gi|327384809|gb|AEA56283.1| hypothetical protein LCBD_0785 [Lactobacillus casei BD-II]
          Length = 135

 Score = 57.2 bits (137), Expect = 6e-07,   Method: Composition-based stats.
 Identities = 17/122 (13%), Positives = 41/122 (33%), Gaps = 1/122 (0%)

Query: 1   MKQCIIFIINIVVVFFIDVMGFFILMKCGADPFYSRIFSIAVAFLVTWIPSRLFIFLKLR 60
           +KQ I F +   V   +  + +  L +       +      +  +     +  ++F    
Sbjct: 5   LKQFIGFGLVGGVNTILTYLIYLTLYQLINP-TAAMGVGYGLTSMFGLFLNDTWVFKAKD 63

Query: 61  RKSFLETVRYGVMYFMLSILNYAFYVKLLLTFQGLQPLLATVLSAVSSMLFVFLLYIRFM 120
           R+          + + L+ +           F  L   LA + + + ++   FLL   ++
Sbjct: 64  RRQLKTVAPRYYLSYGLTFILSLVLTSFWNDFLRLPKPLAPMFALMITVPTNFLLSKFWV 123

Query: 121 TR 122
            R
Sbjct: 124 FR 125


>gi|325693693|gb|EGD35612.1| dolichyl-phosphate beta-D-mannosyltransferase [Streptococcus
           sanguinis SK150]
          Length = 349

 Score = 57.2 bits (137), Expect = 6e-07,   Method: Composition-based stats.
 Identities = 14/127 (11%), Positives = 43/127 (33%), Gaps = 8/127 (6%)

Query: 2   KQCIIFIINIVVVFFIDVMGFFILMKCGAD------PFYSRIFSIAVAFLVTWIPSRLFI 55
           K    F +  +  F +D + + + +              +   +   + +  +  ++  +
Sbjct: 218 KNIFKFALTSLSSFVVDYIVYAMALLFLTAVPTSLRILLANGIARVTSSIFNYSTNKKLV 277

Query: 56  FLKLRRKSFLETVRYGVMYFMLSILNYAFYVKLLLTFQGLQPLLATVLSAVSSMLFVFLL 115
           F             Y  +  +L IL+    ++L     G+  L+  ++         +++
Sbjct: 278 FKNDD-SILKTGTGYFSLAVVLFILD-TLLIRLFYAVFGINLLIVKIIVGTLLFTVSWMV 335

Query: 116 YIRFMTR 122
             RF+ +
Sbjct: 336 QKRFIFK 342


>gi|218131087|ref|ZP_03459891.1| hypothetical protein BACEGG_02692 [Bacteroides eggerthii DSM 20697]
 gi|317477027|ref|ZP_07936269.1| GtrA-like protein [Bacteroides eggerthii 1_2_48FAA]
 gi|217986791|gb|EEC53124.1| hypothetical protein BACEGG_02692 [Bacteroides eggerthii DSM 20697]
 gi|316906820|gb|EFV28532.1| GtrA-like protein [Bacteroides eggerthii 1_2_48FAA]
          Length = 126

 Score = 57.2 bits (137), Expect = 7e-07,   Method: Composition-based stats.
 Identities = 16/121 (13%), Positives = 42/121 (34%), Gaps = 1/121 (0%)

Query: 3   QCIIFIINIVVVFFIDVMGFFILM-KCGADPFYSRIFSIAVAFLVTWIPSRLFIFLKLRR 61
           +   F +   +   I  +  + +M +   +   S + +  +A    +I  + +IF   ++
Sbjct: 6   RIFRFAVIGTLNALITAVTIWFMMDELDINYMLSNVTAYILAQTHNFIWCKYWIFPTEKK 65

Query: 62  KSFLETVRYGVMYFMLSILNYAFYVKLLLTFQGLQPLLATVLSAVSSMLFVFLLYIRFMT 121
            +    V    + F ++      ++  L+        LA  L         FL+  +   
Sbjct: 66  SNTWRQVLLFSIAFGMAYCAQFIFLIGLVEGLNCDEYLAQFLGLFVYGGVNFLMNKKVTF 125

Query: 122 R 122
           +
Sbjct: 126 K 126


>gi|308235649|ref|ZP_07666386.1| GtrA-like protein [Gardnerella vaginalis ATCC 14018]
          Length = 169

 Score = 57.2 bits (137), Expect = 7e-07,   Method: Composition-based stats.
 Identities = 18/129 (13%), Positives = 51/129 (39%), Gaps = 10/129 (7%)

Query: 1   MKQCIIFIINIVVVFFIDVMGFFILMKCGADPFYSRIFSIAVAFLVTWIPSRLFIFLKL- 59
           ++Q + F I  ++   IDV+   +L+    +   +   S  ++ +  +I S  ++F    
Sbjct: 5   IEQVVKFGIVGIIALIIDVVLLNLLLLVHLNNVVAGTISFIISLIFNYIASMKYVFKHRE 64

Query: 60  RRKSFLETVRYGVMYFMLSILNYAFYVKLLLTFQ---------GLQPLLATVLSAVSSML 110
               ++E + + +   +  ++N A      L             L+  +  +++ V   +
Sbjct: 65  DMARWMELLIFIISAVIGLLINDAIIWLSTLGMAQTLRGTAIYMLRTNIGKLIATVVVAV 124

Query: 111 FVFLLYIRF 119
           + F++    
Sbjct: 125 WNFVIRKWL 133


>gi|313896940|ref|ZP_07830487.1| GtrA-like protein [Selenomonas sp. oral taxon 137 str. F0430]
 gi|312974387|gb|EFR39855.1| GtrA-like protein [Selenomonas sp. oral taxon 137 str. F0430]
          Length = 130

 Score = 57.2 bits (137), Expect = 7e-07,   Method: Composition-based stats.
 Identities = 18/121 (14%), Positives = 47/121 (38%), Gaps = 2/121 (1%)

Query: 1   MKQCIIFIINIVVVFFIDVMGFFILM-KCGADPFYSRIFSIAVAFLVTWIPSRLFIFLKL 59
           + + + F++     F +D    ++L    G     S   S  V+  + +    + +F   
Sbjct: 7   LYEVLRFVLVGGACFLLDYGLLYVLTAHLGVYYLVSAGISFTVSVFLNYWLCLVCVFRGA 66

Query: 60  RRKSFLETVRYGVMYFMLSILNYAFYVKLLLTFQGLQPLLATVLSAVSSMLFVFLLYIRF 119
             ++    + +         LN    +  L+    +  ++A +++A   ML+ ++L  R 
Sbjct: 67  AAQTRRAKMLFFGSSIAGLGLNQ-LLMWSLVDLLHIHYMIAKLIAAGIVMLWNYVLKRRA 125

Query: 120 M 120
           +
Sbjct: 126 V 126


>gi|302544322|ref|ZP_07296664.1| glycosyl transferase, group 2 [Streptomyces hygroscopicus ATCC
           53653]
 gi|302461940|gb|EFL25033.1| glycosyl transferase, group 2 [Streptomyces himastatinicus ATCC
           53653]
          Length = 166

 Score = 57.2 bits (137), Expect = 7e-07,   Method: Composition-based stats.
 Identities = 15/104 (14%), Positives = 33/104 (31%), Gaps = 3/104 (2%)

Query: 20  MGFFILMKCGADPFYSRIFSIAVAFLVTWIPSRLFIFLKLRRKSFLETVRYGVMYFMLSI 79
             F +    G     +   ++ +A +  ++ +  + F           V++ V       
Sbjct: 63  ALFALYHWAGLPLLVASGIAVELAVVHNFLLNDRWTFAVPTPS-AGRFVKFNVSVLGGLA 121

Query: 80  LNYAFYVKLLLTFQGLQPLLATVLSAVSSMLFVFLLYIRFMTRR 123
           +N        L   G+  LLA  L   ++    F     ++  R
Sbjct: 122 VNVVL--VWSLVRSGMHLLLANCLGISAAFAVNFACSTGWVWGR 163



 Score = 35.6 bits (81), Expect = 2.4,   Method: Composition-based stats.
 Identities = 10/59 (16%), Positives = 29/59 (49%)

Query: 3   QCIIFIINIVVVFFIDVMGFFILMKCGADPFYSRIFSIAVAFLVTWIPSRLFIFLKLRR 61
           + + F ++++    ++V+  + L++ G     +    I+ AF V +  S  +++ +  R
Sbjct: 108 RFVKFNVSVLGGLAVNVVLVWSLVRSGMHLLLANCLGISAAFAVNFACSTGWVWGRRSR 166


>gi|209965484|ref|YP_002298399.1| hypothetical protein RC1_2199 [Rhodospirillum centenum SW]
 gi|209958950|gb|ACI99586.1| conserved hypothetical protein [Rhodospirillum centenum SW]
          Length = 163

 Score = 57.2 bits (137), Expect = 7e-07,   Method: Composition-based stats.
 Identities = 23/134 (17%), Positives = 49/134 (36%), Gaps = 13/134 (9%)

Query: 2   KQCIIFIINIVVVFFIDVMGFFILMK-CGADPFYSRIFSIAVAFLVTWIPSRLFIFLKLR 60
           ++ + F    V    +D+    + M+  GA+ +  R+ S   A   TW  +R+F F    
Sbjct: 28  REMLTFAAIGVGGAAVDMAALALAMEGAGANFYVGRLVSYFCAATFTWYMNRVFTFRSRG 87

Query: 61  RKSFL-ETVRYGVMYFMLSILNYAFYVKLLLTFQ-----------GLQPLLATVLSAVSS 108
           +   + + + +     +   +NY     ++                L P  A    +++ 
Sbjct: 88  KPGAVWQWLSFLAANGVGGAVNYGTSSAVVAGGPFLLPAALSPLLPLLPYAAVAAGSLAG 147

Query: 109 MLFVFLLYIRFMTR 122
           M F F+     + R
Sbjct: 148 MTFNFVASKWLVFR 161


>gi|300934431|ref|ZP_07149687.1| hypothetical protein CresD4_10198 [Corynebacterium resistens DSM
           45100]
          Length = 164

 Score = 57.2 bits (137), Expect = 7e-07,   Method: Composition-based stats.
 Identities = 17/126 (13%), Positives = 41/126 (32%), Gaps = 9/126 (7%)

Query: 4   CIIFIINIVVVFFIDVM-GFFILMKCGADPFYSRIFSIAVAFLVTWIPSRLFIFLKLRRK 62
              FI+       +D+    F+          S+        L  ++ +R + F     K
Sbjct: 31  LFRFILVGGFSAIVDLGSTLFLRFAFEMSDNLSKTIGFIFGTLTAYLINRRWTFNAAPSK 90

Query: 63  SFLETVRYGVMYFMLSILNYAFYVKLLLTFQG------LQPLLATVLSAVSSMLFVFLLY 116
                V   + Y +  ++    Y   +   +G         + + V++  ++ +  FL+ 
Sbjct: 91  --RRFVITMIAYGLTYLVQIGLYKVGIPWLEGFGLNDFWVRVFSFVIAQGAATILNFLIQ 148

Query: 117 IRFMTR 122
              + R
Sbjct: 149 RFIIFR 154


>gi|237744865|ref|ZP_04575346.1| glycosyltransferase [Fusobacterium sp. 7_1]
 gi|229432094|gb|EEO42306.1| glycosyltransferase [Fusobacterium sp. 7_1]
          Length = 360

 Score = 57.2 bits (137), Expect = 7e-07,   Method: Composition-based stats.
 Identities = 17/129 (13%), Positives = 51/129 (39%), Gaps = 11/129 (8%)

Query: 4   CIIFIINIVVVFFIDVM----GFFILMKCGADP-----FYSRIFSIAVAFLVTWIPSRLF 54
            + +I + +  F +D++       IL+  G          S I +  ++    +  ++ F
Sbjct: 233 FLKYIASAISSFILDILSFKWILAILIAFGNIERATIITISTIVARIISSTFNFYLNKKF 292

Query: 55  IFLKLRRKSFLETVRYGVMYFMLSILNYAFYVKLLLTFQGLQPLLATVLSAVSSMLFVFL 114
           +F    + +    ++Y  +  +  +L+ A +V ++  +         ++      L  + 
Sbjct: 293 VFKYE-KNTKKSLLKYYSLCIVQMLLS-AIFVTMVWKYTKFPETSIKIVVDSILFLLSYF 350

Query: 115 LYIRFMTRR 123
           +  R++ +R
Sbjct: 351 VQQRWVFKR 359


>gi|25027718|ref|NP_737772.1| hypothetical protein CE1162 [Corynebacterium efficiens YS-314]
 gi|23493000|dbj|BAC17972.1| hypothetical protein [Corynebacterium efficiens YS-314]
          Length = 188

 Score = 57.2 bits (137), Expect = 7e-07,   Method: Composition-based stats.
 Identities = 18/164 (10%), Positives = 42/164 (25%), Gaps = 38/164 (23%)

Query: 2   KQCIIFIINIVVVFFIDVMGFFILMKCGAD----------------------PFYSRIFS 39
           +Q I F +       +++    +  K                                 +
Sbjct: 17  RQFIKFGLVGGSGTIVNLAVAALSKKIAGWTAGISEHDPFMNLLGTDFHIRWYHVFMTIA 76

Query: 40  IAVAFLVTWIPSRLFIFLK-LRRKSFLETVRYGVMYFMLSILNYAFYVKLLLTFQGLQ-- 96
             VA +  +  +R + F     R  +     +     +  +++      L+     L   
Sbjct: 77  FLVANIWNYQLNRTWTFKMINMRSWWRGFFPFLATGLVAFVVSQVVTTLLMNPTSPLALS 136

Query: 97  -------------PLLATVLSAVSSMLFVFLLYIRFMTRRVYFI 127
                           A  +S + SM   F++   +  R+   I
Sbjct: 137 SEIFDDSTGLRTKFYWALTISILISMPVNFIVNKYWAFRKPKTI 180


>gi|227506062|ref|ZP_03936111.1| membrane protein [Corynebacterium striatum ATCC 6940]
 gi|227197344|gb|EEI77392.1| membrane protein [Corynebacterium striatum ATCC 6940]
          Length = 172

 Score = 57.2 bits (137), Expect = 7e-07,   Method: Composition-based stats.
 Identities = 16/124 (12%), Positives = 35/124 (28%), Gaps = 4/124 (3%)

Query: 3   QCIIFIINIVVVFFIDVMGFFILMKCGADPFYSRIFSIAVAFLVTWIPSRLFIFLKLRRK 62
           Q   F+   V    ID     +L   G     ++        +  +I +  + F      
Sbjct: 47  QLFRFVSVGVFTAAIDYGLTLLLTSLGLHRSAAKAIGWVFGTIAAYIANARWTFGAQVSG 106

Query: 63  SFLETVRYGVMYFMLSILNYAFYVKLLLTFQGLQ----PLLATVLSAVSSMLFVFLLYIR 118
                V               + +   L   G +      +A V++   + +  F +   
Sbjct: 107 RTAGAVAALYASTFAVQNFLYWALNAPLISMGFEGAVKDTIAFVIAQGVATVTNFAIQRI 166

Query: 119 FMTR 122
           F+ +
Sbjct: 167 FIFK 170


>gi|25026728|ref|NP_736782.1| hypothetical protein CE0172 [Corynebacterium efficiens YS-314]
 gi|23492007|dbj|BAC16982.1| conserved hypothetical protein [Corynebacterium efficiens YS-314]
          Length = 159

 Score = 57.2 bits (137), Expect = 7e-07,   Method: Composition-based stats.
 Identities = 17/127 (13%), Positives = 41/127 (32%), Gaps = 9/127 (7%)

Query: 3   QCIIFIINIVVVFFIDVMGFFIL-MKCGADPFYSRIFSIAVAFLVTWIPSRLFIFLKLRR 61
           Q   FII   +   +D+    +  +  G     +R  S        ++ +R + F     
Sbjct: 35  QAFRFIITGGISAVVDLGLLALFQLVFGFPVPVARTISFIAGTTTAYMINRRWTFQA--E 92

Query: 62  KSFLETVRYGVMYFMLSILNYAFYVKLLLTFQGLQP------LLATVLSAVSSMLFVFLL 115
           KS    +    +Y    ++N          F           ++A +++  +     F++
Sbjct: 93  KSTGRFLAVVALYAATFLVNVGLQTLFDALFTSWDWPASVALVVAFIIAQGTGTTINFIV 152

Query: 116 YIRFMTR 122
               + +
Sbjct: 153 QRMVIFK 159


>gi|311896582|dbj|BAJ28990.1| hypothetical protein KSE_31800 [Kitasatospora setae KM-6054]
          Length = 148

 Score = 57.2 bits (137), Expect = 7e-07,   Method: Composition-based stats.
 Identities = 18/120 (15%), Positives = 52/120 (43%), Gaps = 4/120 (3%)

Query: 4   CIIFIINIVVVFFIDVMGFFILMK-CGADPFYSRIFSIAVAFLVTWIPSRLFIFLKLRRK 62
            + F++   +   +D+   ++L          + + S+ V+F+V +  +R++ F  ++  
Sbjct: 30  LLRFLLAGGLSTGVDIALLYVLHGTLHVQLTVATLISVIVSFVVNFTLNRVWSFGSVQ-P 88

Query: 63  SFLETVRYGVMYFMLSILNYAFYVKLLLTFQGLQPLLATVLSAVSSMLFVFLLYIRFMTR 122
              + VRY ++     +          L   G+  LLA +++   + +  ++ Y  ++ +
Sbjct: 89  VGSQMVRYLILAGFNWVSTALLVSG--LAAIGVFYLLARLITIAVNSVINYIAYKHWVFK 146


>gi|260494646|ref|ZP_05814776.1| dolichyl-phosphate beta-D-mannosyltransferase [Fusobacterium sp.
           3_1_33]
 gi|260197808|gb|EEW95325.1| dolichyl-phosphate beta-D-mannosyltransferase [Fusobacterium sp.
           3_1_33]
          Length = 360

 Score = 57.2 bits (137), Expect = 7e-07,   Method: Composition-based stats.
 Identities = 17/129 (13%), Positives = 51/129 (39%), Gaps = 11/129 (8%)

Query: 4   CIIFIINIVVVFFIDVM----GFFILMKCGADP-----FYSRIFSIAVAFLVTWIPSRLF 54
            + +I + +  F +D++       IL+  G          S I +  ++    +  ++ F
Sbjct: 233 FLKYIASAISSFILDILSFKWILAILIAFGNIERASIITISTIVARIISSTFNFYLNKKF 292

Query: 55  IFLKLRRKSFLETVRYGVMYFMLSILNYAFYVKLLLTFQGLQPLLATVLSAVSSMLFVFL 114
           +F    + +    ++Y  +  +  +L+ A +V ++  +         ++      L  + 
Sbjct: 293 VFKYE-KNTKKSLLKYYSLCIVQMLLS-AIFVTMVWKYTKFPETSIKIVVDSILFLLSYF 350

Query: 115 LYIRFMTRR 123
           +  R++ +R
Sbjct: 351 VQQRWVFKR 359


>gi|254295547|ref|YP_003061569.1| GtrA family protein [Hirschia baltica ATCC 49814]
 gi|254044078|gb|ACT60872.1| GtrA family protein [Hirschia baltica ATCC 49814]
          Length = 146

 Score = 57.2 bits (137), Expect = 7e-07,   Method: Composition-based stats.
 Identities = 17/121 (14%), Positives = 47/121 (38%), Gaps = 3/121 (2%)

Query: 2   KQCIIFIINIVVVFFIDVMGFFILMKCGADPFYSRIFSIAVAFLVTWIPSRLFIFLKLRR 61
           K+ I F++   V   + +       + G     S   ++ ++ + +++  ++F F    +
Sbjct: 21  KKLIRFVLVGGVNTLLYLGLAIGFHEFGLSLDLSHALALFLSLVTSYLGHKIFTFEVKGQ 80

Query: 62  KSFLETVRYGVMYFMLSILNYAFYVKLLLTFQGLQPLLATVLSAVSSMLFVFLLYIRFMT 121
                  R+ +   ++ +  Y   V L  T      +L  + S+    +  F+++  +  
Sbjct: 81  H-KKSGFRFVIATILIMLTQYGLIVLLKQTHLAANLIL--LASSAYYPISSFIIHNCWTF 137

Query: 122 R 122
           R
Sbjct: 138 R 138


>gi|90425709|ref|YP_534079.1| GtrA-like protein [Rhodopseudomonas palustris BisB18]
 gi|90107723|gb|ABD89760.1| GtrA-like protein [Rhodopseudomonas palustris BisB18]
          Length = 176

 Score = 57.2 bits (137), Expect = 7e-07,   Method: Composition-based stats.
 Identities = 25/124 (20%), Positives = 47/124 (37%), Gaps = 6/124 (4%)

Query: 3   QCIIFIINIVVVFFIDVMGFFILM-KCGADPFYSRIFSIAVAFLVTWIPSRLFIFLK--L 59
           + + F +  V+  FID+  F +     G     S + + AVA   ++I +    F +   
Sbjct: 48  KAVSFALVGVINAFIDLGVFLVFYDWIGVPLVASNVLAWAVAVSCSYIMNSFTTFGRESG 107

Query: 60  RRKSFLETVRYGVMYFMLSILNYAFYVKLLLTFQGLQPLLATVLSAVSSMLFVFLLYIRF 119
            +    + +++ V             V L L       L A ++S + S +  F L    
Sbjct: 108 GKLRLRDYLKFVVSGIAGVTAATTTLVVLSLYLP---VLTAKLVSILVSFVVNFSLSHFV 164

Query: 120 MTRR 123
           + RR
Sbjct: 165 VFRR 168


>gi|149275756|ref|ZP_01881901.1| hypothetical protein PBAL39_20835 [Pedobacter sp. BAL39]
 gi|149233184|gb|EDM38558.1| hypothetical protein PBAL39_20835 [Pedobacter sp. BAL39]
          Length = 143

 Score = 57.2 bits (137), Expect = 8e-07,   Method: Composition-based stats.
 Identities = 14/126 (11%), Positives = 38/126 (30%), Gaps = 5/126 (3%)

Query: 9   INIVVVFFIDVMGFFILMKC-GADPFYSRIFSIAVAFLVTWIPSRLFIFLKLRRKS---- 63
           I+      +D     +  +        S         +V +  +R + F      +    
Sbjct: 15  ISAFSGGLLDYGVMILCTELLHIHYTISIAIGGVTGAVVNFCINRYWTFNAKGPSAQHHV 74

Query: 64  FLETVRYGVMYFMLSILNYAFYVKLLLTFQGLQPLLATVLSAVSSMLFVFLLYIRFMTRR 123
             + +++  +      L  +         +    L   V+  + S  F + L   ++ R+
Sbjct: 75  GKQLIKFIFVVAGSICLKSSGTYLFTTWTRLDYKLSRIVVDLIVSFGFNYTLQKYWVFRQ 134

Query: 124 VYFIKK 129
              +K+
Sbjct: 135 SPAMKQ 140


>gi|229815617|ref|ZP_04445944.1| hypothetical protein COLINT_02668 [Collinsella intestinalis DSM
           13280]
 gi|229808847|gb|EEP44622.1| hypothetical protein COLINT_02668 [Collinsella intestinalis DSM
           13280]
          Length = 131

 Score = 57.2 bits (137), Expect = 8e-07,   Method: Composition-based stats.
 Identities = 22/121 (18%), Positives = 44/121 (36%), Gaps = 3/121 (2%)

Query: 1   MKQCIIFIINIVVVFFIDVMGFFILMK-CGADPFYSRIFSIAVAFLVTWIPSRLFIFLKL 59
           + Q   F +  +V   ID     +L      D  ++      V+ +  +  S  F+F   
Sbjct: 5   LSQLAKFGVVGIVATLIDFGIMNLLHYGAHLDILFANTAGFVVSLIFNYAASMKFVFEHK 64

Query: 60  -RRKSFLETVRYGVMYFMLSILNYAFYVKLLLTFQGLQPLLATVLSAVSSMLFVFLLYIR 118
                  E + + V+  +  ILN    V  L     ++  +A + +    M++ F+    
Sbjct: 65  DGMSRGREFIIFVVLSVIGLILNDGI-VLTLNKGLSVEANVAKIAATALVMIYNFVTRKI 123

Query: 119 F 119
           F
Sbjct: 124 F 124


>gi|298571364|gb|ADI87706.1| hypothetical protein LW3_0030 [uncultured Nitrospirae bacterium
           MY3-5B]
          Length = 146

 Score = 56.8 bits (136), Expect = 8e-07,   Method: Composition-based stats.
 Identities = 14/139 (10%), Positives = 50/139 (35%), Gaps = 16/139 (11%)

Query: 1   MKQCIIFIINIVVVFFIDVMGFFILMKC-----GADPFYSRIFSIAVAFLVTWIPSRLFI 55
           ++Q I F +  V+   +D++   +         G+     +  S       ++  ++ + 
Sbjct: 8   IRQFICFALIGVLNTVVDLLILNVETLITGMKEGSPYALQKGISFLGGVACSYYFNKRWA 67

Query: 56  FLKLRRKS-FLETVRYGVMYFMLSILNYAFYVKLLLTFQGL----------QPLLATVLS 104
           F    R+   ++   +  +  + +++N A     +   + +             +  +  
Sbjct: 68  FNDKSRERQGVKISLFMAISVIGALINVAVATLSVTYLRPMIHHGLLTGQVWVNIGALSG 127

Query: 105 AVSSMLFVFLLYIRFMTRR 123
             +++ + FL Y   + ++
Sbjct: 128 TAAALAWNFLGYKFLVFKK 146


>gi|253827843|ref|ZP_04870728.1| hypothetical protein HCAN_1198 [Helicobacter canadensis MIT
           98-5491]
 gi|253511249|gb|EES89908.1| hypothetical protein HCAN_1198 [Helicobacter canadensis MIT
           98-5491]
          Length = 142

 Score = 56.8 bits (136), Expect = 9e-07,   Method: Composition-based stats.
 Identities = 18/120 (15%), Positives = 42/120 (35%), Gaps = 4/120 (3%)

Query: 3   QCIIFIINIVVVFFIDVMGFFILMKCGADPFYSRIFSIAVAFLVTWIPSRLFIFLKLRRK 62
           Q + + I   +   I     F LM  G     +      +  +++++ +  F F      
Sbjct: 17  QFLRYCIIGSINTIIGFGIIFFLMAFGVFAEMANFIGYCMGIIISFMLNSQFTFKAKHNY 76

Query: 63  SFLETVRYGVMYFMLSILNYAFYVKLLLTFQGLQPLLATVLSAVSSMLFVFLLYIRFMTR 122
           +    +R+ +   +  +LN    +        L P L+ + + +      FL    F+ +
Sbjct: 77  A---FLRFCLAMGVSYLLNLLTLMFC-YRILLLNPYLSQIFAGIIYTGSGFLFSKYFVFK 132


>gi|268609103|ref|ZP_06142830.1| GtrA family protein [Ruminococcus flavefaciens FD-1]
          Length = 161

 Score = 56.8 bits (136), Expect = 9e-07,   Method: Composition-based stats.
 Identities = 18/130 (13%), Positives = 46/130 (35%), Gaps = 9/130 (6%)

Query: 3   QCIIFIINIVVVFFIDVMGFFILMKCGADP-----FYSRIFSIAVAFLVTWIPSRLFIFL 57
           Q   ++    + F +D    ++L            + +   S      V +I S  +IF 
Sbjct: 27  QFFRYLFVGGLAFLVDFAVSWLLFHFVFGDRKELGWVANSLSFVAGLAVNYIISTFWIFK 86

Query: 58  KLR-RKSFLETVRYGVMYFMLSILNYA---FYVKLLLTFQGLQPLLATVLSAVSSMLFVF 113
           + + +   +E + +  +  +  ++       +   L     L  ++A ++S   S L+ F
Sbjct: 87  ESKVKNKLVEFISFAAIGVVGLLITIGITKLFEIWLGDTTSLFQIIAKLVSTAVSFLWNF 146

Query: 114 LLYIRFMTRR 123
                 +  +
Sbjct: 147 FARKILLYTK 156


>gi|260578981|ref|ZP_05846883.1| membrane protein [Corynebacterium jeikeium ATCC 43734]
 gi|258602846|gb|EEW16121.1| membrane protein [Corynebacterium jeikeium ATCC 43734]
          Length = 133

 Score = 56.8 bits (136), Expect = 9e-07,   Method: Composition-based stats.
 Identities = 21/121 (17%), Positives = 42/121 (34%)

Query: 2   KQCIIFIINIVVVFFIDVMGFFILMKCGADPFYSRIFSIAVAFLVTWIPSRLFIFLKLRR 61
           ++ +IF +  VV    D     +L+  G   F +R  S  V   V +  +  F F   R 
Sbjct: 8   RKLVIFTLVGVVGACFDFGTRTLLLNLGVIGFVARACSYIVGSTVAYYLNSFFTFQGDRS 67

Query: 62  KSFLETVRYGVMYFMLSILNYAFYVKLLLTFQGLQPLLATVLSAVSSMLFVFLLYIRFMT 121
            +             L+ +     ++   T        +  +S   + +  F+L   ++ 
Sbjct: 68  GTEKARAAVVYTICFLTAVVVDALMRNWGTDLPHILFWSWFVSQAVATVLNFVLQNTWVF 127

Query: 122 R 122
           R
Sbjct: 128 R 128


>gi|329960002|ref|ZP_08298498.1| GtrA-like protein [Bacteroides fluxus YIT 12057]
 gi|328533136|gb|EGF59905.1| GtrA-like protein [Bacteroides fluxus YIT 12057]
          Length = 126

 Score = 56.8 bits (136), Expect = 9e-07,   Method: Composition-based stats.
 Identities = 17/120 (14%), Positives = 44/120 (36%), Gaps = 1/120 (0%)

Query: 3   QCIIFIINIVVVFFIDVMGFFILM-KCGADPFYSRIFSIAVAFLVTWIPSRLFIFLKLRR 61
           +   F +   +   I     +++M +   +   S + +  +A +  +I  + +IF   ++
Sbjct: 6   RIFRFAVIGTLNALIMAATVWVMMDELDINYMLSNVTAYILAQIHNFIWCKYWIFPSKKK 65

Query: 62  KSFLETVRYGVMYFMLSILNYAFYVKLLLTFQGLQPLLATVLSAVSSMLFVFLLYIRFMT 121
            +  + V    + F ++      ++  L+        LA  L         FL+  +F  
Sbjct: 66  SNTWQQVLLFSIAFGMAYGAQFTFLIGLVEGLDCDEYLAQFLGLFVYGGVNFLMNKKFTF 125


>gi|319950273|ref|ZP_08024194.1| GtrA-like protein [Dietzia cinnamea P4]
 gi|319436071|gb|EFV91270.1| GtrA-like protein [Dietzia cinnamea P4]
          Length = 188

 Score = 56.8 bits (136), Expect = 9e-07,   Method: Composition-based stats.
 Identities = 18/159 (11%), Positives = 50/159 (31%), Gaps = 36/159 (22%)

Query: 2   KQCIIFIINIVVVFFIDVMGFFILMKCGADPFYSR--------------------IFSIA 41
           +Q ++F I       ++++   ++ K       ++                    I +  
Sbjct: 16  RQFVMFGIVGGSGMVVNMIVTVLMNKANGGTANAQEILFPIAGTEFNFRFTTLVWIVAFL 75

Query: 42  VAFLVTWIPSRLFIFLKLRR-KSFLETVRYGVMYFMLSILNYAFYVKL-------LLTFQ 93
           VA    ++ +R + F K  +  ++ E   + V+  + +       +          L   
Sbjct: 76  VANFYNFLLNRHWTFGKGHKAPAWQEFWPFLVVGSVAAGAGIFIKLAFTNPTSPLYLPEP 135

Query: 94  GLQ--------PLLATVLSAVSSMLFVFLLYIRFMTRRV 124
                         + +L+ + +M   F++   +  R V
Sbjct: 136 WWHEEAGIHSREYWSQLLTILITMPINFVVNKLWTFRAV 174


>gi|154687946|ref|YP_001423107.1| YwcD [Bacillus amyloliquefaciens FZB42]
 gi|154353797|gb|ABS75876.1| YwcD [Bacillus amyloliquefaciens FZB42]
          Length = 135

 Score = 56.8 bits (136), Expect = 9e-07,   Method: Composition-based stats.
 Identities = 17/128 (13%), Positives = 54/128 (42%), Gaps = 5/128 (3%)

Query: 2   KQCIIFIINIVVVFFIDVMGFFILMK-CGADPFYSRIFSIAVAFLVTWIPSRLFIFLKLR 60
           ++ +++II  +    +++  F+ L      D   + + +  ++ L  ++ ++L++F +  
Sbjct: 4   REIMMYIIMGIFTTIVNIASFYFLTSAFEMDYKAATVAAWILSVLFAYVTNKLYVFQQKT 63

Query: 61  ---RKSFLETVRYGVMYFMLSILNYAFYVKLLLTFQGLQPLLATVLSAVSSMLFVFLLYI 117
              R    E   +  +  +   ++ A  + LL++   +   LA +   V  ++  +    
Sbjct: 64  AGMRSLMKELTAFFSVRVLSLTIDLA-MMILLVSQFHMNETLAKIADNVIIVVVNYAASK 122

Query: 118 RFMTRRVY 125
             + R+  
Sbjct: 123 WIVFRKAK 130


>gi|308175548|ref|YP_003922253.1| teichoic acid glycosylation protein [Bacillus amyloliquefaciens DSM
           7]
 gi|307608412|emb|CBI44783.1| teichoic acid glycosylation protein [Bacillus amyloliquefaciens DSM
           7]
 gi|328555526|gb|AEB26018.1| teichoic acid glycosylation protein [Bacillus amyloliquefaciens
           TA208]
          Length = 135

 Score = 56.8 bits (136), Expect = 9e-07,   Method: Composition-based stats.
 Identities = 19/128 (14%), Positives = 56/128 (43%), Gaps = 5/128 (3%)

Query: 2   KQCIIFIINIVVVFFIDVMGFFILMK-CGADPFYSRIFSIAVAFLVTWIPSRLFIFLKLR 60
           ++ +++II  V    ++++ F+IL      D   + + +  ++ L  ++ ++L++F +  
Sbjct: 4   REIMMYIIMGVFTTIVNIVSFYILTSVFQMDYKMATVAAWILSVLFAYVTNKLYVFQQKT 63

Query: 61  ---RKSFLETVRYGVMYFMLSILNYAFYVKLLLTFQGLQPLLATVLSAVSSMLFVFLLYI 117
              R    E   +  +  +   ++ A  + LL++   +   LA +   V  ++  +    
Sbjct: 64  AGMRSLMKELTAFFSVRVLSLGIDLA-MMILLVSQFHMNETLAKIADNVIIVVVNYAASK 122

Query: 118 RFMTRRVY 125
             + R+  
Sbjct: 123 WIVFRKAK 130


>gi|29348799|ref|NP_812302.1| hypothetical protein BT_3390 [Bacteroides thetaiotaomicron
           VPI-5482]
 gi|253568857|ref|ZP_04846267.1| conserved hypothetical protein [Bacteroides sp. 1_1_6]
 gi|29340705|gb|AAO78496.1| GtrA-like protein [Bacteroides thetaiotaomicron VPI-5482]
 gi|251840876|gb|EES68957.1| conserved hypothetical protein [Bacteroides sp. 1_1_6]
          Length = 143

 Score = 56.8 bits (136), Expect = 1e-06,   Method: Composition-based stats.
 Identities = 14/121 (11%), Positives = 41/121 (33%), Gaps = 6/121 (4%)

Query: 3   QCIIFIINIVVVFFIDVMGFFILMKCGADPF-YSRIFSIAVAFLVTWIPSRLFIFLKLRR 61
           Q I +     +   I    +++L +        +       +F+  +  +  F F     
Sbjct: 16  QFIRYCTVGTLAAGIHYGVYYLLQEYEMTNLNIAYTIGYVTSFICNFFLTSYFTF--RSN 73

Query: 62  KSFLETVRYGVMYFMLSILNYAFYVKLLLTFQGLQPLLATVLSAVSSMLFVFLLYIRFMT 121
            S    + +G  + +  +++   +   L     +   +A +     ++   FL+   F+ 
Sbjct: 74  PSLKRALGFGGSHLVNYLIHMGLFNLFLY--LNVDQEIAPLCVLAVAVPTNFLMLR-FVF 130

Query: 122 R 122
           +
Sbjct: 131 K 131


>gi|322373516|ref|ZP_08048052.1| GtrA family protein [Streptococcus sp. C150]
 gi|321278558|gb|EFX55627.1| GtrA family protein [Streptococcus sp. C150]
          Length = 353

 Score = 56.8 bits (136), Expect = 1e-06,   Method: Composition-based stats.
 Identities = 16/123 (13%), Positives = 45/123 (36%), Gaps = 8/123 (6%)

Query: 4   CIIFIINIVVVFFIDVMGFFILMKCGAD-----PFYSRIFSIAVAFLVTWIPSRLFIFLK 58
              +I + +  F +D++ F IL+             + I +  ++ +V +  +   +F +
Sbjct: 227 FFKYIFSSLFSFLVDIVAFTILISLFNGLSFSAVTLASILARVISSVVNFTLNHKVVFKQ 286

Query: 59  LRRKSFLETVRYGVMYFMLSILNYAFYVKLLLTFQGLQPLLATVLSAVSSMLFVFLLYIR 118
            +  S    ++Y  +  +  +L+      L      L   L  +L   +  +  + +   
Sbjct: 287 GQSNSA---IKYFTLVVVQIVLSSLLVTVLGNALTTLPISLVKILVDGALFIASYFVQKH 343

Query: 119 FMT 121
            + 
Sbjct: 344 LIF 346


>gi|288549799|ref|ZP_05968189.2| hypothetical conserved membrane protein [Enterobacter cancerogenus
           ATCC 35316]
 gi|288317422|gb|EFC56360.1| hypothetical conserved membrane protein [Enterobacter cancerogenus
           ATCC 35316]
          Length = 134

 Score = 56.8 bits (136), Expect = 1e-06,   Method: Composition-based stats.
 Identities = 26/127 (20%), Positives = 56/127 (44%), Gaps = 5/127 (3%)

Query: 1   MKQCIIFIINIVVVFFIDVMGFFILMKCGADPFYSRIFSIAVAFLVTWIPSRLFIFLKLR 60
           +++   F I+  + F +D    ++L++    P+ +R  S   A L TW+ +R   F   R
Sbjct: 5   LRELFFFAISGGLGFLVDTAVLYLLIE-SLGPYIARGLSFFSAVLFTWLFNRSITFKGKR 63

Query: 61  R--KSFLETVRYGVMYFMLSILNYAFYVKLLLTFQGL--QPLLATVLSAVSSMLFVFLLY 116
              K+  E V Y ++      +NY  Y  L+ +++ +   P++     +++ M       
Sbjct: 64  SNMKAGSEFVSYLLLMLCGGAVNYGLYSWLISSYEIVLEHPIIGVAAGSIAGMFVNLATS 123

Query: 117 IRFMTRR 123
              + R+
Sbjct: 124 KLILFRK 130


>gi|262068194|ref|ZP_06027806.1| dolichyl-phosphate beta-D-mannosyltransferase [Fusobacterium
           periodonticum ATCC 33693]
 gi|291378062|gb|EFE85580.1| dolichyl-phosphate beta-D-mannosyltransferase [Fusobacterium
           periodonticum ATCC 33693]
          Length = 360

 Score = 56.8 bits (136), Expect = 1e-06,   Method: Composition-based stats.
 Identities = 16/129 (12%), Positives = 51/129 (39%), Gaps = 11/129 (8%)

Query: 4   CIIFIINIVVVFFIDVM----GFFILMKCGADP-----FYSRIFSIAVAFLVTWIPSRLF 54
            + +I + V  F +D++       +L+  G          + + +  ++    +  ++ F
Sbjct: 233 FLKYIASAVSSFILDILSFKWILALLLAFGNIEGAAVITIATVAARILSSSFNFYLNKKF 292

Query: 55  IFLKLRRKSFLETVRYGVMYFMLSILNYAFYVKLLLTFQGLQPLLATVLSAVSSMLFVFL 114
           +F    + +    ++Y  +  +  +++ AF+V L+            ++      L  + 
Sbjct: 293 VFKYE-KNTKKSLLKYYSLCAVQMLIS-AFFVTLVWKHTKYPETSIKIVVDSILFLLSYF 350

Query: 115 LYIRFMTRR 123
           +  R++ +R
Sbjct: 351 IQQRWVFKR 359


>gi|317499190|ref|ZP_07957465.1| GtrA-like protein [Lachnospiraceae bacterium 5_1_63FAA]
 gi|316893504|gb|EFV15711.1| GtrA-like protein [Lachnospiraceae bacterium 5_1_63FAA]
          Length = 138

 Score = 56.8 bits (136), Expect = 1e-06,   Method: Composition-based stats.
 Identities = 16/122 (13%), Positives = 48/122 (39%), Gaps = 5/122 (4%)

Query: 5   IIFIINIVVVFFIDVMGFFILMK-CGADPFYSRIFSIAVAFLVTWIPSRLFIFLKLRRK- 62
           I ++    +   +++  F +L   CG D   S  FS+A+A    ++ ++L++F       
Sbjct: 14  IRYLFFGGLTTLVNLGMFALLKGPCGIDYKISNFFSVAIAICFAFVVNKLYVFQSKSESF 73

Query: 63  --SFLETVRYGVMYFMLSILNYAFYVKLLLTFQGLQPLLATVLSAVSSMLFVFLLYIRFM 120
             +  E +++ +   +   +         +       ++A + + V   +  + +    +
Sbjct: 74  TDTIHEFIKFVLGRLVTMAVEVGGVPFC-VEILHQPQMIAKLETQVIVTVVNYFISKFLV 132

Query: 121 TR 122
            +
Sbjct: 133 FK 134


>gi|167768448|ref|ZP_02440501.1| hypothetical protein CLOSS21_03007 [Clostridium sp. SS2/1]
 gi|167709972|gb|EDS20551.1| hypothetical protein CLOSS21_03007 [Clostridium sp. SS2/1]
 gi|291560422|emb|CBL39222.1| Predicted membrane protein [butyrate-producing bacterium SSC/2]
          Length = 138

 Score = 56.8 bits (136), Expect = 1e-06,   Method: Composition-based stats.
 Identities = 16/122 (13%), Positives = 48/122 (39%), Gaps = 5/122 (4%)

Query: 5   IIFIINIVVVFFIDVMGFFILMK-CGADPFYSRIFSIAVAFLVTWIPSRLFIFLKLRRK- 62
           I ++    +   +++  F +L   CG D   S  FS+A+A    ++ ++L++F       
Sbjct: 14  IRYLFFGGLTTLVNLGMFALLKGPCGIDYKISNFFSVAIAICFAFVVNKLYVFQSKSESF 73

Query: 63  --SFLETVRYGVMYFMLSILNYAFYVKLLLTFQGLQPLLATVLSAVSSMLFVFLLYIRFM 120
             +  E +++ +   +   +         +       ++A + + V   +  + +    +
Sbjct: 74  TDTIHEFIKFVLGRLVTMAVEVGGVPFC-VEILHQPQMIAKLETQVIVTIVNYFISKFLV 132

Query: 121 TR 122
            +
Sbjct: 133 FK 134


>gi|186477045|ref|YP_001858515.1| GtrA family protein [Burkholderia phymatum STM815]
 gi|184193504|gb|ACC71469.1| GtrA family protein [Burkholderia phymatum STM815]
          Length = 152

 Score = 56.8 bits (136), Expect = 1e-06,   Method: Composition-based stats.
 Identities = 23/126 (18%), Positives = 48/126 (38%), Gaps = 5/126 (3%)

Query: 1   MKQCIIFIINIVVVFFIDVMGFFILMKCGADPFYSRIFSIAVAFLVTWIPSRLFIFLKLR 60
           +++   F +   + F +D    + L K     FY R  S   A   TW+ +R + F   R
Sbjct: 10  IREIFAFGVVGTIGFVVDTSVLY-LTKGHFGLFYGRATSFVCAAFTTWLINRAWTFKSKR 68

Query: 61  RK--SFLETVRYGVMYFMLSILNYAFYVKLLLTFQGL--QPLLATVLSAVSSMLFVFLLY 116
               +  E   Y ++  M   +NY+ Y   +  +      P++     +++ M    +  
Sbjct: 69  SSLDAKSEFAVYFLLMLMGGAVNYSAYYFTISKYPLAASHPIIGVAAGSIAGMFVNLMSS 128

Query: 117 IRFMTR 122
              + +
Sbjct: 129 RMILFK 134


>gi|315613196|ref|ZP_07888106.1| GtrA family protein [Streptococcus sanguinis ATCC 49296]
 gi|315314758|gb|EFU62800.1| GtrA family protein [Streptococcus sanguinis ATCC 49296]
          Length = 347

 Score = 56.4 bits (135), Expect = 1e-06,   Method: Composition-based stats.
 Identities = 14/127 (11%), Positives = 47/127 (37%), Gaps = 8/127 (6%)

Query: 2   KQCIIFIINIVVVFFIDVMGFFI------LMKCGADPFYSRIFSIAVAFLVTWIPSRLFI 55
           K  + F ++    F +D + + +       +  G     S   +   + +  +  ++  +
Sbjct: 216 KNILKFALSSFSSFIVDYVVYALSILCLSFIPTGLRVLLSNSLARVTSSIFNFSTNKKLV 275

Query: 56  FLKLRRKSFLETVRYGVMYFMLSILNYAFYVKLLLTFQGLQPLLATVLSAVSSMLFVFLL 115
           F          +  +G+   +   +     ++L  +  G+  L+A +L  +   +  + +
Sbjct: 276 FKNKASSFKTGSGYFGL--AVGLFIIDTILIRLFNSGLGVNLLIAKILVGIMLFILSWTV 333

Query: 116 YIRFMTR 122
             R++ +
Sbjct: 334 QTRYIFK 340


>gi|331698785|ref|YP_004335024.1| family 2 glycosyl transferase [Pseudonocardia dioxanivorans CB1190]
 gi|326953474|gb|AEA27171.1| glycosyl transferase family 2 [Pseudonocardia dioxanivorans CB1190]
          Length = 420

 Score = 56.4 bits (135), Expect = 1e-06,   Method: Composition-based stats.
 Identities = 17/124 (13%), Positives = 38/124 (30%), Gaps = 5/124 (4%)

Query: 3   QCIIFIINIVVVFFIDVMGFFILMKCGADPFYSRIFSIAVAFLVTWIPSRLFIFLKLRRK 62
           Q   F    V       +  ++L++       + I ++ +        +R   F    R 
Sbjct: 284 QLARFAAIGVASTLA-NLLLYVLLRGMMGAIAANILALLLTTFANTAANRRLTFGVRGRA 342

Query: 63  SFL----ETVRYGVMYFMLSILNYAFYVKLLLTFQGLQPLLATVLSAVSSMLFVFLLYIR 118
                  + +    +   L+    A    L         L   VL+   + +  F+L+  
Sbjct: 343 GAGRHQFQGLVVFGLGLGLTTGALALLGSLAPGAGRSTELAVIVLANAVATVLRFVLFRS 402

Query: 119 FMTR 122
           ++ R
Sbjct: 403 WIFR 406


>gi|331695419|ref|YP_004331658.1| GtrA family protein [Pseudonocardia dioxanivorans CB1190]
 gi|326950108|gb|AEA23805.1| GtrA family protein [Pseudonocardia dioxanivorans CB1190]
          Length = 165

 Score = 56.4 bits (135), Expect = 1e-06,   Method: Composition-based stats.
 Identities = 19/124 (15%), Positives = 45/124 (36%), Gaps = 4/124 (3%)

Query: 1   MKQCIIFIINIVVVFFIDVMGFFILMKCGADPFYSRIFSIAVAFLVTWIPSRLFIFLKLR 60
           +++ + F +       ++   F++ M+    P  + I ++ V+  +T   +R F F  + 
Sbjct: 38  LRRLVRFAVVGATGTGLN-ALFYLAMRTWLPPVPANIVALLVSTALTTEMNRRFTFDGVV 96

Query: 61  RKSFLETVR---YGVMYFMLSILNYAFYVKLLLTFQGLQPLLATVLSAVSSMLFVFLLYI 117
              +  +V+     V Y   S         +       +   A   ++V   L  FL   
Sbjct: 97  APRWRASVQDVCTVVFYAFYSSGVLLLLDWVDPAAAAWEEAAAVAAASVLGGLLRFLAMR 156

Query: 118 RFMT 121
            ++ 
Sbjct: 157 YWVF 160


>gi|292670008|ref|ZP_06603434.1| hypothetical protein HMPREF7545_0972 [Selenomonas noxia ATCC 43541]
 gi|292648309|gb|EFF66281.1| hypothetical protein HMPREF7545_0972 [Selenomonas noxia ATCC 43541]
          Length = 128

 Score = 56.4 bits (135), Expect = 1e-06,   Method: Composition-based stats.
 Identities = 20/121 (16%), Positives = 48/121 (39%), Gaps = 2/121 (1%)

Query: 1   MKQCIIFIINIVVVFFIDVMGFFILM-KCGADPFYSRIFSIAVAFLVTWIPSRLFIFLKL 59
           + +   F++     F +D    ++L    G     S   S +V+  V +      +F   
Sbjct: 6   LYEIARFVLVGGACFVLDYGLLYVLTEYVGLYYLLSAGISFSVSVFVNYWLCLACVFRGA 65

Query: 60  RRKSFLETVRYGVMYFMLSILNYAFYVKLLLTFQGLQPLLATVLSAVSSMLFVFLLYIRF 119
             ++    + +         LN    + LL+ F  +  ++A +++A   M++ ++L  R 
Sbjct: 66  DAQTRRAKMLFFGSSIAGLGLNQ-LLMWLLVDFAHIYYMIAKLIAAGIVMIWNYVLKRRA 124

Query: 120 M 120
           +
Sbjct: 125 V 125


>gi|258510262|ref|YP_003183696.1| GtrA family protein [Alicyclobacillus acidocaldarius subsp.
           acidocaldarius DSM 446]
 gi|257476988|gb|ACV57307.1| GtrA family protein [Alicyclobacillus acidocaldarius subsp.
           acidocaldarius DSM 446]
          Length = 157

 Score = 56.4 bits (135), Expect = 1e-06,   Method: Composition-based stats.
 Identities = 21/135 (15%), Positives = 50/135 (37%), Gaps = 12/135 (8%)

Query: 5   IIFIINIVVVFFIDVMGFFILMKCGADP-----FYSRIFSIAVAFLVTWIPSRLFIFLKL 59
             F++  V+   +D+     L+                  +  A   +++ +R + F  +
Sbjct: 16  FKFLLVGVMNAAVDLGVLNALLLAFPTRSPLVLMAYNTIGVLAAICNSYLWNRFWTFGDI 75

Query: 60  RRKSFLETVRYGVMYFMLSILNYAFYVK---LLLTFQGLQPL----LATVLSAVSSMLFV 112
              S  E +++ +   +  +LN A  V     L+T +GL  +    +A   +   S    
Sbjct: 76  ATGSRREKMKFALQSLVNLVLNDAILVGANDYLVTHRGLPYMLGSNIAKGGAMFVSSSVS 135

Query: 113 FLLYIRFMTRRVYFI 127
           ++    F+ +R   +
Sbjct: 136 YVFMRMFVFKRRNVL 150


>gi|153854468|ref|ZP_01995746.1| hypothetical protein DORLON_01741 [Dorea longicatena DSM 13814]
 gi|149752994|gb|EDM62925.1| hypothetical protein DORLON_01741 [Dorea longicatena DSM 13814]
          Length = 145

 Score = 56.4 bits (135), Expect = 1e-06,   Method: Composition-based stats.
 Identities = 16/126 (12%), Positives = 48/126 (38%), Gaps = 7/126 (5%)

Query: 4   CIIFIINIVVVFFIDVMGFFILMK-CGADPFYSRIFSIAVAFLVTWIPSRLFIFLKLRRK 62
              F++  +V   +     F          + S   +  V  +V++  ++ F F    + 
Sbjct: 21  FWKFVLVGIVNTLVGTAVMFAAYNVLHLSYWISSASNYVVGSIVSYFLNKYFTFQNKEKS 80

Query: 63  SFLETVRYGVMYFMLSILNYAFYVKLLLTFQG-----LQPLLATVLSAVSSMLFVFLLYI 117
            + + V++ +   +  ++ Y     L+  F       +Q  L+ ++   + ++F ++   
Sbjct: 81  -WKQLVKFALNITVCYLVAYGLAKPLVSWFLHGQSKSVQDNLSMLVGMGAFVVFNYVGQR 139

Query: 118 RFMTRR 123
             + R+
Sbjct: 140 VIVFRK 145


>gi|227506061|ref|ZP_03936110.1| hypothetical membrane protein [Corynebacterium striatum ATCC 6940]
 gi|227197343|gb|EEI77391.1| hypothetical membrane protein [Corynebacterium striatum ATCC 6940]
          Length = 153

 Score = 56.4 bits (135), Expect = 1e-06,   Method: Composition-based stats.
 Identities = 20/127 (15%), Positives = 40/127 (31%), Gaps = 7/127 (5%)

Query: 3   QCIIFIINIVVVFFIDVMGFFILMKCGA--DPFYSRIFSIAVAFLVTWIPSRLFIFLKLR 60
           Q   F I  ++   ID    +I            +R        L  ++ +R + F    
Sbjct: 17  QGFKFAITGMIAAVIDAGLTWIFQIGLDLLGDVAARTVGFIFGTLTAYLLNRRWTFDAKA 76

Query: 61  RKSFLE-----TVRYGVMYFMLSILNYAFYVKLLLTFQGLQPLLATVLSAVSSMLFVFLL 115
            K  L            +  +L    + F+   L        ++A V++  ++ L  F +
Sbjct: 77  SKRRLAAVVATYALTYAVNIILYRWAFPFFDHDLEWPSSWALVVAFVIAQGTATLINFFV 136

Query: 116 YIRFMTR 122
               + R
Sbjct: 137 QRWVIFR 143


>gi|289582154|ref|YP_003480620.1| GtrA family protein [Natrialba magadii ATCC 43099]
 gi|289531707|gb|ADD06058.1| GtrA family protein [Natrialba magadii ATCC 43099]
          Length = 150

 Score = 56.4 bits (135), Expect = 1e-06,   Method: Composition-based stats.
 Identities = 18/125 (14%), Positives = 47/125 (37%), Gaps = 6/125 (4%)

Query: 3   QCIIFIINIVVVFFIDVMGFFILMKC-GADPFYSRIFSIAVAFLVTWIPSRLFIFLKLRR 61
           +   F    +V   +D  G   L++  G DP  +++ S  ++ +V ++ +  + F    +
Sbjct: 21  RFSQFASVGLVGATVDNAGLITLVELTGLDPVIAKVISWELSIIVIFLLNEYWTFAGHGK 80

Query: 62  KS----FLETVRYGVMYFMLSILNYAFYVKLLLTFQGLQPLLATVLSAVSSMLFVFLLYI 117
           +S        +R   + F   ++       L+  +  +  +LA V+         +    
Sbjct: 81  RSVSAFGRRFLRSNAVRFGGFLVTLTVLAVLVNWY-DVNYVLANVIGIGIGFFVNYTCES 139

Query: 118 RFMTR 122
            +  +
Sbjct: 140 LYTWK 144


>gi|288904581|ref|YP_003429802.1| glycosyltransferase [Streptococcus gallolyticus UCN34]
 gi|306830576|ref|ZP_07463743.1| GtrA family protein [Streptococcus gallolyticus subsp. gallolyticus
           TX20005]
 gi|288731306|emb|CBI12857.1| putative glycosyltransferase [Streptococcus gallolyticus UCN34]
 gi|304427294|gb|EFM30399.1| GtrA family protein [Streptococcus gallolyticus subsp. gallolyticus
           TX20005]
          Length = 355

 Score = 56.4 bits (135), Expect = 1e-06,   Method: Composition-based stats.
 Identities = 16/123 (13%), Positives = 44/123 (35%), Gaps = 8/123 (6%)

Query: 4   CIIFIINIVVVFFIDVMGFFILMKCGAD-----PFYSRIFSIAVAFLVTWIPSRLFIFLK 58
              +I + +  F +D++ F IL+             + I + A++ +V +  +   +F +
Sbjct: 228 FFKYIFSSLFSFLVDIVAFTILISLFNGLSFSAVTLASILARAISSVVNFTLNHKVVFKQ 287

Query: 59  LRRKSFLETVRYGVMYFMLSILNYAFYVKLLLTFQGLQPLLATVLSAVSSMLFVFLLYIR 118
            +  S    ++Y  +  +   L+      L      L   +  +L   +     + +   
Sbjct: 288 GQSNSA---IKYFTLVVVQIALSSLLVTVLGNALTMLPISVVKILVDGTLFFVSYFVQKH 344

Query: 119 FMT 121
            + 
Sbjct: 345 LIF 347


>gi|116619606|ref|YP_821762.1| glycosyl transferase family protein [Candidatus Solibacter usitatus
           Ellin6076]
 gi|116222768|gb|ABJ81477.1| glycosyl transferase, family 2 [Candidatus Solibacter usitatus
           Ellin6076]
          Length = 1167

 Score = 56.4 bits (135), Expect = 1e-06,   Method: Composition-based stats.
 Identities = 20/119 (16%), Positives = 43/119 (36%), Gaps = 2/119 (1%)

Query: 4   CIIFIINIVVVFFIDVMGFFILMKCGADPFYSRIFSIAVAFLVTWIPSRLFIFLKLRRKS 63
            + F    ++   +D + F+ + K       S+I    VA L  +   R  +F   R   
Sbjct: 229 LLRFSSVSLMTALLDNLVFYFVWKRTGLILGSQITGRLVAVLFNYSMVRKTVF-ASREGH 287

Query: 64  FLETVRYGVMYFMLSILNYAFYVKLLLTFQGLQPLLATVLSAVSSMLFVFLLYIRFMTR 122
            +   +Y ++       +Y   ++ L    G+  + A +          F++   F+ R
Sbjct: 288 RVLLPKYLLLVGASGTASY-LGIRFLTARFGVTAMPAKLFVETLLFFVNFVIQRMFIFR 345


>gi|91226931|ref|ZP_01261528.1| hypothetical protein V12G01_16142 [Vibrio alginolyticus 12G01]
 gi|91188894|gb|EAS75179.1| hypothetical protein V12G01_16142 [Vibrio alginolyticus 12G01]
          Length = 138

 Score = 56.4 bits (135), Expect = 1e-06,   Method: Composition-based stats.
 Identities = 23/122 (18%), Positives = 52/122 (42%), Gaps = 4/122 (3%)

Query: 4   CIIFIINIVVVFFIDVMGFF-ILMKCGADPFYSRIFSIAVAFLVTWIPSRLFIFLKLRR- 61
              F +   V F +D + F  +    G +   +R  +   A   TW+ +R   F +  + 
Sbjct: 16  LTRFALVGGVGFMVDTIIFSVLFHWLGLELMLARGIAFLFAATTTWLGNRWLTFSQAEKT 75

Query: 62  KSFLETVRYGVMYFMLSILNYAFYVKLLLTF--QGLQPLLATVLSAVSSMLFVFLLYIRF 119
             F +  ++     + ++ N+  +  + L+   QG+   LA +L  +  M+  +LL  ++
Sbjct: 76  NPFAQWQKFMASACISALPNFIVFKGVTLSLGTQGVMVYLALILGILVGMVSNYLLSAKW 135

Query: 120 MT 121
           + 
Sbjct: 136 VF 137


>gi|159903803|ref|YP_001551147.1| hypothetical protein P9211_12621 [Prochlorococcus marinus str. MIT
           9211]
 gi|159888979|gb|ABX09193.1| Predicted membrane protein [Prochlorococcus marinus str. MIT 9211]
          Length = 371

 Score = 56.4 bits (135), Expect = 1e-06,   Method: Composition-based stats.
 Identities = 14/123 (11%), Positives = 35/123 (28%), Gaps = 3/123 (2%)

Query: 2   KQCIIFIINIVVVFFIDVMGFFILMKCGADPFY-SRIFSIAVAFLVTWIPSRLFIFLKLR 60
           ++ I F I  +    + ++   I+M+     F  +   ++  A    ++ +    F   R
Sbjct: 246 RRAISFAIVGLTGVGVQLVATNIMMRFFLLTFKEALPIAVISAATSNYLINNALTFRSKR 305

Query: 61  RKSFLETVRYGVMYFMLSILNYA--FYVKLLLTFQGLQPLLATVLSAVSSMLFVFLLYIR 118
                          + S    A                  A +       ++ ++   R
Sbjct: 306 LAGISLLKGLLKFLLVASFPVIANVGLATAFYNIVSENETWAQLAGISIVFIWNYVASSR 365

Query: 119 FMT 121
           F+ 
Sbjct: 366 FVW 368


>gi|298387880|ref|ZP_06997429.1| conserved hypothetical protein [Bacteroides sp. 1_1_14]
 gi|298259287|gb|EFI02162.1| conserved hypothetical protein [Bacteroides sp. 1_1_14]
          Length = 143

 Score = 56.1 bits (134), Expect = 1e-06,   Method: Composition-based stats.
 Identities = 14/121 (11%), Positives = 41/121 (33%), Gaps = 6/121 (4%)

Query: 3   QCIIFIINIVVVFFIDVMGFFILMKCGADPF-YSRIFSIAVAFLVTWIPSRLFIFLKLRR 61
           Q I +     +   I    +++L +        +       +F+  +  +  F F     
Sbjct: 16  QFIRYCTVGTLAAGIHYGVYYLLQEYEMTNLNIAYTIGYVTSFICNFFLTSYFTF--RSN 73

Query: 62  KSFLETVRYGVMYFMLSILNYAFYVKLLLTFQGLQPLLATVLSAVSSMLFVFLLYIRFMT 121
            S    + +G  + +  +++   +   L     +   +A +     ++   FL+   F+ 
Sbjct: 74  PSLKRALGFGGSHLVNYLIHMGLFNLFLY--LNVDQEIAPLCVLAVAVPANFLMLR-FVF 130

Query: 122 R 122
           +
Sbjct: 131 K 131


>gi|240144677|ref|ZP_04743278.1| GtrA family protein [Roseburia intestinalis L1-82]
 gi|257203196|gb|EEV01481.1| GtrA family protein [Roseburia intestinalis L1-82]
          Length = 173

 Score = 56.1 bits (134), Expect = 1e-06,   Method: Composition-based stats.
 Identities = 16/132 (12%), Positives = 52/132 (39%), Gaps = 11/132 (8%)

Query: 3   QCIIFIINIVVVFFIDVMGFFILMKCGA--------DPFYSRIFSIAVAFLVTWIPSRLF 54
           Q + F I  V    I  + + + +            D   +++ +  ++ L ++  +   
Sbjct: 41  QFVKFGIVGVSNTVISYVLYAVSLIGFQKAGVLPKSDYLVAQVIAFVLSVLWSFYWNNKL 100

Query: 55  IFL---KLRRKSFLETVRYGVMYFMLSILNYAFYVKLLLTFQGLQPLLATVLSAVSSMLF 111
           +F+     +R  +   ++  V Y    +   +  + L +   G+   +A +++ + S+  
Sbjct: 101 VFVLEEGKQRSVWKALLKTYVSYSFTGLFLNSILLILWVQVVGISEFIAPIINLLISVPL 160

Query: 112 VFLLYIRFMTRR 123
            F++   +  ++
Sbjct: 161 NFVINKFWAFKQ 172


>gi|134099355|ref|YP_001105016.1| hypothetical protein SACE_2812 [Saccharopolyspora erythraea NRRL
           2338]
 gi|291007259|ref|ZP_06565232.1| hypothetical protein SeryN2_22282 [Saccharopolyspora erythraea NRRL
           2338]
 gi|133911978|emb|CAM02091.1| hypothetical protein SACE_2812 [Saccharopolyspora erythraea NRRL
           2338]
          Length = 163

 Score = 56.1 bits (134), Expect = 1e-06,   Method: Composition-based stats.
 Identities = 24/121 (19%), Positives = 44/121 (36%), Gaps = 4/121 (3%)

Query: 3   QCIIFIINIVVVFFIDVMGFFILMKCGADPF-YSRIFSIAVAFLVTWIPSRLFIFLKLRR 61
           + + F I     F +D+     L    A P   +   +  +AF + +I +R   F     
Sbjct: 39  ELVGFAILGWFTFLVDLAILASLRAWTALPLPVAVTIAYLLAFGLNFILNRTLNFR-SHA 97

Query: 62  KSFLETVRYGVMYFMLSILNYAFYVKLLLTFQGLQPLLATVLSAVSSMLFVFLLYIRFMT 121
               + VR+ V+      L         LT  G+   LA +L+     +F +     ++ 
Sbjct: 98  PIAGQAVRWAVVIVADYGLTLGVTTG--LTALGVDFRLARLLAGACVAVFTYTASRWWVF 155

Query: 122 R 122
           R
Sbjct: 156 R 156


>gi|68536280|ref|YP_250985.1| hypothetical protein jk1203 [Corynebacterium jeikeium K411]
 gi|68263879|emb|CAI37367.1| putative membrane protein [Corynebacterium jeikeium K411]
          Length = 133

 Score = 56.1 bits (134), Expect = 1e-06,   Method: Composition-based stats.
 Identities = 21/122 (17%), Positives = 41/122 (33%), Gaps = 2/122 (1%)

Query: 2   KQCIIFIINIVVVFFIDVMGFFILMKCGADPFYSRIFSIAVAFLVTWIPSRLFIFLKLRR 61
           K+   F +  VV    D     +L+  G   F +R  S  V   V +  +  F F   R 
Sbjct: 8   KKIGTFTLVGVVGACFDFGTRTLLLNLGVIGFVARACSYIVGSTVAYYLNSFFTFQGDRS 67

Query: 62  KSFL-ETVRYGVMYFMLSILNYAFYVKLLLTFQGLQPLLATVLSAVSSMLFVFLLYIRFM 120
            +          + F+ +++  A                +  +S   + +  F+L   ++
Sbjct: 68  GAEKARAAVVYTICFIAAVVVDALLRHWGADLPHA-LFWSWFVSQAVATVLNFVLQNTWV 126

Query: 121 TR 122
            R
Sbjct: 127 FR 128


>gi|78049319|ref|YP_365494.1| hypothetical protein XCV3763 [Xanthomonas campestris pv.
           vesicatoria str. 85-10]
 gi|78037749|emb|CAJ25494.1| putative membrane protein [Xanthomonas campestris pv. vesicatoria
           str. 85-10]
          Length = 137

 Score = 56.1 bits (134), Expect = 1e-06,   Method: Composition-based stats.
 Identities = 18/123 (14%), Positives = 40/123 (32%), Gaps = 2/123 (1%)

Query: 2   KQCIIFIINIVVVFFIDVMGFFILMKCGADPFYSRIFSIAVAFLVTWIPSRLFIFLKLRR 61
           +Q   F+I   +   +D   F      G     + +       ++ +  +  + F +   
Sbjct: 15  RQGSQFMIIGALQLVVDCGIFIAATAAGMPAVPANLLGRIGGAMLGFWLNGRYTFAQQGD 74

Query: 62  KS--FLETVRYGVMYFMLSILNYAFYVKLLLTFQGLQPLLATVLSAVSSMLFVFLLYIRF 119
               +    R+ VM+  L++++       +      Q  LA  L      +  F L    
Sbjct: 75  ARLGWRRFGRFAVMWLTLTLISTWLLSTTVDLLGLRQAWLAKPLVEGGLAVVSFFLGRHV 134

Query: 120 MTR 122
           + R
Sbjct: 135 VYR 137


>gi|328945806|gb|EGG39957.1| dolichyl-phosphate beta-D-mannosyltransferase [Streptococcus
           sanguinis SK1087]
          Length = 349

 Score = 56.1 bits (134), Expect = 1e-06,   Method: Composition-based stats.
 Identities = 17/127 (13%), Positives = 46/127 (36%), Gaps = 8/127 (6%)

Query: 2   KQCIIFIINIVVVFFIDVMGFFILMKCGAD------PFYSRIFSIAVAFLVTWIPSRLFI 55
           K    F +  +  F +D + + + +   A          +   +   + +  +  ++  +
Sbjct: 218 KNIFKFALTSLSSFVVDYIVYALALLFLAAVPTSLRILLANGIARVTSSIFNYSTNKKLV 277

Query: 56  FLKLRRKSFLETVRYGVMYFMLSILNYAFYVKLLLTFQGLQPLLATVLSAVSSMLFVFLL 115
           F       F     Y  +  +L IL+    ++L     GL  L+  ++  +      +++
Sbjct: 278 FKNDD-SIFKTGTGYFSLAVVLFILD-TLLIRLFYAVFGLNLLIVKIIVGILLFTISWMV 335

Query: 116 YIRFMTR 122
             RF+ +
Sbjct: 336 QKRFIFK 342


>gi|311070332|ref|YP_003975255.1| putative integral inner membrane protein [Bacillus atrophaeus 1942]
 gi|310870849|gb|ADP34324.1| putative integral inner membrane protein [Bacillus atrophaeus 1942]
          Length = 129

 Score = 56.1 bits (134), Expect = 1e-06,   Method: Composition-based stats.
 Identities = 18/126 (14%), Positives = 55/126 (43%), Gaps = 5/126 (3%)

Query: 4   CIIFIINIVVVFFIDVMGFFILMK-CGADPFYSRIFSIAVAFLVTWIPSRLFIFLKLR-- 60
            I++II  +    +++  F+IL++    D   + + +  ++ L  +I +++++F +    
Sbjct: 1   MIMYIIMGIFTTAVNISSFYILVEILDTDYKTATVIAWILSVLFAYITNKIYVFQQKTSD 60

Query: 61  -RKSFLETVRYGVMYFMLSILNYAFYVKLLLTFQGLQPLLATVLSAVSSMLFVFLLYIRF 119
            R    E   +  +  +   ++    + LL++       LA +L  V  ++  ++     
Sbjct: 61  MRSLIRELTAFFSVRLLSLGIDLG-MMILLVSQFHTNETLAKILDNVVIVVVNYIASKWL 119

Query: 120 MTRRVY 125
           + ++  
Sbjct: 120 VFKKTT 125


>gi|160889603|ref|ZP_02070606.1| hypothetical protein BACUNI_02029 [Bacteroides uniformis ATCC 8492]
 gi|270296724|ref|ZP_06202923.1| conserved hypothetical protein [Bacteroides sp. D20]
 gi|317480092|ref|ZP_07939203.1| GtrA-like protein [Bacteroides sp. 4_1_36]
 gi|156861120|gb|EDO54551.1| hypothetical protein BACUNI_02029 [Bacteroides uniformis ATCC 8492]
 gi|270272711|gb|EFA18574.1| conserved hypothetical protein [Bacteroides sp. D20]
 gi|316903769|gb|EFV25612.1| GtrA-like protein [Bacteroides sp. 4_1_36]
          Length = 126

 Score = 56.1 bits (134), Expect = 1e-06,   Method: Composition-based stats.
 Identities = 18/121 (14%), Positives = 44/121 (36%), Gaps = 1/121 (0%)

Query: 3   QCIIFIINIVVVFFIDVMGFFILM-KCGADPFYSRIFSIAVAFLVTWIPSRLFIFLKLRR 61
           +   F +   +   I  +  +++M +   +   S + +  +A +  +I  + +IF   ++
Sbjct: 6   RIFRFAVIGTLNALIMAVTVWVMMDELDINYMLSNVTAYILAQIHNFIWCKYWIFPTEKK 65

Query: 62  KSFLETVRYGVMYFMLSILNYAFYVKLLLTFQGLQPLLATVLSAVSSMLFVFLLYIRFMT 121
            +    V    + F ++      ++  L+        LA  L         FL+  R   
Sbjct: 66  SNTWRQVLLFSIAFGMAYGAQFLFLIGLVEGLDCNEYLAQFLGLFIYGSVNFLMNKRVTF 125

Query: 122 R 122
           R
Sbjct: 126 R 126


>gi|320532275|ref|ZP_08033133.1| hypothetical protein HMPREF9057_01004 [Actinomyces sp. oral taxon
           171 str. F0337]
 gi|320135506|gb|EFW27596.1| hypothetical protein HMPREF9057_01004 [Actinomyces sp. oral taxon
           171 str. F0337]
          Length = 199

 Score = 56.1 bits (134), Expect = 1e-06,   Method: Composition-based stats.
 Identities = 18/123 (14%), Positives = 45/123 (36%), Gaps = 3/123 (2%)

Query: 4   CIIFIINIVVVFFIDVMGFFILM-KCGADPFYSRIFSIAVAFLVTWIPSRLFIFLKLRRK 62
            I + I     F +D+   ++           +     A+A + +++ +R   F      
Sbjct: 64  FIGYAIINGSAFSLDMTCLWVFYNHFHWFYPVAVTIGYAIAAVYSFLLNRWLNFQAHGHV 123

Query: 63  SFLETVRYGVMYFMLSILNYAFYVKLLLTFQGLQPLLATVLSAVSSMLFVFLLYIRFMTR 122
                    +   +   + +   +  LL + G+   LA V+SA    +++++    ++ R
Sbjct: 124 VKQGAG--YMAGVISQYVIFILGLSSLLHWFGVNAELARVISACCEGIYLYVFIRLWVFR 181

Query: 123 RVY 125
            V 
Sbjct: 182 GVP 184


>gi|320160576|ref|YP_004173800.1| hypothetical protein ANT_11660 [Anaerolinea thermophila UNI-1]
 gi|319994429|dbj|BAJ63200.1| hypothetical membrane protein [Anaerolinea thermophila UNI-1]
          Length = 151

 Score = 56.1 bits (134), Expect = 2e-06,   Method: Composition-based stats.
 Identities = 17/141 (12%), Positives = 46/141 (32%), Gaps = 18/141 (12%)

Query: 3   QCIIFIINIVVVFFIDVMGFFI-LMKCGADPFYSRIFSIAVAFLVTWIPSRLFIFLKLRR 61
           + + F +  V+   +D   F + +   G    ++   S   A +  +  +R + +   R 
Sbjct: 11  RFLKFAVVGVIGAIVDFGLFNLSIAFLGMPAVWASALSFTAAVISNFTWNRFWTYPDSRS 70

Query: 62  KSF-LETVRYGVMYFMLS-----------ILNYAFYVKLLLTFQGLQPLLA-----TVLS 104
           K    +  ++ ++  +             I     + ++L       P  A       ++
Sbjct: 71  KQLSQQLAQFALVSAIGLGIRIPMVATLEIPMINLFTRILPRSFIFTPTFAGHNVTLAIA 130

Query: 105 AVSSMLFVFLLYIRFMTRRVY 125
            +  M++ F     +    V 
Sbjct: 131 VLVVMMWNFFANRFWTYNDVN 151


>gi|315924436|ref|ZP_07920658.1| cell wall teichoic acid glycosylation protein GtcA
           [Pseudoramibacter alactolyticus ATCC 23263]
 gi|315622315|gb|EFV02274.1| cell wall teichoic acid glycosylation protein GtcA
           [Pseudoramibacter alactolyticus ATCC 23263]
          Length = 139

 Score = 56.1 bits (134), Expect = 2e-06,   Method: Composition-based stats.
 Identities = 14/119 (11%), Positives = 46/119 (38%), Gaps = 7/119 (5%)

Query: 2   KQCIIFIINIVVVFFIDVMGFFILMKC------GADPFYSRIFSIAVAFLVTWIPSRLFI 55
           ++ I +++  V+   + +  +++ +        G     + + S   A    +  +R ++
Sbjct: 10  REIINYLVVGVLTTIVSLGVYYLCVATFLNPDNGLQLQAANVISWIAAVTFAYFTNRKYV 69

Query: 56  FLKLRRKSFLETVRYGVMYFMLSILNYAFYVKLLLTFQGLQPLLATVLSAVSSMLFVFL 114
           F         E   + +      +++    + L +T  G+   +A ++S V   +  ++
Sbjct: 70  FASRNPNMMREAFAFFLSRVSTLLMDMGV-MFLAVTLSGMNDKIAKLISQVVVTIANYI 127


>gi|192361090|ref|YP_001982099.1| GtrA-like protein family [Cellvibrio japonicus Ueda107]
 gi|190687255|gb|ACE84933.1| GtrA-like protein family [Cellvibrio japonicus Ueda107]
          Length = 157

 Score = 56.1 bits (134), Expect = 2e-06,   Method: Composition-based stats.
 Identities = 12/119 (10%), Positives = 42/119 (35%), Gaps = 1/119 (0%)

Query: 3   QCIIFIINIVVVFFIDVMGFFILMKCGADPFYSRIFSIAVAFLVTWIPSRLFIFLKLRRK 62
           Q   ++    + F +D + F  ++        + +    V   V +     +++   + +
Sbjct: 38  QFCRYVAVGGIAFIMDFLAFNGILALQLHYMLATVIGFMVGVAVNYCLCVFWVWSGTQAR 97

Query: 63  SFLETVRYGVMYFMLSILNYAFYVKLLLTFQGLQPLLATVLSAVSSMLFVFLLYIRFMT 121
           +  + + + ++     +L         +        L+ ++ A+  + + F L   F+ 
Sbjct: 98  TAKDILIFTLIGIGGLLLTALLMWLS-VDIFSFDARLSKIVVAIIVLFWNFGLRKVFVF 155


>gi|304438250|ref|ZP_07398191.1| glycosyl transferase [Selenomonas sp. oral taxon 149 str. 67H29BP]
 gi|304368616|gb|EFM22300.1| glycosyl transferase [Selenomonas sp. oral taxon 149 str. 67H29BP]
          Length = 126

 Score = 56.1 bits (134), Expect = 2e-06,   Method: Composition-based stats.
 Identities = 18/117 (15%), Positives = 46/117 (39%), Gaps = 2/117 (1%)

Query: 3   QCIIFIINIVVVFFIDVMGFFILM-KCGADPFYSRIFSIAVAFLVTWIPSRLFIFLKLRR 61
           + + F++     F +D    +IL    G     S   S +++  V +    +++F     
Sbjct: 7   EILRFLLVGGGCFLLDYGLLYILTEYAGLYYLLSSGISFSISVFVNYRLCLIYVFHGASA 66

Query: 62  KSFLETVRYGVMYFMLSILNYAFYVKLLLTFQGLQPLLATVLSAVSSMLFVFLLYIR 118
           ++    + +         LN    +  L+    +  +LA +++A    ++ ++L  R
Sbjct: 67  ETHRAKILFFGSSIAGLALNQ-LLMWGLVDGLSVYYMLAKIIAASIVTVWNYVLKRR 122


>gi|237654291|ref|YP_002890605.1| GtrA family protein [Thauera sp. MZ1T]
 gi|237625538|gb|ACR02228.1| GtrA family protein [Thauera sp. MZ1T]
          Length = 136

 Score = 56.1 bits (134), Expect = 2e-06,   Method: Composition-based stats.
 Identities = 21/122 (17%), Positives = 40/122 (32%), Gaps = 3/122 (2%)

Query: 3   QCIIFIINIVVVFFIDVMGFFILMKCGADPFYSRIFS-IAVAFLVTWIPSRLFIFLKLRR 61
           + + F     V           L++    P  +   +   +  LV +  +R  +F    R
Sbjct: 9   RFLRFAAVGAVGTLAHYALLLALVEGADAPPLAGAIAGFMLGALVNYALARRLVF-ASTR 67

Query: 62  KSFLETVRYGVMYFMLSILNYAFYVKLLLTFQGLQPLLATVLSAVSSMLFVFLLYIRFMT 121
                  R+  +         A  +   +   GL  LLA VL+    +L+ +     +  
Sbjct: 68  SHAQALPRFFAVALAGLAWT-ALLMSFFMELLGLHYLLAQVLTTALLLLWHYAGNALWTF 126

Query: 122 RR 123
           RR
Sbjct: 127 RR 128


>gi|293553254|ref|ZP_06673891.1| teichoic acid glycosylation protein [Enterococcus faecium E1039]
 gi|291602664|gb|EFF32879.1| teichoic acid glycosylation protein [Enterococcus faecium E1039]
          Length = 156

 Score = 56.1 bits (134), Expect = 2e-06,   Method: Composition-based stats.
 Identities = 12/131 (9%), Positives = 47/131 (35%), Gaps = 5/131 (3%)

Query: 3   QCIIFIINIVVVFFIDVMGFFILM-KCGADPFYSRIFSIAVAFLVTWIPSRLFIFLKLRR 61
           + ++++    +   ++ + F +           S   S   + L  ++ ++L++F     
Sbjct: 18  EILVYLFFGGLATIVNFVSFALARQYFDLSMALSNSISWFCSVLFAFVTNKLWVFHSKSP 77

Query: 62  KSFLETV---RYGVMYFMLSILNYAFYVKLLLTFQGLQPLLATVLSAVSSMLFVFLLYIR 118
                 +   ++     +   L+    V  L+        +A +++ +  +L  ++    
Sbjct: 78  NFTHALIECGKFFFYRILSYGLDMGAMVL-LINVMNSNEYVAKIITQIIVILANYIFSKL 136

Query: 119 FMTRRVYFIKK 129
           F+ +     ++
Sbjct: 137 FIFKETEVFEE 147


>gi|149911939|ref|ZP_01900537.1| hypothetical protein PE36_11022 [Moritella sp. PE36]
 gi|149804986|gb|EDM65015.1| hypothetical protein PE36_11022 [Moritella sp. PE36]
          Length = 129

 Score = 56.1 bits (134), Expect = 2e-06,   Method: Composition-based stats.
 Identities = 23/127 (18%), Positives = 48/127 (37%), Gaps = 7/127 (5%)

Query: 3   QCIIFIINIVVVFFIDVMGFFILMKCGADPFYSRIFSIAVAFLVTWIPSRLFIFLKLR-- 60
           + I F     + F +D+    +        F +R  +   A    W+ +R   F + +  
Sbjct: 4   KYIKFACVGGIGFIVDLSAMIVFSTF-MPLFLARSLAFFFAVNSNWLLNRRITFKQQQFE 62

Query: 61  --RKSFLETVRYGVMYFMLSILNYAFYVKLL--LTFQGLQPLLATVLSAVSSMLFVFLLY 116
                  E  ++     + +I N   Y  L+  L+  G   ++A +   +  ML  +LL 
Sbjct: 63  SNSGLLQEWSKFLCSSCVGAIPNLCCYWLLVSGLSLTGSAAVIAIIPGIIFGMLINYLLA 122

Query: 117 IRFMTRR 123
            R++  +
Sbjct: 123 DRWVFSK 129


>gi|183985319|ref|YP_001853610.1| hypothetical protein MMAR_5351 [Mycobacterium marinum M]
 gi|183178645|gb|ACC43755.1| conserved hypothetical membrane protein [Mycobacterium marinum M]
          Length = 146

 Score = 56.1 bits (134), Expect = 2e-06,   Method: Composition-based stats.
 Identities = 20/122 (16%), Positives = 45/122 (36%), Gaps = 1/122 (0%)

Query: 3   QCIIFIINIVVVFFIDVMGFFILMKC-GADPFYSRIFSIAVAFLVTWIPSRLFIFLKLRR 61
           Q I FI+       +D   + +L K  G     S+  S+ +  +  ++ +R + F     
Sbjct: 24  QMIRFIVTGGFAAIVDFSVYVVLYKVVGLQVDLSKFISVVIGTITAYLINRRWTFQAAPS 83

Query: 62  KSFLETVRYGVMYFMLSILNYAFYVKLLLTFQGLQPLLATVLSAVSSMLFVFLLYIRFMT 121
            +    V           +        L+ ++G    +A V++   + +  F++    + 
Sbjct: 84  GARFAAVMALYGVTFAVQVGINHLCLALMHYRGWAIPVAFVIAQAVATVINFVVQRAVIF 143

Query: 122 RR 123
           RR
Sbjct: 144 RR 145


>gi|113866753|ref|YP_725242.1| hypothetical protein H16_A0726 [Ralstonia eutropha H16]
 gi|113525529|emb|CAJ91874.1| predicted membrane protein [Ralstonia eutropha H16]
          Length = 129

 Score = 56.1 bits (134), Expect = 2e-06,   Method: Composition-based stats.
 Identities = 15/123 (12%), Positives = 39/123 (31%), Gaps = 5/123 (4%)

Query: 1   MKQCIIFIINIVVVFFIDVMGFFILMKCGA-DPFYSRIFSIAVAFLVTWIPSRLFIFLKL 59
           +++   F+++      + V     L+   A  P  +   +   A   +++ + L+ F   
Sbjct: 10  LRRVTRFLVSGATSTGVHVAITATLVTTLATSPVAANCVAFVCATACSYLLNTLWSFSSR 69

Query: 60  RRKSFLETVRYGVMYFMLSILNYAFYVKLLLTFQGLQPLLATVLSAVSSMLFVFLLYIRF 119
            R       R+  +  +   L           + G           ++   F +L +  +
Sbjct: 70  LRNRT--LGRFAGVSLLGLGLTMGIS--WTAQYLGASYWAGLAGVVLTVPAFSYLAHRAW 125

Query: 120 MTR 122
             R
Sbjct: 126 TYR 128


>gi|254482180|ref|ZP_05095421.1| GtrA-like protein [marine gamma proteobacterium HTCC2148]
 gi|214037505|gb|EEB78171.1| GtrA-like protein [marine gamma proteobacterium HTCC2148]
          Length = 128

 Score = 56.1 bits (134), Expect = 2e-06,   Method: Composition-based stats.
 Identities = 17/123 (13%), Positives = 43/123 (34%), Gaps = 4/123 (3%)

Query: 5   IIFIINIVVVFFIDVMGFFI-LMKCGADPFYSRIFSIAVAFLVTWIPSRLFIFLKLRR-- 61
             F +  V+   +     ++ +   G D   +      VA    ++    + F       
Sbjct: 6   FRFALVGVITGLVHYGLVYLGVSWLGWDSLVASSVGFVVAVSCNYLMHYGWTFAVDAHEV 65

Query: 62  -KSFLETVRYGVMYFMLSILNYAFYVKLLLTFQGLQPLLATVLSAVSSMLFVFLLYIRFM 120
                 T+R  +       +     + L +   G   L+A V ++V+ +L+ + +   ++
Sbjct: 66  PPPHGATLRRYLTMVACGFVINGLVMYLSVQVLGCHYLVAQVFASVAVVLWNYFVANFWV 125

Query: 121 TRR 123
            +R
Sbjct: 126 FKR 128


>gi|228477963|ref|ZP_04062574.1| glycosyl transferase [Streptococcus salivarius SK126]
 gi|228250143|gb|EEK09396.1| glycosyl transferase [Streptococcus salivarius SK126]
          Length = 353

 Score = 55.7 bits (133), Expect = 2e-06,   Method: Composition-based stats.
 Identities = 17/123 (13%), Positives = 45/123 (36%), Gaps = 8/123 (6%)

Query: 4   CIIFIINIVVVFFIDVMGFFILMKCGAD-----PFYSRIFSIAVAFLVTWIPSRLFIFLK 58
              +I + +  F +D++ F IL+             + I + A++ +V +  +   +F +
Sbjct: 227 FFKYIFSALFSFLVDIVAFTILISLFNGLSFSAVTLASILARAISSVVNFTLNHKVVFKR 286

Query: 59  LRRKSFLETVRYGVMYFMLSILNYAFYVKLLLTFQGLQPLLATVLSAVSSMLFVFLLYIR 118
            +  S    ++Y  +  +  +L+      L      L   L  +L   +     + +   
Sbjct: 287 GQSNSA---IKYFTLVVVQIVLSSLLVTVLGNALTTLPISLVKILVDGTLFFVSYFVQKH 343

Query: 119 FMT 121
            + 
Sbjct: 344 LIF 346



 Score = 33.7 bits (76), Expect = 8.0,   Method: Composition-based stats.
 Identities = 13/74 (17%), Positives = 30/74 (40%), Gaps = 3/74 (4%)

Query: 53  LFIFLKLRRKSFLETVRYGVMYFMLSILNYAFYVKLLLTFQGLQP---LLATVLSAVSSM 109
            F  ++   + +    +Y        +++   +  L+  F GL      LA++L+   S 
Sbjct: 213 HFDAIRDSIRIYKVFFKYIFSALFSFLVDIVAFTILISLFNGLSFSAVTLASILARAISS 272

Query: 110 LFVFLLYIRFMTRR 123
           +  F L  + + +R
Sbjct: 273 VVNFTLNHKVVFKR 286


>gi|227550528|ref|ZP_03980577.1| teichoic acid glycosylation protein GtrA [Enterococcus faecium
           TX1330]
 gi|257888555|ref|ZP_05668208.1| teichoic acid glycosylation protein [Enterococcus faecium
           1,141,733]
 gi|257897070|ref|ZP_05676723.1| teichoic acid glycosylation protein [Enterococcus faecium Com12]
 gi|257899008|ref|ZP_05678661.1| teichoic acid glycosylation protein [Enterococcus faecium Com15]
 gi|293378758|ref|ZP_06624916.1| cell wall teichoic acid glycosylation protein GtcA family protein
           [Enterococcus faecium PC4.1]
 gi|227180429|gb|EEI61401.1| teichoic acid glycosylation protein GtrA [Enterococcus faecium
           TX1330]
 gi|257824609|gb|EEV51541.1| teichoic acid glycosylation protein [Enterococcus faecium
           1,141,733]
 gi|257833635|gb|EEV60056.1| teichoic acid glycosylation protein [Enterococcus faecium Com12]
 gi|257836920|gb|EEV61994.1| teichoic acid glycosylation protein [Enterococcus faecium Com15]
 gi|292642686|gb|EFF60838.1| cell wall teichoic acid glycosylation protein GtcA family protein
           [Enterococcus faecium PC4.1]
          Length = 156

 Score = 55.7 bits (133), Expect = 2e-06,   Method: Composition-based stats.
 Identities = 12/131 (9%), Positives = 47/131 (35%), Gaps = 5/131 (3%)

Query: 3   QCIIFIINIVVVFFIDVMGFFILM-KCGADPFYSRIFSIAVAFLVTWIPSRLFIFLKLRR 61
           + ++++    +   ++ + F +           S   S   + L  ++ ++L++F     
Sbjct: 18  EILVYLFFGGLATIVNFVSFALARQYFDLSMALSNSISWFCSVLFAFVTNKLWVFHSKSP 77

Query: 62  KSFLETV---RYGVMYFMLSILNYAFYVKLLLTFQGLQPLLATVLSAVSSMLFVFLLYIR 118
                 +   ++     +   L+    V  L+        +A +++ +  +L  ++    
Sbjct: 78  NFTHALIECGKFFFYRILSYGLDMGAMVL-LINVMNSNEYVAKIITQIIVILANYIFSKL 136

Query: 119 FMTRRVYFIKK 129
           F+ +     ++
Sbjct: 137 FIFKETEVFEE 147


>gi|332827626|gb|EGK00368.1| hypothetical protein HMPREF9455_03321 [Dysgonomonas gadei ATCC
           BAA-286]
          Length = 159

 Score = 55.7 bits (133), Expect = 2e-06,   Method: Composition-based stats.
 Identities = 22/144 (15%), Positives = 49/144 (34%), Gaps = 24/144 (16%)

Query: 1   MKQCIIFIINIVVVFFIDVMGFFILMKCGA----------------------DPFYSRIF 38
           ++Q I + +  +V   ID+  F++L+   +                      D   S I 
Sbjct: 14  IRQLIKYGLVGIVGLVIDMGIFYLLVNKFSVHYPFSATISSLLKGNMSIGMLDILISNII 73

Query: 39  SIAVAFLVTWIPSRLFIFLKLRRKSFLETVRYGVMYFMLSILNYAFYVKLLLTFQGLQPL 98
           S  +A +  +I +  F F    +K     + +  +  +  I++        +    +  +
Sbjct: 74  SQTLAVVNNFILNSYFTFKVTDQK-LKRFMSFASIAIVGMIISSMLLTL-FIGIMKIDDM 131

Query: 99  LATVLSAVSSMLFVFLLYIRFMTR 122
           LA V +        F +   F  +
Sbjct: 132 LAKVFAIFIVAAIQFAINKFFTFK 155


>gi|170699120|ref|ZP_02890175.1| GtrA family protein [Burkholderia ambifaria IOP40-10]
 gi|170135995|gb|EDT04268.1| GtrA family protein [Burkholderia ambifaria IOP40-10]
          Length = 133

 Score = 55.7 bits (133), Expect = 2e-06,   Method: Composition-based stats.
 Identities = 18/119 (15%), Positives = 38/119 (31%), Gaps = 5/119 (4%)

Query: 3   QCIIFIINIVVVFFIDVMGFFILMKCGADPFYSRIFSIAVAFLVTWIPSRLFIFLKLRRK 62
           Q + F+    +   +    F +L   G     +   +     L  +      +F    R 
Sbjct: 17  QLLRFLAVGGLNTLVGYSLFALLTYAGLAYPVAIGLATVGGVLFNFQSVGRLVFDGAPRS 76

Query: 63  SFLETVRYGVMYFMLSILNYAFYVKLLLTFQGLQPLLATVLSAVSSMLFVFLLYIRFMT 121
                 R+  +Y ++ +         LL        +A  L+ +   +  F+L  RF+ 
Sbjct: 77  ---RFWRFVGVYCVIYL--LNLGGVRLLLGLDANIYIANALTLLPLSVIAFILNRRFVF 130


>gi|187777091|ref|ZP_02993564.1| hypothetical protein CLOSPO_00636 [Clostridium sporogenes ATCC
           15579]
 gi|187774019|gb|EDU37821.1| hypothetical protein CLOSPO_00636 [Clostridium sporogenes ATCC
           15579]
          Length = 139

 Score = 55.7 bits (133), Expect = 2e-06,   Method: Composition-based stats.
 Identities = 24/124 (19%), Positives = 51/124 (41%), Gaps = 4/124 (3%)

Query: 2   KQCIIFIINIVVVFFIDVMGFFILMKC-GADPFYSRIFSIAVAFLVTWIPSRLFIFLKLR 60
           K    F I  V    ID + F I  +  G     S+I   +   + ++I ++ + F + +
Sbjct: 17  KHISRFSIVGVANTIIDFLMFTIFNELVGVGYITSQIIGYSFGIMNSFIFNKKWTFKERK 76

Query: 61  --RKSFLETVRYGVMYFMLSILNYAFYVKLLLTFQGLQPLLATVLSAVSSMLFVFLLYIR 118
             +K   E +++ V+  +  I+   F +  L     +   LA V+  + +    F+ Y  
Sbjct: 77  ISKKVLYELMQFIVVNLVSLIIT-VFVMNFLAKNLNINVYLAKVIVTIIAQATNFVAYKF 135

Query: 119 FMTR 122
            + +
Sbjct: 136 IVFK 139


>gi|257880203|ref|ZP_05659856.1| teichoic acid glycosylation protein [Enterococcus faecium
           1,230,933]
 gi|257883004|ref|ZP_05662657.1| teichoic acid glycosylation protein [Enterococcus faecium
           1,231,502]
 gi|257885246|ref|ZP_05664899.1| teichoic acid glycosylation protein [Enterococcus faecium
           1,231,501]
 gi|257891413|ref|ZP_05671066.1| teichoic acid glycosylation protein [Enterococcus faecium
           1,231,410]
 gi|257893590|ref|ZP_05673243.1| teichoic acid glycosylation protein [Enterococcus faecium
           1,231,408]
 gi|258614391|ref|ZP_05712161.1| teichoic acid glycosylation protein, putative [Enterococcus faecium
           DO]
 gi|260560499|ref|ZP_05832673.1| conserved hypothetical protein [Enterococcus faecium C68]
 gi|261209016|ref|ZP_05923421.1| conserved hypothetical protein [Enterococcus faecium TC 6]
 gi|289565172|ref|ZP_06445624.1| conserved hypothetical protein [Enterococcus faecium D344SRF]
 gi|293563318|ref|ZP_06677768.1| teichoic acid glycosylation protein [Enterococcus faecium E1162]
 gi|293569313|ref|ZP_06680611.1| teichoic acid glycosylation protein [Enterococcus faecium E1071]
 gi|293572479|ref|ZP_06683458.1| teichoic acid glycosylation protein [Enterococcus faecium E980]
 gi|294615296|ref|ZP_06695172.1| teichoic acid glycosylation protein [Enterococcus faecium E1636]
 gi|294619061|ref|ZP_06698556.1| teichoic acid glycosylation protein [Enterococcus faecium E1679]
 gi|294621459|ref|ZP_06700628.1| teichoic acid glycosylation protein [Enterococcus faecium U0317]
 gi|314939795|ref|ZP_07847015.1| cell wall teichoic acid glycosylation protein GtcA family protein
           [Enterococcus faecium TX0133a04]
 gi|314943908|ref|ZP_07850634.1| cell wall teichoic acid glycosylation protein GtcA family protein
           [Enterococcus faecium TX0133C]
 gi|314950005|ref|ZP_07853298.1| cell wall teichoic acid glycosylation protein GtcA family protein
           [Enterococcus faecium TX0082]
 gi|314953527|ref|ZP_07856439.1| cell wall teichoic acid glycosylation protein GtcA family protein
           [Enterococcus faecium TX0133A]
 gi|314994270|ref|ZP_07859572.1| cell wall teichoic acid glycosylation protein GtcA family protein
           [Enterococcus faecium TX0133B]
 gi|314995138|ref|ZP_07860254.1| cell wall teichoic acid glycosylation protein GtcA family protein
           [Enterococcus faecium TX0133a01]
 gi|257814431|gb|EEV43189.1| teichoic acid glycosylation protein [Enterococcus faecium
           1,230,933]
 gi|257818662|gb|EEV45990.1| teichoic acid glycosylation protein [Enterococcus faecium
           1,231,502]
 gi|257821098|gb|EEV48232.1| teichoic acid glycosylation protein [Enterococcus faecium
           1,231,501]
 gi|257827773|gb|EEV54399.1| teichoic acid glycosylation protein [Enterococcus faecium
           1,231,410]
 gi|257829969|gb|EEV56576.1| teichoic acid glycosylation protein [Enterococcus faecium
           1,231,408]
 gi|260073501|gb|EEW61829.1| conserved hypothetical protein [Enterococcus faecium C68]
 gi|260077055|gb|EEW64777.1| conserved hypothetical protein [Enterococcus faecium TC 6]
 gi|289162993|gb|EFD10841.1| conserved hypothetical protein [Enterococcus faecium D344SRF]
 gi|291588019|gb|EFF19869.1| teichoic acid glycosylation protein [Enterococcus faecium E1071]
 gi|291591854|gb|EFF23487.1| teichoic acid glycosylation protein [Enterococcus faecium E1636]
 gi|291594722|gb|EFF26104.1| teichoic acid glycosylation protein [Enterococcus faecium E1679]
 gi|291598953|gb|EFF30001.1| teichoic acid glycosylation protein [Enterococcus faecium U0317]
 gi|291604770|gb|EFF34254.1| teichoic acid glycosylation protein [Enterococcus faecium E1162]
 gi|291607396|gb|EFF36739.1| teichoic acid glycosylation protein [Enterococcus faecium E980]
 gi|313590629|gb|EFR69474.1| cell wall teichoic acid glycosylation protein GtcA family protein
           [Enterococcus faecium TX0133a01]
 gi|313591305|gb|EFR70150.1| cell wall teichoic acid glycosylation protein GtcA family protein
           [Enterococcus faecium TX0133B]
 gi|313594450|gb|EFR73295.1| cell wall teichoic acid glycosylation protein GtcA family protein
           [Enterococcus faecium TX0133A]
 gi|313597449|gb|EFR76294.1| cell wall teichoic acid glycosylation protein GtcA family protein
           [Enterococcus faecium TX0133C]
 gi|313640935|gb|EFS05515.1| cell wall teichoic acid glycosylation protein GtcA family protein
           [Enterococcus faecium TX0133a04]
 gi|313643652|gb|EFS08232.1| cell wall teichoic acid glycosylation protein GtcA family protein
           [Enterococcus faecium TX0082]
          Length = 156

 Score = 55.7 bits (133), Expect = 2e-06,   Method: Composition-based stats.
 Identities = 12/131 (9%), Positives = 47/131 (35%), Gaps = 5/131 (3%)

Query: 3   QCIIFIINIVVVFFIDVMGFFILM-KCGADPFYSRIFSIAVAFLVTWIPSRLFIFLKLRR 61
           + ++++    +   ++ + F +           S   S   + L  ++ ++L++F     
Sbjct: 18  EILVYLFFGGLATIVNFVSFALARQYFDLSMALSNSISWFCSVLFAFVTNKLWVFHSKSP 77

Query: 62  KSFLETV---RYGVMYFMLSILNYAFYVKLLLTFQGLQPLLATVLSAVSSMLFVFLLYIR 118
                 +   ++     +   L+    V  L+        +A +++ +  +L  ++    
Sbjct: 78  NFTHALIECGKFFFYRILSYGLDMGAMVL-LINVMNSNEYVAKIITQIIVILANYIFSKL 136

Query: 119 FMTRRVYFIKK 129
           F+ +     ++
Sbjct: 137 FIFKETEVFEE 147


>gi|29831619|ref|NP_826253.1| hypothetical protein SAV_5076 [Streptomyces avermitilis MA-4680]
 gi|29608735|dbj|BAC72788.1| hypothetical protein [Streptomyces avermitilis MA-4680]
          Length = 162

 Score = 55.7 bits (133), Expect = 2e-06,   Method: Composition-based stats.
 Identities = 17/124 (13%), Positives = 44/124 (35%), Gaps = 4/124 (3%)

Query: 3   QCIIFIINIVVVFFIDVMGFFI-LMKCGADPFYSRIFSIAVAFLVTWIPSRLFIFLKLRR 61
           +   F +       ++ + F + L      P  + + +  +A    +I  R + +     
Sbjct: 33  EVARFGVVGGSGVAVNFLVFNLALHGMKWAPMAATVLASVIAMGTNYIGFRCYAYRDRAS 92

Query: 62  KSFLETVRYGVMYFMLSILNYAFYVKLLLTFQGLQPL---LATVLSAVSSMLFVFLLYIR 118
           ++  +   +     +  ++    +           P+   LA  LS V +  F FL+Y  
Sbjct: 93  RTRRQIALFFAFSGLGVVMESVLFYVGYHGLGMSGPIGSNLAKALSIVLASAFRFLVYRT 152

Query: 119 FMTR 122
           ++ +
Sbjct: 153 WVFQ 156


>gi|220932716|ref|YP_002509624.1| GtrA family protein [Halothermothrix orenii H 168]
 gi|219994026|gb|ACL70629.1| GtrA family protein [Halothermothrix orenii H 168]
          Length = 130

 Score = 55.7 bits (133), Expect = 2e-06,   Method: Composition-based stats.
 Identities = 16/121 (13%), Positives = 47/121 (38%), Gaps = 3/121 (2%)

Query: 4   CIIFIINIVVVFFIDVMGFFILMKCGADPFYSRIFSIAVAFLVTWIPSRLFIFLKL--RR 61
            I F +  +    +++  +  L+        + + S  VA    +  + ++ F      +
Sbjct: 8   FIKFSLVGLSGVVVNMAVYSSLLYFDVYYLVAAVISFIVAVTNNFYWNFIWTFKGRAAHK 67

Query: 62  KSFLETVRYGVMYFMLSILNYAFYVKLLLTFQGLQPLLATVLSAVSSMLFVFLLYIRFMT 121
               + + + V+  +   +N    +++L+    L  +LA +++   + L  FL  +    
Sbjct: 68  TVARKYIDFFVISLINFGVNL-ISLRILVEAFSLHKVLAQLVAIGIASLLNFLGNLLITF 126

Query: 122 R 122
           +
Sbjct: 127 K 127


>gi|254281737|ref|ZP_04956705.1| GtrA-like protein [gamma proteobacterium NOR51-B]
 gi|219677940|gb|EED34289.1| GtrA-like protein [gamma proteobacterium NOR51-B]
          Length = 136

 Score = 55.7 bits (133), Expect = 2e-06,   Method: Composition-based stats.
 Identities = 26/124 (20%), Positives = 55/124 (44%), Gaps = 7/124 (5%)

Query: 1   MKQCIIFIINIVVVFFIDVMGFFILMKCGADPFYSRIFSIAVAFLVTWIPSRLFIFLKLR 60
           +++ ++F I   + F +D +  ++        F  RI S A+A +VTW  + +F F    
Sbjct: 14  LEKVVLFSIAGFIGFVVDAVFLYLFSTLTNP-FLGRIGSFAIAVVVTWRINAVFTFKDEG 72

Query: 61  RKSFLETVRYGVMYFMLSILNYAFY--VKLLLTFQGLQPLLATVLSAVSSMLFVFLLYIR 118
           +        Y +       +NY  +     LL     Q LLA  + + ++M+F +++   
Sbjct: 73  KGLLH----YVLGQVAGITINYLVFCTSIYLLPDHVWQLLLALAIGSGTAMIFNYMVMKH 128

Query: 119 FMTR 122
           ++ +
Sbjct: 129 WVFQ 132


>gi|296111585|ref|YP_003621967.1| Putative glycosyl transferase [Leuconostoc kimchii IMSNU 11154]
 gi|295833117|gb|ADG40998.1| Putative glycosyl transferase [Leuconostoc kimchii IMSNU 11154]
          Length = 349

 Score = 55.7 bits (133), Expect = 2e-06,   Method: Composition-based stats.
 Identities = 19/125 (15%), Positives = 45/125 (36%), Gaps = 8/125 (6%)

Query: 4   CIIFIINIVVVFFIDVMGFFILMKC-----GADPFYSRIFSIAVAFLVTWIPSRLFIFLK 58
            I +I   +  F ID++ F ++M           F + I S   + +  +  ++  +F  
Sbjct: 227 FIKYIFGAIGSFLIDIVVFAVMMVLLSTVSTWAVFIAAIISRLTSSIANYYINKSIVFKN 286

Query: 59  LRRKSFLETVRYGVMYFMLSILNYAFYVKLLLTFQGLQPLLATVLSAVSSMLFVFLLYIR 118
             R   L  V Y ++     I++    + L      L  ++  +       +  + +   
Sbjct: 287 NNR---LSFVNYYLLVVTQLIVSTLLVIFLQHYLAKLNVVIIKIAVDSLLFIISYQIQKN 343

Query: 119 FMTRR 123
            + +R
Sbjct: 344 VVFKR 348


>gi|188993186|ref|YP_001905196.1| hypothetical protein xccb100_3791 [Xanthomonas campestris pv.
           campestris str. B100]
 gi|167734946|emb|CAP53158.1| conserved putative membrane protein [Xanthomonas campestris pv.
           campestris]
          Length = 127

 Score = 55.7 bits (133), Expect = 2e-06,   Method: Composition-based stats.
 Identities = 18/123 (14%), Positives = 39/123 (31%), Gaps = 2/123 (1%)

Query: 2   KQCIIFIINIVVVFFIDVMGFFILMKCGADPFYSRIFSIAVAFLVTWIPSRLFIFLKLR- 60
           +Q   F +   +   +D   F      G     + +        + +  +  F F +   
Sbjct: 5   RQGGQFAMIGALQLAVDCGIFIACTAAGMPAVPANLLGRISGATLGFWLNGRFTFAQQGD 64

Query: 61  -RKSFLETVRYGVMYFMLSILNYAFYVKLLLTFQGLQPLLATVLSAVSSMLFVFLLYIRF 119
            R  +    R+ VM+  L++++       +      Q  LA  L      +  F +    
Sbjct: 65  ARLGWQRFARFAVMWLALTVISTWLLSATVDLVGLRQAWLAKPLVEGGLAIVSFFVGRHV 124

Query: 120 MTR 122
           + R
Sbjct: 125 VYR 127


>gi|167772013|ref|ZP_02444066.1| hypothetical protein ANACOL_03387 [Anaerotruncus colihominis DSM
           17241]
 gi|167665811|gb|EDS09941.1| hypothetical protein ANACOL_03387 [Anaerotruncus colihominis DSM
           17241]
          Length = 134

 Score = 55.7 bits (133), Expect = 2e-06,   Method: Composition-based stats.
 Identities = 22/124 (17%), Positives = 56/124 (45%), Gaps = 2/124 (1%)

Query: 1   MKQCIIFIINIVVVFFIDVMGFFIL-MKCGADPFYSRIFSIAVAFLVTWIPSRLFIFLKL 59
           +K+ + F +  V    +D + F +L +  GA+  +S+    +   L +++ +R + F   
Sbjct: 12  LKRALKFAVTGVGNTVVDFVVFTVLAVWLGANVPFSQFCGYSAGMLNSYLINRSWTFQTK 71

Query: 60  RRKSFLETVRYGVMYFMLSILNYAFYVKLLLTFQGLQPLLATVLSAVSSMLFVFLLYIRF 119
            R   L+  R+      + +L+       +    G+  L+A + +   +++  FL+   +
Sbjct: 72  DRFFSLQMARFVAANVAVMLLSMVLIQAGIAYL-GMSKLVAKLFTTAFTIVVNFLISRLW 130

Query: 120 MTRR 123
           + R+
Sbjct: 131 VFRK 134


>gi|148358937|ref|YP_001250144.1| glycosyltransferase [Legionella pneumophila str. Corby]
 gi|296106986|ref|YP_003618686.1| Glycosyltransferases involved in cell wall biogenesis [Legionella
           pneumophila 2300/99 Alcoy]
 gi|148280710|gb|ABQ54798.1| glycosyltransferase [Legionella pneumophila str. Corby]
 gi|295648887|gb|ADG24734.1| Glycosyltransferases involved in cell wall biogenesis [Legionella
           pneumophila 2300/99 Alcoy]
          Length = 388

 Score = 55.7 bits (133), Expect = 2e-06,   Method: Composition-based stats.
 Identities = 13/128 (10%), Positives = 37/128 (28%), Gaps = 7/128 (5%)

Query: 1   MKQCIIFIINIVVVFFIDVMGFFILMKCGADPFYSRIFSIAVAFLVTWIPSRLFIFLKL- 59
           ++Q +       +   I    +  L         S   +I+ A +  +I      F +  
Sbjct: 243 LRQYLTMCCVGSIGALIQFSLYNWLRSSNHSALVSSQVAISAAIISNFIFHHSITFKQKT 302

Query: 60  ----RRKSFLETVRYGVMYFMLSILNYAFYVKLLLTF--QGLQPLLATVLSAVSSMLFVF 113
                + +F    ++ +    +      +    + +F    L+  +          +  +
Sbjct: 303 DFRITKTTFSRFTQFIIYSTFMVYFQSLWVHIFVHSFGQGVLKENIIVASGLGIGSIINY 362

Query: 114 LLYIRFMT 121
           L Y   + 
Sbjct: 363 LFYSNIIW 370


>gi|290955977|ref|YP_003487159.1| glycosyl transferase [Streptomyces scabiei 87.22]
 gi|260645503|emb|CBG68591.1| putative glycosyl transferase [Streptomyces scabiei 87.22]
          Length = 429

 Score = 55.7 bits (133), Expect = 2e-06,   Method: Composition-based stats.
 Identities = 13/118 (11%), Positives = 35/118 (29%), Gaps = 4/118 (3%)

Query: 7   FIINIVVVFFIDVMGFFILMKCGADPFYSRIFSIAVAFLVTWIPSRLFIFLKLRRKSFLE 66
           F+   VV   +     + L++    P  + + S+ V  ++    +R   F          
Sbjct: 305 FLAIGVVST-VGQALLYWLLRGWWSPAVANLVSLFVLAVLNTEANRRLTFRYSTAPPARA 363

Query: 67  TVRYGVMYFMLSILNYAFYVKLLLTFQGLQ---PLLATVLSAVSSMLFVFLLYIRFMT 121
            +  G ++ +  ++     +       G            ++V      F +    + 
Sbjct: 364 HLGAGGLFVLGYLVTSGAVLWFKWLDPGASTAAETAVLATASVVVTCVRFAVLRLAVF 421


>gi|238927657|ref|ZP_04659417.1| GtrA family protein [Selenomonas flueggei ATCC 43531]
 gi|238884582|gb|EEQ48220.1| GtrA family protein [Selenomonas flueggei ATCC 43531]
          Length = 126

 Score = 55.7 bits (133), Expect = 2e-06,   Method: Composition-based stats.
 Identities = 18/117 (15%), Positives = 48/117 (41%), Gaps = 2/117 (1%)

Query: 3   QCIIFIINIVVVFFIDVMGFFILM-KCGADPFYSRIFSIAVAFLVTWIPSRLFIFLKLRR 61
           + + F++     F +D    +IL    G     S   S +++  V +    +++F     
Sbjct: 7   EILRFLLVGGGCFLLDYGLLYILTEYAGLYYLLSSGISFSISVFVNYRLCLIYVFHGASA 66

Query: 62  KSFLETVRYGVMYFMLSILNYAFYVKLLLTFQGLQPLLATVLSAVSSMLFVFLLYIR 118
           ++    + +        +LN    + +L+    +  +LA +++A    ++ ++L  R
Sbjct: 67  ETHRAKILFFGSSIAGLVLNQ-ILMWVLVDGLSVYYMLAKIIAAGIVTVWNYVLKRR 122


>gi|331083187|ref|ZP_08332303.1| hypothetical protein HMPREF0992_01227 [Lachnospiraceae bacterium
           6_1_63FAA]
 gi|330404576|gb|EGG84116.1| hypothetical protein HMPREF0992_01227 [Lachnospiraceae bacterium
           6_1_63FAA]
          Length = 137

 Score = 55.7 bits (133), Expect = 2e-06,   Method: Composition-based stats.
 Identities = 14/127 (11%), Positives = 50/127 (39%), Gaps = 3/127 (2%)

Query: 2   KQCIIFIINIVVVFFIDVMGFFILMKC-GADPFYSRIFSIAVAFLVTWIPSRLFIFLKLR 60
           K  I ++   V    ++++G++ L          S + +  +A +  ++ +R ++F    
Sbjct: 11  KDIIPYLFFGVCTTAVNMIGYWTLAYLCDFGMMPSTVIAWLLALIFAYVTNRKWVFKSEA 70

Query: 61  RKSF--LETVRYGVMYFMLSILNYAFYVKLLLTFQGLQPLLATVLSAVSSMLFVFLLYIR 118
           +     +    Y  +  + + +     + L +    L  + +  ++ +  +L  ++   R
Sbjct: 71  KNPAEIVREAFYFFICRLSTGVVDWGSMLLFVGVFRLNDMFSKFVANIIVILLNYIASKR 130

Query: 119 FMTRRVY 125
            + ++  
Sbjct: 131 IIFKKSK 137


>gi|326772227|ref|ZP_08231512.1| membrane spanning protein, GtrA-family [Actinomyces viscosus C505]
 gi|326638360|gb|EGE39261.1| membrane spanning protein, GtrA-family [Actinomyces viscosus C505]
          Length = 187

 Score = 55.7 bits (133), Expect = 2e-06,   Method: Composition-based stats.
 Identities = 19/127 (14%), Positives = 49/127 (38%), Gaps = 3/127 (2%)

Query: 4   CIIFIINIVVVFFIDVMGFFILM-KCGADPFYSRIFSIAVAFLVTWIPSRLFIFLKLRRK 62
            I + I     FF+D+   ++           +      +A + +++ +R   F      
Sbjct: 60  FIGYAIINGSAFFLDITCLWVFYNHLHWFYPVAVTVGYVIAAVYSFLLNRWLNFQAHGH- 118

Query: 63  SFLETVRYGVMYFMLSILNYAFYVKLLLTFQGLQPLLATVLSAVSSMLFVFLLYIRFMTR 122
             ++     +   +   + +   +  LL + G+   LA V+SA    +++++    ++ R
Sbjct: 119 -VVQQGAGYMAGVVSQYVIFILGLSSLLHWFGVNAELARVISACCEGIYLYVFIRLWVFR 177

Query: 123 RVYFIKK 129
            V   +K
Sbjct: 178 GVPEPEK 184


>gi|87200676|ref|YP_497933.1| dolichyl-phosphate beta-D-mannosyltransferase [Novosphingobium
           aromaticivorans DSM 12444]
 gi|87136357|gb|ABD27099.1| Dolichyl-phosphate beta-D-mannosyltransferase [Novosphingobium
           aromaticivorans DSM 12444]
          Length = 373

 Score = 55.7 bits (133), Expect = 2e-06,   Method: Composition-based stats.
 Identities = 12/139 (8%), Positives = 36/139 (25%), Gaps = 22/139 (15%)

Query: 3   QCIIFIINIVVV--------------FFIDVMGFFILMKCGADPFYSRIFSIAVAFLVTW 48
           +  +F     +               F  D+                +  +   A    +
Sbjct: 238 RFALFGTVGGLGAVVHLTVLTLVLHLFGADLQVSH--YPKETAFIVGQTLAALTAMTFNF 295

Query: 49  IPSRLFIFLKLRRKSF----LETVRYGVMYFMLSILNYAFYVKLLLTFQGLQPLLATVLS 104
           + +    +   R +         +++        + N        L   G+    A +  
Sbjct: 296 VLNNELTYSDKRLRGIGPITRGWLKFAATCAFGMLANIGVSTA--LVRIGVHTYPAAIAG 353

Query: 105 AVSSMLFVFLLYIRFMTRR 123
            + + ++ F L  +F+  +
Sbjct: 354 IILASVWNFALSSKFVWGK 372


>gi|300692349|ref|YP_003753344.1| bactoprenol-linked glucose translocase (gtrA) [Ralstonia
           solanacearum PSI07]
 gi|299079409|emb|CBJ52080.1| putative bactoprenol-linked glucose translocase (gtrA) [Ralstonia
           solanacearum PSI07]
          Length = 148

 Score = 55.7 bits (133), Expect = 2e-06,   Method: Composition-based stats.
 Identities = 16/121 (13%), Positives = 39/121 (32%), Gaps = 5/121 (4%)

Query: 3   QCIIFIINIVVVFFIDVMGFFILMKCGADPFY-SRIFSIAVAFLVTWIPSRLFIFLKLRR 61
           +   F ++ VV   + V    +L+   +     +   +   A + +++ + L+ F     
Sbjct: 32  RVFRFGVSGVVATGVHVALAMLLITAFSATQVEANGVAFVCANVCSYLLNALWAFSAR-- 89

Query: 62  KSFLETVRYGVMYFMLSILNYAFYVKLLLTFQGLQPLLATVLSAVSSMLFVFLLYIRFMT 121
                 +R+  +     +L  A          G           ++     FLL+  +  
Sbjct: 90  PGRDNFLRFFCVSVFGLLLTLAISWAA--QKAGANYWTGLAAILMTVPPITFLLHRFWTF 147

Query: 122 R 122
           R
Sbjct: 148 R 148


>gi|224436646|ref|ZP_03657655.1| hypothetical protein HcinC1_01810 [Helicobacter cinaedi CCUG 18818]
 gi|313143146|ref|ZP_07805339.1| predicted protein [Helicobacter cinaedi CCUG 18818]
 gi|313128177|gb|EFR45794.1| predicted protein [Helicobacter cinaedi CCUG 18818]
          Length = 151

 Score = 55.7 bits (133), Expect = 2e-06,   Method: Composition-based stats.
 Identities = 20/111 (18%), Positives = 48/111 (43%), Gaps = 1/111 (0%)

Query: 3   QCIIFIINIVVVFFIDVMGFFILMKCGADPFYSRIFSIAVAFLVTWIPSRLFIFLKLRRK 62
           +   + +       I+ + F+I  + G     + + S  +A L  +I +++FIF   +  
Sbjct: 32  KLYKYALVGGSAALINWLIFYITTESGLWYILAGLLSFILATLWNFIFAKIFIFKHSKHH 91

Query: 63  SFLETVRYGVMYFMLSILNYAFYVKLLLTFQGLQPLLATVLSAVSSMLFVF 113
            F E++   V+ F+   ++        + F     +L+ V++   + +F F
Sbjct: 92  IFKESILVYVVSFIGLCIDMGVLFVC-VEFLAFHTMLSKVIATGIAFIFNF 141


>gi|194288844|ref|YP_002004751.1| membrane component, gtra-like protein [Cupriavidus taiwanensis LMG
           19424]
 gi|193222679|emb|CAQ68682.1| putative membrane component, GtrA-like protein [Cupriavidus
           taiwanensis LMG 19424]
          Length = 129

 Score = 55.7 bits (133), Expect = 2e-06,   Method: Composition-based stats.
 Identities = 15/123 (12%), Positives = 39/123 (31%), Gaps = 5/123 (4%)

Query: 1   MKQCIIFIINIVVVFFIDVMGFFILMKCGA-DPFYSRIFSIAVAFLVTWIPSRLFIFLKL 59
           + +   F+++      + V     L+      P  +   +   A L +++ + L+ F   
Sbjct: 10  LHRFTRFVVSGATSTGVHVAITATLVNLLDASPVTANGLAFVSATLCSYLLNTLWSFSSR 69

Query: 60  RRKSFLETVRYGVMYFMLSILNYAFYVKLLLTFQGLQPLLATVLSAVSSMLFVFLLYIRF 119
                L   R+  +  +   L           + G           ++  +  +LL+  +
Sbjct: 70  LHHRTLR--RFAGVSLLGLALTVGIS--WTAQWLGASYWTGLAGVVLTVPMLTYLLHRTW 125

Query: 120 MTR 122
             R
Sbjct: 126 TYR 128


>gi|19704429|ref|NP_603991.1| dolichol-phosphate mannosyltransferase [Fusobacterium nucleatum
           subsp. nucleatum ATCC 25586]
 gi|19714689|gb|AAL95290.1| Dolichol-phosphate mannosyltransferase [Fusobacterium nucleatum
           subsp. nucleatum ATCC 25586]
          Length = 360

 Score = 55.7 bits (133), Expect = 2e-06,   Method: Composition-based stats.
 Identities = 15/129 (11%), Positives = 45/129 (34%), Gaps = 11/129 (8%)

Query: 4   CIIFIINIVVVFFIDVM----GFFILMKCGADP-----FYSRIFSIAVAFLVTWIPSRLF 54
            + +I +    F +D++       IL+  G          S I +  ++    +  ++ F
Sbjct: 233 FLKYIASATSSFILDILSFKWILAILIALGNIEGAGIITISTIVARIISSSFNFYLNKKF 292

Query: 55  IFLKLRRKSFLETVRYGVMYFMLSILNYAFYVKLLLTFQGLQPLLATVLSAVSSMLFVFL 114
           +F    + +    ++Y  +  +  +L+      +             ++      L  + 
Sbjct: 293 VFKYE-KNTKKSLLKYYSLCTVQMLLSATLVTVVWKHT-RYAETSIKIVVDSILFLLSYF 350

Query: 115 LYIRFMTRR 123
           +  R++ +R
Sbjct: 351 IQQRWVFKR 359


>gi|291545763|emb|CBL18871.1| Predicted membrane protein [Ruminococcus sp. SR1/5]
          Length = 142

 Score = 55.7 bits (133), Expect = 2e-06,   Method: Composition-based stats.
 Identities = 18/121 (14%), Positives = 44/121 (36%), Gaps = 4/121 (3%)

Query: 4   CIIFIINIVVVFFIDVMGFFILMKCGADPFYSRIFSIAVAFLVTWIPSRLFIFLKL---R 60
            I +I        ++++ F+I+   G     + I SI +A L  ++ +  F+F       
Sbjct: 13  VIRYIFWGGCTTLVNLLSFYIMRAMGIPLMSANIISIILAILFAYVVNSRFVFHDRCETW 72

Query: 61  RKSFLETVRYGVMYFMLSILNYAFYVKLLLTFQGLQPLLATVLSAVSSMLFVFLLYIRFM 120
           R      +++     +  ++     V LL    G + + A   +    +   ++     +
Sbjct: 73  RDHIRPFLKFISARLVTMVIEVG-GVWLLAEILGFRDMFAKFCTQFIVLALNYIFSKFII 131

Query: 121 T 121
            
Sbjct: 132 F 132


>gi|73542319|ref|YP_296839.1| GtrA-like protein [Ralstonia eutropha JMP134]
 gi|72119732|gb|AAZ61995.1| GtrA-like protein [Ralstonia eutropha JMP134]
          Length = 129

 Score = 55.7 bits (133), Expect = 2e-06,   Method: Composition-based stats.
 Identities = 14/123 (11%), Positives = 36/123 (29%), Gaps = 5/123 (4%)

Query: 2   KQCIIFIINIVVVFFIDVMGFFILMKC-GADPFYSRIFSIAVAFLVTWIPSRLFIFLKLR 60
           +Q   F++       I V     L+   G  P  +   +   A   +++ + L+ F    
Sbjct: 11  RQVARFLLAGASSTGIHVAIVATLVNATGTSPVKANCVAFVCATACSYLINTLWSFSSRL 70

Query: 61  RKSFLETVRYGVMYFMLSILNYAFYVKLLLTFQGLQPLLATVLSAVSSMLFVFLLYIRFM 120
             +     R+  +  +   L             G           +    F ++ +  + 
Sbjct: 71  HHTT--LWRFAGVSLLGVGLTMGIS--WTAQSVGSSYWTGLACVVLIVPAFTYVAHRSWT 126

Query: 121 TRR 123
            ++
Sbjct: 127 YQK 129


>gi|172061329|ref|YP_001808981.1| GtrA family protein [Burkholderia ambifaria MC40-6]
 gi|171993846|gb|ACB64765.1| GtrA family protein [Burkholderia ambifaria MC40-6]
          Length = 133

 Score = 55.7 bits (133), Expect = 2e-06,   Method: Composition-based stats.
 Identities = 18/119 (15%), Positives = 38/119 (31%), Gaps = 5/119 (4%)

Query: 3   QCIIFIINIVVVFFIDVMGFFILMKCGADPFYSRIFSIAVAFLVTWIPSRLFIFLKLRRK 62
           Q + F+    +   +    F +L   G     +   +     L  +      +F    R 
Sbjct: 17  QLLRFLAVGGLNTLVGYSLFALLTYAGLAYPVAIGLATVGGVLFNFQSVGRLVFDGAPRS 76

Query: 63  SFLETVRYGVMYFMLSILNYAFYVKLLLTFQGLQPLLATVLSAVSSMLFVFLLYIRFMT 121
                 R+  +Y ++ +         LL        +A  L+ +   +  F+L  RF+ 
Sbjct: 77  ---RFWRFVGVYCVIYL--LNLGGVRLLLGLDANIYIANALTLLPLSVIAFILNRRFVF 130


>gi|323485952|ref|ZP_08091284.1| hypothetical protein HMPREF9474_03035 [Clostridium symbiosum
           WAL-14163]
 gi|323693053|ref|ZP_08107273.1| hypothetical protein HMPREF9475_02136 [Clostridium symbiosum
           WAL-14673]
 gi|323400714|gb|EGA93080.1| hypothetical protein HMPREF9474_03035 [Clostridium symbiosum
           WAL-14163]
 gi|323502934|gb|EGB18776.1| hypothetical protein HMPREF9475_02136 [Clostridium symbiosum
           WAL-14673]
          Length = 145

 Score = 55.7 bits (133), Expect = 2e-06,   Method: Composition-based stats.
 Identities = 16/125 (12%), Positives = 51/125 (40%), Gaps = 4/125 (3%)

Query: 2   KQCIIFIINIVVVFFIDVMGFFILMKCGADPFYSRIFSIAVAFLVTWIPSRLFIFLK--- 58
           ++ + + I  V+   +D M + ++        +S + S A A +  ++ +++F+F     
Sbjct: 16  RETVSYFIFGVLTTAVDWMVYPLMRWLDHSVAWSSVVSWAAAVIFAFVTNKIFVFQSYTF 75

Query: 59  LRRKSFLETVRYGVMYFMLSILNYAFYVKLLLTFQGLQPLLATVLSAVSSMLFVFLLYIR 118
             ++   E V +     +         + +++   G    +  V  +  S++  ++    
Sbjct: 76  RPKELSREFVSFVSCRALTGAFTVV-AMVVIVDVMGWNEWIGKVAVSAMSLVLNYIFSKL 134

Query: 119 FMTRR 123
           F+ ++
Sbjct: 135 FIFKK 139


>gi|307942647|ref|ZP_07657995.1| putative GtrA family protein [Roseibium sp. TrichSKD4]
 gi|307774286|gb|EFO33499.1| putative GtrA family protein [Roseibium sp. TrichSKD4]
          Length = 146

 Score = 55.3 bits (132), Expect = 2e-06,   Method: Composition-based stats.
 Identities = 18/119 (15%), Positives = 34/119 (28%), Gaps = 4/119 (3%)

Query: 6   IFIINIVVVFFIDVMG-FFILMKCGADPFYSRIFSIAVAFLVTWIPSRLFIFLKLRRKSF 64
            F +  +       +     L       + S I    VAF+V++     + F   R    
Sbjct: 20  RFALVGIAATLTHSVVALAALQSEMFGAYGSNILGFIVAFVVSFAGHNFWSFKPRRHHGT 79

Query: 65  --LETVRYGVMYFMLSILNYAFYVKLLLTFQGLQPLLATVLSAVSSMLFVFLLYIRFMT 121
                 R+ ++  M  + N        L F      +  + S     +  FL    +  
Sbjct: 80  TGRRMARFLLIAVMGFLANNVVLTAC-LQFTNWPATVGLIFSIAIVPVLSFLGSRFWAF 137


>gi|303236860|ref|ZP_07323439.1| HAD phosphoserine phosphatase-like hydrolase, family IB [Prevotella
           disiens FB035-09AN]
 gi|302483028|gb|EFL46044.1| HAD phosphoserine phosphatase-like hydrolase, family IB [Prevotella
           disiens FB035-09AN]
          Length = 320

 Score = 55.3 bits (132), Expect = 2e-06,   Method: Composition-based stats.
 Identities = 25/121 (20%), Positives = 46/121 (38%), Gaps = 5/121 (4%)

Query: 3   QCIIFIINIVVVFFIDVMGFFILMKCGADPFYSRIFSIAVAFLVTWIPSRLFIFLKLRRK 62
           + I F I  VV   I    + +L+K       S      ++F+  +I S  F F    + 
Sbjct: 205 EFIRFGIVGVVATAIQYGLYLLLLKWLQPQ-ISNTLGYVISFIFNYIASTKFTFKV--KS 261

Query: 63  SFLETVRYGVMYFMLSILNYAFYVKLLLTFQGLQPLLATVLSAVSSMLFVFLLYIRFMTR 122
           +  +   +   +F+  +L   F    L    GL   +A +      +   FLL   F+ +
Sbjct: 262 TAKKGAGFAFSHFINYVLQTVFLTLFLW--LGLPKNIALIPVFCICVPINFLLVRLFLKK 319

Query: 123 R 123
           +
Sbjct: 320 K 320



 Score = 34.5 bits (78), Expect = 5.1,   Method: Composition-based stats.
 Identities = 17/74 (22%), Positives = 33/74 (44%), Gaps = 3/74 (4%)

Query: 56  FLKLRRKSFLETVRYGVMYFMLSILNYAFYVKLLLTFQGLQPLLATVLSAVSSMLFVFLL 115
           F   +     E +R+G++  + + + Y  Y+ LL      QP ++  L  V S +F ++ 
Sbjct: 195 FRNEKTDKTGEFIRFGIVGVVATAIQYGLYLLLLKWL---QPQISNTLGYVISFIFNYIA 251

Query: 116 YIRFMTRRVYFIKK 129
             +F  +     KK
Sbjct: 252 STKFTFKVKSTAKK 265


>gi|34496614|ref|NP_900829.1| hypothetical protein CV_1159 [Chromobacterium violaceum ATCC 12472]
 gi|34102469|gb|AAQ58834.1| conserved hypothetical protein [Chromobacterium violaceum ATCC
           12472]
          Length = 129

 Score = 55.3 bits (132), Expect = 2e-06,   Method: Composition-based stats.
 Identities = 23/121 (19%), Positives = 42/121 (34%), Gaps = 2/121 (1%)

Query: 2   KQCIIFIINIVVVFFIDVMGFFI-LMKCGADPFYSRIFSIAVAFLVTWIPSRLFIFLKLR 60
           KQ   F +  V    +      + L+  GA P  + +     AF +++   R F F    
Sbjct: 3   KQLFWFGVVGVSAMLLHFALVTLVLVPLGAPPLAANVLGFLGAFQLSYWGHRRFTFEAGH 62

Query: 61  RKSFLETVRYGVMYFMLSILNYAFYVKLLLTFQGLQPLLATVLSAVSSMLFVFLLYIRFM 120
                   R+  +  +   +N A Y   LL +  L   ++  +   +     FLL   + 
Sbjct: 63  VPHRQALPRFFGVSCLSFCVNEAMYFA-LLRYAPLDYRVSLAIVLFAVAALTFLLGKLWA 121

Query: 121 T 121
            
Sbjct: 122 F 122


>gi|260589757|ref|ZP_05855670.1| cell wall teichoic acid glycosylation protein GtcA [Blautia
           hansenii DSM 20583]
 gi|260539997|gb|EEX20566.1| cell wall teichoic acid glycosylation protein GtcA [Blautia
           hansenii DSM 20583]
          Length = 137

 Score = 55.3 bits (132), Expect = 2e-06,   Method: Composition-based stats.
 Identities = 14/127 (11%), Positives = 49/127 (38%), Gaps = 3/127 (2%)

Query: 2   KQCIIFIINIVVVFFIDVMGFFILMKC-GADPFYSRIFSIAVAFLVTWIPSRLFIFLKLR 60
           K  I ++   V    ++++G++ L          S + +  +A +  ++ +R ++F    
Sbjct: 11  KDIIPYLFFGVCTTAVNMIGYWTLAYLCDFGMMPSTVIAWLLALIFAYVTNRKWVFKSEA 70

Query: 61  RKSF--LETVRYGVMYFMLSILNYAFYVKLLLTFQGLQPLLATVLSAVSSMLFVFLLYIR 118
           +     +    Y  +  + + +     + L +    L  + +   + +  +L  ++   R
Sbjct: 71  KNPAEIVREAFYFFICRLSTGVVDWGSMLLFVGVFRLNDMFSKFAANIIVILLNYIASKR 130

Query: 119 FMTRRVY 125
            + ++  
Sbjct: 131 IIFKKSK 137


>gi|152967824|ref|YP_001363608.1| GtrA family protein [Kineococcus radiotolerans SRS30216]
 gi|151362341|gb|ABS05344.1| GtrA family protein [Kineococcus radiotolerans SRS30216]
          Length = 147

 Score = 55.3 bits (132), Expect = 2e-06,   Method: Composition-based stats.
 Identities = 21/124 (16%), Positives = 50/124 (40%), Gaps = 5/124 (4%)

Query: 3   QCIIFIINIVVVFFIDVMGFFILMKCGADPFYSRIFSIAVAFLVTWIPSRLFIFLKLRR- 61
           + + F+++  + +  D++ F +L+  G    +S++ S  +A  + ++ SR + +   R  
Sbjct: 16  EVVRFLVSGGIAYLADLVVFNVLLLAGVGSVWSKVVSSVIAIFIAFLGSRYYTWRDRRSE 75

Query: 62  KSFLETVRYGVMYFMLSILNYAFYVKLLLTFQG----LQPLLATVLSAVSSMLFVFLLYI 117
               E   + +   + + L           F         L   V+    +M+F FL + 
Sbjct: 76  HPGREYAMFFLFSAIAAGLQLLCLAITHYGFGWTSALADNLSGNVVGMAIAMVFRFLTFR 135

Query: 118 RFMT 121
            F+ 
Sbjct: 136 TFVF 139


>gi|160936256|ref|ZP_02083629.1| hypothetical protein CLOBOL_01152 [Clostridium bolteae ATCC
           BAA-613]
 gi|158441066|gb|EDP18790.1| hypothetical protein CLOBOL_01152 [Clostridium bolteae ATCC
           BAA-613]
          Length = 152

 Score = 55.3 bits (132), Expect = 2e-06,   Method: Composition-based stats.
 Identities = 17/126 (13%), Positives = 44/126 (34%), Gaps = 6/126 (4%)

Query: 3   QCIIFIINIVVVFFIDVMGFFILMKCGADPFYSRIFSIAVAFLVTWIPSRLFIFLK---L 59
           + + +II   +   +D   + +L +       S+  S   A L  ++ ++L +F      
Sbjct: 23  ETVSYIICGFLTTAVDFAVYALLRQIEIGVGLSQAMSWLAAVLFAYVVNKLIVFRNYNLR 82

Query: 60  RRKSFLETVRYGVMYFMLSILNYAFYVKLLLTF---QGLQPLLATVLSAVSSMLFVFLLY 116
                 E   +         + +   V ++        L  L     S+V +M+  ++  
Sbjct: 83  PSYLVKEVGAFVAARAFSGAVTWVLMVVMVKLGGDRGMLYELFCKFTSSVINMVLNYIFS 142

Query: 117 IRFMTR 122
             ++ +
Sbjct: 143 KLWIFK 148


>gi|83747553|ref|ZP_00944590.1| Hypothetical Protein RRSL_02048 [Ralstonia solanacearum UW551]
 gi|83725733|gb|EAP72874.1| Hypothetical Protein RRSL_02048 [Ralstonia solanacearum UW551]
          Length = 148

 Score = 55.3 bits (132), Expect = 2e-06,   Method: Composition-based stats.
 Identities = 17/121 (14%), Positives = 37/121 (30%), Gaps = 5/121 (4%)

Query: 3   QCIIFIINIVVVFFIDVMGFFIL-MKCGADPFYSRIFSIAVAFLVTWIPSRLFIFLKLRR 61
           +   F I+ VV   + V    +L     A    +   +   A + +++ + L+ F     
Sbjct: 32  RVFRFGISGVVATGVHVALAMLLITGFSATQVEANGVAFVCANVCSYLLNALWAFSAR-- 89

Query: 62  KSFLETVRYGVMYFMLSILNYAFYVKLLLTFQGLQPLLATVLSAVSSMLFVFLLYIRFMT 121
                 +R+  +     +L  A          G            +     F+L+  +  
Sbjct: 90  PGRDNFLRFFCVSVFGLLLTLAIS--WTAQRLGANYWTGLAGILATVPPITFVLHRFWTF 147

Query: 122 R 122
           R
Sbjct: 148 R 148


>gi|300781506|ref|ZP_07091360.1| conserved hypothetical protein [Corynebacterium genitalium ATCC
           33030]
 gi|300533213|gb|EFK54274.1| conserved hypothetical protein [Corynebacterium genitalium ATCC
           33030]
          Length = 195

 Score = 55.3 bits (132), Expect = 2e-06,   Method: Composition-based stats.
 Identities = 16/162 (9%), Positives = 46/162 (28%), Gaps = 38/162 (23%)

Query: 2   KQCIIFIINIVVVFFIDVMGFFILMKCGA----------------------DPFYSRIFS 39
           ++ I F I      F+++   +++ K                                 +
Sbjct: 28  REFIKFGIVGGSGVFVNLAVVYVVKKALELGWDIHENEVFMNLFGTRWNVRWYHVIMTIA 87

Query: 40  IAVAFLVTWIPSRLFIFLKLRRKSFLE-TVRYGVMYFMLSILNYAFYVKLLLTFQGLQ-- 96
             VA    +  +R + F  + +KS+L     +     +  +++      L+     +   
Sbjct: 88  FVVANTWNYQLNRSWTFRNVPKKSWLRGYFPFMTTGIVAFLVSQTVATLLMNPTSPIALS 147

Query: 97  -------------PLLATVLSAVSSMLFVFLLYIRFMTRRVY 125
                           +  +S + +M   F++   +   +  
Sbjct: 148 DDIFDNSTGFRTKFYWSAAISTLVAMPVNFVINKLWTFGKPK 189


>gi|218658317|ref|ZP_03514247.1| hypothetical protein RetlI_00927 [Rhizobium etli IE4771]
          Length = 88

 Score = 55.3 bits (132), Expect = 2e-06,   Method: Composition-based stats.
 Identities = 25/88 (28%), Positives = 42/88 (47%), Gaps = 1/88 (1%)

Query: 1  MKQCIIFIINIVVVFFIDVMGFFILMKCGA-DPFYSRIFSIAVAFLVTWIPSRLFIFLKL 59
          MK+ I F I   + F +D      ++      PF +R+ +I++A   TW  +R F F + 
Sbjct: 1  MKKLIRFAIAGGIGFLVDAGVLSAMLDLTPLGPFGARLIAISLAMAATWAFNRNFTFDRS 60

Query: 60 RRKSFLETVRYGVMYFMLSILNYAFYVK 87
           R    E +RYG +    +++NY  Y  
Sbjct: 61 GRSLAEEGIRYGSVGVTAALVNYGLYSA 88


>gi|331090984|ref|ZP_08339826.1| hypothetical protein HMPREF9477_00469 [Lachnospiraceae bacterium
           2_1_46FAA]
 gi|330405206|gb|EGG84742.1| hypothetical protein HMPREF9477_00469 [Lachnospiraceae bacterium
           2_1_46FAA]
          Length = 137

 Score = 55.3 bits (132), Expect = 3e-06,   Method: Composition-based stats.
 Identities = 15/122 (12%), Positives = 45/122 (36%), Gaps = 3/122 (2%)

Query: 1   MKQCIIFIINIVVVFFIDVMGFF-ILMKCGADPFYSRIFSIAVAFLVTWIPSRLFIFLKL 59
           + + I +         I+ + +   L        ++   +   A L  +  ++ F+F K 
Sbjct: 6   LTEFIRYCFIGGCTTAINYLVYIGFLFFFQKHYLFANTVAWIFAVLFAFYANKYFVFQKT 65

Query: 60  RRKSFLETVRYGVMYFMLSILNYAFYVKLLLTFQGLQPLLATVLSAVSSMLFVFLLYIRF 119
            +    E + +  M  +  ++        +     +  L+A ++ +V ++L  ++L    
Sbjct: 66  EKSD-REALSFFSMRLLTLLIENVLLYICIQQLL-IHSLIAKLVVSVITVLANYVLCKYK 123

Query: 120 MT 121
           + 
Sbjct: 124 IF 125


>gi|311741640|ref|ZP_07715463.1| conserved hypothetical protein [Corynebacterium pseudogenitalium
           ATCC 33035]
 gi|311303304|gb|EFQ79384.1| conserved hypothetical protein [Corynebacterium pseudogenitalium
           ATCC 33035]
          Length = 137

 Score = 55.3 bits (132), Expect = 3e-06,   Method: Composition-based stats.
 Identities = 21/120 (17%), Positives = 43/120 (35%)

Query: 2   KQCIIFIINIVVVFFIDVMGFFILMKCGADPFYSRIFSIAVAFLVTWIPSRLFIFLKLRR 61
           +  ++F I  V+   ID      L   GA+    R  S  +  L  +  +R  IF   R 
Sbjct: 11  RAVVLFCIVGVIGASIDFGTMHFLETSGANALIGREISYILGSLFAYYANRFVIFSGNRS 70

Query: 62  KSFLETVRYGVMYFMLSILNYAFYVKLLLTFQGLQPLLATVLSAVSSMLFVFLLYIRFMT 121
            +            ++  +      ++ L        L+ V+S  ++    F+L  +++ 
Sbjct: 71  TTEKLMAFIVYTACLIMTVLVNKLARIPLADFEHTVFLSWVISQATATTLNFILQSKWVF 130


>gi|207728093|ref|YP_002256487.1| hypothetical protein RSMK04475 [Ralstonia solanacearum MolK2]
 gi|207742488|ref|YP_002258880.1| hypothetical transmembrane protein [Ralstonia solanacearum IPO1609]
 gi|206591338|emb|CAQ56950.1| conserved hypothetical protein [Ralstonia solanacearum MolK2]
 gi|206593879|emb|CAQ60806.1| hypothetical transmembrane protein [Ralstonia solanacearum IPO1609]
          Length = 149

 Score = 55.3 bits (132), Expect = 3e-06,   Method: Composition-based stats.
 Identities = 17/121 (14%), Positives = 37/121 (30%), Gaps = 5/121 (4%)

Query: 3   QCIIFIINIVVVFFIDVMGFFIL-MKCGADPFYSRIFSIAVAFLVTWIPSRLFIFLKLRR 61
           +   F I+ VV   + V    +L     A    +   +   A + +++ + L+ F     
Sbjct: 33  RVFRFGISGVVATGVHVALAMLLITGFSATQVEANGVAFVCANVCSYLLNALWAFSAR-- 90

Query: 62  KSFLETVRYGVMYFMLSILNYAFYVKLLLTFQGLQPLLATVLSAVSSMLFVFLLYIRFMT 121
                 +R+  +     +L  A          G            +     F+L+  +  
Sbjct: 91  PGRDNFLRFFCVSVFGLLLTLAIS--WTAQRLGANYWTGLAGILATVPPITFVLHRFWTF 148

Query: 122 R 122
           R
Sbjct: 149 R 149


>gi|307610110|emb|CBW99651.1| hypothetical protein LPW_14191 [Legionella pneumophila 130b]
          Length = 388

 Score = 55.3 bits (132), Expect = 3e-06,   Method: Composition-based stats.
 Identities = 13/128 (10%), Positives = 37/128 (28%), Gaps = 7/128 (5%)

Query: 1   MKQCIIFIINIVVVFFIDVMGFFILMKCGADPFYSRIFSIAVAFLVTWIPSRLFIFLKL- 59
           ++Q +       +   I    +  L         S   +I+ A +  +I      F +  
Sbjct: 243 LRQYLTMCCVGSIGALIQFSLYNWLRSSNYSALVSSQVAISAAIISNFIFHHSITFKQKT 302

Query: 60  ----RRKSFLETVRYGVMYFMLSILNYAFYVKLLLTF--QGLQPLLATVLSAVSSMLFVF 113
                + +F    ++ +    +      +    + +F    L+  +          +  +
Sbjct: 303 DFRITKTTFSRFTQFIIYSTFMVYFQSLWVHIFVHSFGQGVLKENIIVASGLGIGSIINY 362

Query: 114 LLYIRFMT 121
           L Y   + 
Sbjct: 363 LFYSNIIW 370


>gi|322376542|ref|ZP_08051035.1| putative glycosyl transferase, group 2 family [Streptococcus sp.
           M334]
 gi|321282349|gb|EFX59356.1| putative glycosyl transferase, group 2 family [Streptococcus sp.
           M334]
          Length = 347

 Score = 55.3 bits (132), Expect = 3e-06,   Method: Composition-based stats.
 Identities = 15/127 (11%), Positives = 42/127 (33%), Gaps = 8/127 (6%)

Query: 2   KQCIIFIINIVVVFFIDVMGFFILMKC------GADPFYSRIFSIAVAFLVTWIPSRLFI 55
           K  + F ++    F +D + +   +        G     S   +   + +  +  ++  +
Sbjct: 216 KNILKFALSSFSSFIVDYLVYAFFILFLSFIPSGLHLLLSNGLARVTSSIFNFSTNKKLV 275

Query: 56  FLKLRRKSFLETVRYGVMYFMLSILNYAFYVKLLLTFQGLQPLLATVLSAVSSMLFVFLL 115
           F      +      Y  +  +L  L+         T  G+   +A +   +   +  + +
Sbjct: 276 FKNKA-SNLKTGAGYLTLSVVLFFLDTLLISL-FNTGFGINLFMAKIFVGMLLFVVSWTV 333

Query: 116 YIRFMTR 122
             RF+ +
Sbjct: 334 QTRFIFK 340


>gi|118466057|ref|YP_879526.1| membrane protein [Mycobacterium avium 104]
 gi|254773291|ref|ZP_05214807.1| membrane protein [Mycobacterium avium subsp. avium ATCC 25291]
 gi|118167344|gb|ABK68241.1| membrane protein [Mycobacterium avium 104]
          Length = 134

 Score = 55.3 bits (132), Expect = 3e-06,   Method: Composition-based stats.
 Identities = 17/121 (14%), Positives = 43/121 (35%), Gaps = 1/121 (0%)

Query: 3   QCIIFIINIVVVFFIDVMGFFILMKC-GADPFYSRIFSIAVAFLVTWIPSRLFIFLKLRR 61
           Q + F++   +   +D   +  L K  G     ++  S  V  +  ++ +R + F     
Sbjct: 12  QVMRFVVTGGLAGIVDFGLYATLYKVVGVQVDVAKAISFIVGTITAYLINRRWTFQAAPS 71

Query: 62  KSFLETVRYGVMYFMLSILNYAFYVKLLLTFQGLQPLLATVLSAVSSMLFVFLLYIRFMT 121
            +    V           +         L ++G    +A V++  ++ +  F++    + 
Sbjct: 72  TARFVAVMALYAVTFAVQVGLNHLCLAFLHYRGWAIPVAFVIAQGTATVINFVVQRAVIF 131

Query: 122 R 122
           R
Sbjct: 132 R 132


>gi|296328217|ref|ZP_06870748.1| dolichyl-phosphate beta-D-mannosyltransferase [Fusobacterium
           nucleatum subsp. nucleatum ATCC 23726]
 gi|296154729|gb|EFG95515.1| dolichyl-phosphate beta-D-mannosyltransferase [Fusobacterium
           nucleatum subsp. nucleatum ATCC 23726]
          Length = 360

 Score = 55.3 bits (132), Expect = 3e-06,   Method: Composition-based stats.
 Identities = 17/129 (13%), Positives = 48/129 (37%), Gaps = 11/129 (8%)

Query: 4   CIIFIINIVVVFFIDVM----GFFILMKCGADP-----FYSRIFSIAVAFLVTWIPSRLF 54
            + +I +    F +D++       IL+  G          S I +  ++    +  ++ F
Sbjct: 233 FLKYIASATSSFILDILSFKWILAILIALGNIEGAGIITISTIVARIISSSFNFYLNKKF 292

Query: 55  IFLKLRRKSFLETVRYGVMYFMLSILNYAFYVKLLLTFQGLQPLLATVLSAVSSMLFVFL 114
           +F    + +    ++Y  +  +  +L+ A  V ++            ++      L  + 
Sbjct: 293 VFKYE-KNTKKSLLKYYSLCTVQMLLS-AILVTVVWKHTRYAETSIKIVVDSILFLLSYF 350

Query: 115 LYIRFMTRR 123
           +  R++ +R
Sbjct: 351 IQQRWVFKR 359


>gi|269124705|ref|YP_003298075.1| GtrA family protein [Thermomonospora curvata DSM 43183]
 gi|268309663|gb|ACY96037.1| GtrA family protein [Thermomonospora curvata DSM 43183]
          Length = 425

 Score = 55.3 bits (132), Expect = 3e-06,   Method: Composition-based stats.
 Identities = 21/124 (16%), Positives = 44/124 (35%), Gaps = 5/124 (4%)

Query: 2   KQCIIFIINIVVVFFIDVMGFFILMKCGADPFYSRIFSIAVAFLVTWIPSRLFIFLKLRR 61
           +Q   F +   V   +  +  F+L++    P  +   S+ VA +     +R F F    R
Sbjct: 274 RQLPRFALVGGVSTVV-QLVLFLLLRTVMGPLAANAVSLVVATVGNTAANRRFTFGVRGR 332

Query: 62  ----KSFLETVRYGVMYFMLSILNYAFYVKLLLTFQGLQPLLATVLSAVSSMLFVFLLYI 117
               +  LE     ++   LS    A    L+          A + +  ++ +  F+   
Sbjct: 333 QGMARHHLEGFAVFLLGLGLSSGGLALVHALVPDASRALEAAALIAANSTATVLRFVAMR 392

Query: 118 RFMT 121
            ++ 
Sbjct: 393 AWVF 396


>gi|312961414|ref|ZP_07775917.1| GtrA family protein [Pseudomonas fluorescens WH6]
 gi|311284309|gb|EFQ62887.1| GtrA family protein [Pseudomonas fluorescens WH6]
          Length = 135

 Score = 55.3 bits (132), Expect = 3e-06,   Method: Composition-based stats.
 Identities = 20/119 (16%), Positives = 42/119 (35%), Gaps = 3/119 (2%)

Query: 4   CIIFIINIVVVFFIDVMGFFILMKCGA-DPFYSRIFSIAVAFLVTWIPSRLFIFLKLRRK 62
            + +    ++ + +D+  F +LM      P  + I    VA +  +   R F F      
Sbjct: 3   FVRYGTIQLMAYALDMGTFLLLMTLSQDHPVLANITGKMVAGVFAFFLHRHFTFQSTHAS 62

Query: 63  SFLETVRYGVMYFMLSILNYAFYVKLLLTFQGLQPLLATVLSAVSSMLFVFLLYIRFMT 121
              + VRY  +  +   +  A +   L       P    ++S V  +   + +   F+ 
Sbjct: 63  GKAQAVRYFSLLALNIPVASALFSLGLY--FINSPAPVKLISDVICVALTYWISKLFVF 119


>gi|255324438|ref|ZP_05365555.1| conserved hypothetical protein [Corynebacterium tuberculostearicum
           SK141]
 gi|311740709|ref|ZP_07714536.1| conserved hypothetical protein [Corynebacterium pseudogenitalium
           ATCC 33035]
 gi|255298344|gb|EET77644.1| conserved hypothetical protein [Corynebacterium tuberculostearicum
           SK141]
 gi|311304229|gb|EFQ80305.1| conserved hypothetical protein [Corynebacterium pseudogenitalium
           ATCC 33035]
          Length = 187

 Score = 55.3 bits (132), Expect = 3e-06,   Method: Composition-based stats.
 Identities = 19/158 (12%), Positives = 44/158 (27%), Gaps = 38/158 (24%)

Query: 3   QCIIFIINIVVVFFIDVMGFFILMKCGAD----------------------PFYSRIFSI 40
           Q + F I       +++   ++  K                                 + 
Sbjct: 15  QFLKFGIVGGSGTAVNLFVVYLCRKITWWSGGIEADDPFINLFGSVFHIRWYHVFLTIAF 74

Query: 41  AVAFLVTWIPSRLFIFLKLRRKSFLE-TVRYGVMYFMLSILNYAFYVKLLLTFQGLQ--- 96
            VA    +  +R++ F  + + S+L     + +      I++      L+     L    
Sbjct: 75  LVANTWNYQLNRMWTFRSVAKVSWLRGFFPFLLAGIGAFIVSQVVATLLMNPTSPLHLPS 134

Query: 97  ------------PLLATVLSAVSSMLFVFLLYIRFMTR 122
                          A+ +S + +M   F+L   +  R
Sbjct: 135 DILDDSTGLRTKVYWASAISIIVAMPINFILNKLWTFR 172


>gi|154492282|ref|ZP_02031908.1| hypothetical protein PARMER_01916 [Parabacteroides merdae ATCC
           43184]
 gi|154087507|gb|EDN86552.1| hypothetical protein PARMER_01916 [Parabacteroides merdae ATCC
           43184]
          Length = 125

 Score = 55.3 bits (132), Expect = 3e-06,   Method: Composition-based stats.
 Identities = 19/123 (15%), Positives = 48/123 (39%), Gaps = 2/123 (1%)

Query: 1   MKQCIIFIINIVVVFFIDVMGFFILM-KCGADPFYSRIFSIAVAFLVTWIPSRLFIFLKL 59
           M + + FI+   +   I V+  +++M K G +   + I +  +A +  +  S+ +IF   
Sbjct: 1   MVRVMRFILVGTLNALITVLIVWLMMDKLGCNYIATNITAYVIAQINNFFWSKYWIFSSR 60

Query: 60  RRKSFLETVRYGVMYFMLSILNYAFYVKLLLTFQGLQPLLATVLSAVSSMLFVFLLYIRF 119
             K   E   + + +       +   + +++    L   LA  L         +++  + 
Sbjct: 61  TGKFRREIPLFLIAFGCAYCSQF-LALLIMVEIFDLNEYLAQFLGLFIYGAVNYMMNKKI 119

Query: 120 MTR 122
             +
Sbjct: 120 TFQ 122


>gi|90413971|ref|ZP_01221956.1| hypothetical protein P3TCK_07896 [Photobacterium profundum 3TCK]
 gi|90325033|gb|EAS41548.1| hypothetical protein P3TCK_07896 [Photobacterium profundum 3TCK]
          Length = 151

 Score = 55.3 bits (132), Expect = 3e-06,   Method: Composition-based stats.
 Identities = 23/147 (15%), Positives = 44/147 (29%), Gaps = 28/147 (19%)

Query: 3   QCIIFIINIVVVFFIDVMGFFILMKCGADPFYSRIFSIAVAFLVTWIPSRLFIFLKLRR- 61
           +   F     + F +D    F L         +R  +  VA    W  +R   F      
Sbjct: 2   KVFRFAGVGSIGFVVDAATMFFLSSY-IAFIPARAIAFWVAATSNWWLNRHITFDASNNP 60

Query: 62  KSFLETVRYGVMYFMLSILNYAFYVK--------------------------LLLTFQGL 95
           K   +  R+  +  +  I N+  Y                              L  + +
Sbjct: 61  KPVQQWGRFLAVSCIGFIPNWGCYWLLMQSIDINQLLIESLIKYPEMKTLIINHLDIEVV 120

Query: 96  QPLLATVLSAVSSMLFVFLLYIRFMTR 122
             ++A V   +  ++  +LL  R++ R
Sbjct: 121 WSVVAMVPGVLLGLITNYLLAERWVFR 147


>gi|327458991|gb|EGF05339.1| dolichyl-phosphate beta-D-mannosyltransferase [Streptococcus
           sanguinis SK1057]
          Length = 302

 Score = 55.3 bits (132), Expect = 3e-06,   Method: Composition-based stats.
 Identities = 15/127 (11%), Positives = 44/127 (34%), Gaps = 8/127 (6%)

Query: 2   KQCIIFIINIVVVFFIDVMGFFILMKCGAD------PFYSRIFSIAVAFLVTWIPSRLFI 55
           K    F +  +  F +D + + + +              +   +   + +  +  ++  +
Sbjct: 171 KNIFKFALTSLSSFVVDYIVYAMALLFLTAVPTSLRILLANGIARVTSSIFNYSTNKRLV 230

Query: 56  FLKLRRKSFLETVRYGVMYFMLSILNYAFYVKLLLTFQGLQPLLATVLSAVSSMLFVFLL 115
           F             Y  +  +L IL+    ++L     GL  L+  ++  +      +++
Sbjct: 231 FKNDD-SILKTGTGYFSLAVVLFILD-TLLIRLFYAVFGLNLLIVKIIVGILLFTVSWMV 288

Query: 116 YIRFMTR 122
             RF+ +
Sbjct: 289 QKRFIFK 295


>gi|253577976|ref|ZP_04855248.1| conserved hypothetical protein [Ruminococcus sp. 5_1_39B_FAA]
 gi|251850294|gb|EES78252.1| conserved hypothetical protein [Ruminococcus sp. 5_1_39BFAA]
          Length = 138

 Score = 55.3 bits (132), Expect = 3e-06,   Method: Composition-based stats.
 Identities = 20/121 (16%), Positives = 49/121 (40%), Gaps = 4/121 (3%)

Query: 4   CIIFIINIVVVFFIDVMGFFILMKCGADPFYSRIFSIAVAFLVTWIPSRLFIFLKLR--- 60
            I +I        ++++ FFIL K   +   + I SI +A L  ++ +  ++F       
Sbjct: 13  VIRYIFFGGCTTMVNLVSFFILRKLKVELNIANIISIILAILFAYVVNSKYVFQDKCETL 72

Query: 61  RKSFLETVRYGVMYFMLSILNYAFYVKLLLTFQGLQPLLATVLSAVSSMLFVFLLYIRFM 120
           +       ++     +  ++     V LL++  GL  ++   L+    ++  ++    F+
Sbjct: 73  KDHVQPFCKFVSARLVTMVIEVG-GVWLLVSVMGLNDMIGKFLTQFIVLILNYVFSKFFV 131

Query: 121 T 121
            
Sbjct: 132 F 132


>gi|323340248|ref|ZP_08080512.1| teichoic acid glycosylation protein GtrA [Lactobacillus ruminis
           ATCC 25644]
 gi|323092439|gb|EFZ35047.1| teichoic acid glycosylation protein GtrA [Lactobacillus ruminis
           ATCC 25644]
          Length = 160

 Score = 55.3 bits (132), Expect = 3e-06,   Method: Composition-based stats.
 Identities = 17/122 (13%), Positives = 42/122 (34%), Gaps = 5/122 (4%)

Query: 4   CIIFIINIVVVFFIDVMGFFILM-KCGADPFYSRIFSIAVAFLVTWIPSRLFIFL---KL 59
            + +     +   ++++ F IL    G +   + + S     LVT+  ++  +F      
Sbjct: 11  FVSYTFFGTLASGVNLIVFHILYQNIGINYVVANVISYICGMLVTFFTNKRLVFHSEYDS 70

Query: 60  RRKSFLETVRYGVMYFMLSILNYAFYVKLLLTFQGLQPLLATVLSAVSSMLFVFLLYIRF 119
            +K   E + +  +      L+    V  +  F     LL  ++      +  +     F
Sbjct: 71  VKKLIREFLSFCNVRLFSFFLDNFIMVVGIGIFPINADLL-KIIDQCIVGILNYFFSKWF 129

Query: 120 MT 121
           + 
Sbjct: 130 IF 131


>gi|219853375|ref|YP_002470497.1| hypothetical protein CKR_0032 [Clostridium kluyveri NBRC 12016]
 gi|219567099|dbj|BAH05083.1| hypothetical protein [Clostridium kluyveri NBRC 12016]
          Length = 132

 Score = 55.3 bits (132), Expect = 3e-06,   Method: Composition-based stats.
 Identities = 18/119 (15%), Positives = 59/119 (49%), Gaps = 2/119 (1%)

Query: 3   QCIIFIINIVVVFFIDVMGFFILMKCGADPFYSRIFSIAVAFLVTWIPSRLFIFLKLRRK 62
           + I + I+  +   I ++ + IL++ G +   S + +  +  +  +I  ++++F    +K
Sbjct: 15  KFIKYAISGTINTLITLLIYNILIQIGVNYMISNVIAYFLGIINGFILDKIWVFK-SNKK 73

Query: 63  SFLETVRYGVMYFMLSILNYAFYVKLLLTFQGLQPLLATVLSAVSSMLFVFLLYIRFMT 121
             +   ++ ++  +  + N +  +  L+   GL  +L+ ++S +S+ +F +++   +  
Sbjct: 74  IVILFSKFIIVNIISLLFN-SIILFTLVNNIGLDSVLSQLISTISTGMFNYIMNKVWTF 131


>gi|190572680|ref|YP_001970525.1| putative transmembrane GtrA-like cell surface polysaccharide
           biosynthesis protein [Stenotrophomonas maltophilia
           K279a]
 gi|190010602|emb|CAQ44211.1| putative transmembrane GtrA-like cell surface polysaccharide
           biosynthesis protein [Stenotrophomonas maltophilia
           K279a]
          Length = 134

 Score = 55.3 bits (132), Expect = 3e-06,   Method: Composition-based stats.
 Identities = 13/126 (10%), Positives = 44/126 (34%), Gaps = 7/126 (5%)

Query: 3   QCIIFIINIVVVFFIDVMGFFILMKCGADPFYSRIFSIAVAFLVTWIPSRLFIFLKLRRK 62
           Q I F++   +   ++V    +L         + + +  +  +  +  +++F+F +   +
Sbjct: 9   QFIRFLLVGGLAAAVNVGSRILLSHW-LPYVTAILLAFCLGLVTAFALNKVFVFNQASNR 67

Query: 63  SFLETVRYGVMYFMLSILNYAF------YVKLLLTFQGLQPLLATVLSAVSSMLFVFLLY 116
              + + +  +                 ++  LL        +A  L  +  ++  ++ +
Sbjct: 68  LHHQVLWFIAVNIAAVGQTLLISLLVARWLLPLLNVDFHNETIAHALGVIVPVITSYIGH 127

Query: 117 IRFMTR 122
            R   R
Sbjct: 128 KRLSFR 133


>gi|255625167|ref|XP_002540591.1| conserved hypothetical protein [Ricinus communis]
 gi|223494850|gb|EEF21792.1| conserved hypothetical protein [Ricinus communis]
          Length = 131

 Score = 55.3 bits (132), Expect = 3e-06,   Method: Composition-based stats.
 Identities = 21/93 (22%), Positives = 36/93 (38%), Gaps = 1/93 (1%)

Query: 2  KQCIIFIINIVVVFFIDVMGFFILMKCGADPFYSRIFSIAVAFLVTWIPSRLFIF-LKLR 60
          ++ + F I   +   +D    + ++  GA  F  R  S   A   TW  +R F F     
Sbjct: 3  RELLRFAIAGAIGLVVDAGVLYGMLALGAGYFVGRAVSFVAAVWSTWQFNRHFTFVQGSN 62

Query: 61 RKSFLETVRYGVMYFMLSILNYAFYVKLLLTFQ 93
          + ++ E   Y        ++NYA Y   +L   
Sbjct: 63 KSAWAEWWHYLFAMLGGGVVNYAAYSATVLLLP 95


>gi|153010071|ref|YP_001371286.1| GtrA family protein [Ochrobactrum anthropi ATCC 49188]
 gi|151561959|gb|ABS15457.1| GtrA family protein [Ochrobactrum anthropi ATCC 49188]
          Length = 129

 Score = 55.3 bits (132), Expect = 3e-06,   Method: Composition-based stats.
 Identities = 21/120 (17%), Positives = 42/120 (35%), Gaps = 2/120 (1%)

Query: 4   CIIFIINIVVVFFIDVMGFFILMKCGA-DPFYSRIFSIAVAFLVTWIPSRLFIFLKLRRK 62
            + F+I      FI+ + F  L          +      V     +I ++ + F      
Sbjct: 11  LMRFLIVGGASTFINYLVFTGLYSGKMLGYMPASAMGFLVGLAFGYIFNKRWTFGATAPS 70

Query: 63  SFLETVRYGVMYFMLSILNYAFYVKLLLTFQGLQPLLATVLSAVSSMLFVFLLYIRFMTR 122
           S      Y V+Y     L     + +L+ +  + PL+A  +S + +    F+     + R
Sbjct: 71  SPSIIAGYIVVYMTSLCLGL-LAIHVLVAYARINPLVANGMSIILTTCTNFIGTRYLVFR 129


>gi|52841636|ref|YP_095435.1| glycosyltransferase [Legionella pneumophila subsp. pneumophila str.
           Philadelphia 1]
 gi|52628747|gb|AAU27488.1| glycosyltransferase [Legionella pneumophila subsp. pneumophila str.
           Philadelphia 1]
          Length = 391

 Score = 55.3 bits (132), Expect = 3e-06,   Method: Composition-based stats.
 Identities = 13/128 (10%), Positives = 37/128 (28%), Gaps = 7/128 (5%)

Query: 1   MKQCIIFIINIVVVFFIDVMGFFILMKCGADPFYSRIFSIAVAFLVTWIPSRLFIFLKL- 59
           ++Q +       +   I    +  L         S   +I+ A +  +I      F +  
Sbjct: 246 LRQYLTMCCVGSIGALIQFSLYNWLRSSNHSALVSSQVAISAAIISNFIFHHSITFKQKT 305

Query: 60  ----RRKSFLETVRYGVMYFMLSILNYAFYVKLLLTF--QGLQPLLATVLSAVSSMLFVF 113
                + +F    ++ +    +      +    + +F    L+  +          +  +
Sbjct: 306 DFRITKTTFSRFTQFIIYSTFMVYFQSLWVHIFVHSFGQGVLKENIIVASGLGIGSIINY 365

Query: 114 LLYIRFMT 121
           L Y   + 
Sbjct: 366 LFYSNIIW 373


>gi|309812784|ref|ZP_07706523.1| GtrA-like protein [Dermacoccus sp. Ellin185]
 gi|308433301|gb|EFP57194.1| GtrA-like protein [Dermacoccus sp. Ellin185]
          Length = 176

 Score = 55.3 bits (132), Expect = 3e-06,   Method: Composition-based stats.
 Identities = 14/128 (10%), Positives = 43/128 (33%), Gaps = 6/128 (4%)

Query: 3   QCIIFIINIVVVFFIDVMGFFILMKCGADPFYSRIFSIAVAFLVTWIPSRLFIFLKLRRK 62
           Q + F +  +    +    F +L     +   + I ++ +  ++    ++ F F     +
Sbjct: 52  QAMRFAMVGIASTVLYTALFAVL-DTRMNHQIANILALLICTVLNTWVNQRFTFDAAGHE 110

Query: 63  SFLETVRYGVMYFMLSILNYAFYVKLLLTFQGLQPLLATVLSAVSSMLFVFLLY--IRFM 120
              +     +    + ++  A     L       P  +T+   V+  +   +       +
Sbjct: 111 RGRDA---HLQSLAILVVTLAVTSGALALEHHQWPHASTLWDTVTVTVGNAIATVIRFVV 167

Query: 121 TRRVYFIK 128
            RR++  +
Sbjct: 168 FRRIFAAR 175


>gi|259506880|ref|ZP_05749780.1| membrane protein [Corynebacterium efficiens YS-314]
 gi|259165512|gb|EEW50066.1| membrane protein [Corynebacterium efficiens YS-314]
          Length = 177

 Score = 54.9 bits (131), Expect = 3e-06,   Method: Composition-based stats.
 Identities = 18/164 (10%), Positives = 42/164 (25%), Gaps = 38/164 (23%)

Query: 2   KQCIIFIINIVVVFFIDVMGFFILMKCGAD----------------------PFYSRIFS 39
           +Q I F +       +++    +  K                                 +
Sbjct: 6   RQFIKFGLVGGSGTIVNLAVAALSKKIAGWTAGISEHDPFMNLLGTDFHIRWYHVFMTIA 65

Query: 40  IAVAFLVTWIPSRLFIFLK-LRRKSFLETVRYGVMYFMLSILNYAFYVKLLLTFQGLQ-- 96
             VA +  +  +R + F     R  +     +     +  +++      L+     L   
Sbjct: 66  FLVANIWNYQLNRTWTFKMINMRSWWRGFFPFLATGLVAFVVSQVVTTLLMNPTSPLALS 125

Query: 97  -------------PLLATVLSAVSSMLFVFLLYIRFMTRRVYFI 127
                           A  +S + SM   F++   +  R+   I
Sbjct: 126 SEIFDDSTGLRTKFYWALTISILISMPVNFIVNKYWAFRKPKTI 169


>gi|297243022|ref|ZP_06926960.1| hypothetical membrane protein [Gardnerella vaginalis AMD]
 gi|296889233|gb|EFH27967.1| hypothetical membrane protein [Gardnerella vaginalis AMD]
          Length = 171

 Score = 54.9 bits (131), Expect = 3e-06,   Method: Composition-based stats.
 Identities = 18/129 (13%), Positives = 49/129 (37%), Gaps = 10/129 (7%)

Query: 1   MKQCIIFIINIVVVFFIDVMGFFILMKCGADPFYSRIFSIAVAFLVTWIPSRLFIFLKL- 59
           ++Q + F I  ++   IDV    +LM    +   +   S  ++ +  +I S  ++F    
Sbjct: 8   IEQVVKFGIVGIIALIIDVALLNLLMLAHLNNVVAGTISFVISLIFNYIASMKYVFKHRE 67

Query: 60  RRKSFLETVRYGVMYFMLSILNYAFYVKLLLTFQ---------GLQPLLATVLSAVSSML 110
               ++E + + +   +  ++N        L             L+  +  +++ V   +
Sbjct: 68  DMAKWMELLIFVISAVIGLLINDLIIWASTLGMAETLRGSAVYVLRTNIGKLVATVVVAV 127

Query: 111 FVFLLYIRF 119
           + F++    
Sbjct: 128 WNFVIRKWL 136


>gi|289668413|ref|ZP_06489488.1| hypothetical protein XcampmN_07920 [Xanthomonas campestris pv.
           musacearum NCPPB4381]
          Length = 132

 Score = 54.9 bits (131), Expect = 3e-06,   Method: Composition-based stats.
 Identities = 12/127 (9%), Positives = 44/127 (34%), Gaps = 7/127 (5%)

Query: 2   KQCIIFIINIVVVFFIDVMGFFILMKCGADPFYSRIFSIAVAFLVTWIPSRLFIFLKLRR 61
           ++   F++   +   ++     +L +       + I +  +  L  ++ +RLF+F +   
Sbjct: 4   QKFFKFLVAGGLAALVNFGSRILLNEF-MPYAQAIIIAYCIGMLTAFLLNRLFVFKESSN 62

Query: 62  KSFLETVRYGVMYFMLSILNYAFYVKLL------LTFQGLQPLLATVLSAVSSMLFVFLL 115
               +   + ++    ++      +         +        +A  +  ++ +   +L 
Sbjct: 63  HIHQQAAWFILINVAAALQTLLISLLFAKIIFPKMQMNFYPQAVAHAIGVIAPVAISYLG 122

Query: 116 YIRFMTR 122
           +  F  R
Sbjct: 123 HKHFTFR 129


>gi|54294292|ref|YP_126707.1| hypothetical protein lpl1357 [Legionella pneumophila str. Lens]
 gi|53754124|emb|CAH15597.1| hypothetical protein lpl1357 [Legionella pneumophila str. Lens]
          Length = 388

 Score = 54.9 bits (131), Expect = 3e-06,   Method: Composition-based stats.
 Identities = 13/128 (10%), Positives = 37/128 (28%), Gaps = 7/128 (5%)

Query: 1   MKQCIIFIINIVVVFFIDVMGFFILMKCGADPFYSRIFSIAVAFLVTWIPSRLFIFLKL- 59
           ++Q +       +   I    +  L         S   +I+ A +  +I      F +  
Sbjct: 243 LRQYLTMCCVGSIGALIQFSLYNWLRSSNHSALVSSQVAISAAIISNFIFHHSITFKQKT 302

Query: 60  ----RRKSFLETVRYGVMYFMLSILNYAFYVKLLLTF--QGLQPLLATVLSAVSSMLFVF 113
                + +F    ++ +    +      +    + +F    L+  +          +  +
Sbjct: 303 DFRITKTTFSRFTQFIIYSTFMVYFQSLWVHIFVHSFGQGVLKENIIVASGLGIGSIINY 362

Query: 114 LLYIRFMT 121
           L Y   + 
Sbjct: 363 LFYSNIIW 370


>gi|327490598|gb|EGF22379.1| dolichyl-phosphate beta-D-mannosyltransferase [Streptococcus
           sanguinis SK1058]
          Length = 349

 Score = 54.9 bits (131), Expect = 3e-06,   Method: Composition-based stats.
 Identities = 16/127 (12%), Positives = 45/127 (35%), Gaps = 8/127 (6%)

Query: 2   KQCIIFIINIVVVFFIDVMGFFILMKCGAD------PFYSRIFSIAVAFLVTWIPSRLFI 55
           K    F +  +  F +D + + + +   A          +   +   + +  +  ++  +
Sbjct: 218 KNIFKFALTSLSSFVVDYIVYALALLFLAAVPTSLRILLTNGIARVTSSIFNYSTNKRLV 277

Query: 56  FLKLRRKSFLETVRYGVMYFMLSILNYAFYVKLLLTFQGLQPLLATVLSAVSSMLFVFLL 115
           F             Y  +  +L IL+    ++L     GL  L+  ++  +      +++
Sbjct: 278 FKNDD-SILKTGTGYFSLAVVLFILD-TLLIRLFYAVFGLNLLIVKIIVGILLFTVSWMV 335

Query: 116 YIRFMTR 122
             RF+ +
Sbjct: 336 QKRFIFK 342


>gi|190575940|ref|YP_001973785.1| putative transmembrane protein [Stenotrophomonas maltophilia K279a]
 gi|190013862|emb|CAQ47500.1| putative transmembrane protein [Stenotrophomonas maltophilia K279a]
          Length = 137

 Score = 54.9 bits (131), Expect = 3e-06,   Method: Composition-based stats.
 Identities = 17/124 (13%), Positives = 42/124 (33%), Gaps = 2/124 (1%)

Query: 1   MKQCIIFIINIVVVFFIDVMGFFILMKCGADPFYSRIFSIAVAFLVTWIPSRLFIFLKLR 60
           ++Q   ++   +V   +D + F +    G     + I       L+ +  +  + F +  
Sbjct: 14  VRQGSAYLFIGLVQLLLDWLVFVVTTALGMPVAPANIAGRLAGMLLGFWLNGRYTFAEAG 73

Query: 61  RK--SFLETVRYGVMYFMLSILNYAFYVKLLLTFQGLQPLLATVLSAVSSMLFVFLLYIR 118
            +   +    R+  ++ +L++ +      +          LA  L         FLL   
Sbjct: 74  TRKLGWKRFARFFGLWLLLTVASTLLVSLVDHALGLQYTWLAKPLVEGGLACVSFLLMRY 133

Query: 119 FMTR 122
            + R
Sbjct: 134 VVYR 137


>gi|166713464|ref|ZP_02244671.1| GtrA family protein [Xanthomonas oryzae pv. oryzicola BLS256]
          Length = 134

 Score = 54.9 bits (131), Expect = 3e-06,   Method: Composition-based stats.
 Identities = 18/127 (14%), Positives = 47/127 (37%), Gaps = 7/127 (5%)

Query: 2   KQCIIFIINIVVVFFIDVMGFFILMKCGADPFYSRIFSIAVAFLVTWIPSRLFIFLKLRR 61
           +Q I+F+    +   ++      L     D   S I +  +  +  ++ ++LF+F + R 
Sbjct: 8   RQFILFLFAGGLAAAVNFGSRIALSHW-MDYVPSIIIAYLLGMMSAFMLNKLFVFSEARN 66

Query: 62  KSFLETVRYGVMYFMLSILNYAFYVKLLLTFQGL------QPLLATVLSAVSSMLFVFLL 115
           +   + + + ++  +         + L                +A  +  V  ++  +L 
Sbjct: 67  RLHNQVMWFILINLVAVAQTIVISLLLARWLLPAIGVDFHNETIAHSIGIVVPVITSYLG 126

Query: 116 YIRFMTR 122
           + RF  R
Sbjct: 127 HKRFSFR 133


>gi|227546263|ref|ZP_03976312.1| membrane protein [Bifidobacterium longum subsp. infantis ATCC
           55813]
 gi|227213244|gb|EEI81116.1| membrane protein [Bifidobacterium longum subsp. infantis ATCC
           55813]
          Length = 161

 Score = 54.9 bits (131), Expect = 3e-06,   Method: Composition-based stats.
 Identities = 15/122 (12%), Positives = 38/122 (31%), Gaps = 8/122 (6%)

Query: 4   CIIFIINIVVVFFIDVMGFFILMKCGADPFYSRIFSIAVAFLVTWIPSRLFIFLKLRRKS 63
              ++        ++   F IL   G     +   ++  +    ++ +R   F       
Sbjct: 45  LGKYVGVSATQTIVEYATFAILHLIGVPSQIANGIAVVCSATYNFVMNRNVTFKSSSN-- 102

Query: 64  FLETVRYGVMYFMLSILNY---AFYVKLLLTFQGLQPLLATVLSAVSSMLFVFLLYIRFM 120
                R   ++ +L I N+      +  +    GL P +   ++      + + L    +
Sbjct: 103 ---FTRSVALFVLLWIWNFTFSTLLIGWMPGATGLSPYVVKFIAMACQFGWGYPLCKYVI 159

Query: 121 TR 122
            R
Sbjct: 160 FR 161


>gi|256845365|ref|ZP_05550823.1| glycosyltransferase [Fusobacterium sp. 3_1_36A2]
 gi|256718924|gb|EEU32479.1| glycosyltransferase [Fusobacterium sp. 3_1_36A2]
          Length = 360

 Score = 54.9 bits (131), Expect = 3e-06,   Method: Composition-based stats.
 Identities = 17/129 (13%), Positives = 49/129 (37%), Gaps = 11/129 (8%)

Query: 4   CIIFIINIVVVFFIDVM----GFFILMKCGADP-----FYSRIFSIAVAFLVTWIPSRLF 54
            + +I + +  F +D++       IL+  G          S I +  ++    +  ++ F
Sbjct: 233 FLKYIASAISSFILDILSFKWILIILIAFGNIERAAVITISTIVARVISSTFNFYLNKKF 292

Query: 55  IFLKLRRKSFLETVRYGVMYFMLSILNYAFYVKLLLTFQGLQPLLATVLSAVSSMLFVFL 114
           +F    + +    ++Y  +  +  +L+ A  V ++            ++      L  + 
Sbjct: 293 VFKYE-KNTKKSLLKYYSLCVVQMLLS-AVLVTVVWKHTKYPETRIKIVVDTILFLLSYF 350

Query: 115 LYIRFMTRR 123
           +  R++ +R
Sbjct: 351 VQQRWVFKR 359


>gi|91976043|ref|YP_568702.1| GtrA-like protein [Rhodopseudomonas palustris BisB5]
 gi|91682499|gb|ABE38801.1| GtrA-like protein [Rhodopseudomonas palustris BisB5]
          Length = 148

 Score = 54.9 bits (131), Expect = 3e-06,   Method: Composition-based stats.
 Identities = 21/124 (16%), Positives = 43/124 (34%), Gaps = 6/124 (4%)

Query: 3   QCIIFIINIVVVFFIDVMGFFILMK-CGADPFYSRIFSIAVAFLVTWIPSRLFIFLKLRR 61
           + + F    VV  FID+  F +  K        + + +  VA   +++ + +  F     
Sbjct: 20  KMVAFASIGVVNTFIDLGVFALAYKVFELPIVLANVLAWLVAASCSYVMNTMITFRVESG 79

Query: 62  KSFLE--TVRYGVMYFMLSILNYAFYVKLLLTFQGLQPLLATVLSAVSSMLFVFLLYIRF 119
           +       + +     +  I N    V L           A +++ V S +  F +    
Sbjct: 80  RVLKTKDYLSFVASGLLGLIANTTTLVVLSAYVP---VFTAKLVAIVVSFVVNFSMSHLV 136

Query: 120 MTRR 123
           + RR
Sbjct: 137 VFRR 140


>gi|328542079|ref|YP_004302188.1| GtrA-like protein [polymorphum gilvum SL003B-26A1]
 gi|326411829|gb|ADZ68892.1| GtrA-like protein [Polymorphum gilvum SL003B-26A1]
          Length = 145

 Score = 54.9 bits (131), Expect = 3e-06,   Method: Composition-based stats.
 Identities = 16/117 (13%), Positives = 38/117 (32%), Gaps = 3/117 (2%)

Query: 6   IFIINIVVVFFIDVMGFFILMKCGA-DPFYSRIFSIAVAFLVTWIPSRLFIFLKLRRKSF 64
            F++  ++           L+  G    F + + +  VAFLV++    ++ F      + 
Sbjct: 21  RFVVVGLIATATHAGVALALLWLGVLPAFPANVIAFLVAFLVSFTGHHVWSFPGTG-DAA 79

Query: 65  LETVRYGVMYFMLSILNYAFYVKLLLTFQGLQPLLATVLSAVSSMLFVFLLYIRFMT 121
               R+ ++     ++N       L         L  +++        FL    +  
Sbjct: 80  RRMRRFFLLALAGFLVNSGALAAWLEWTP-WPDSLGILVAIAVVPAVTFLGARLWAF 135


>gi|294785338|ref|ZP_06750626.1| dolichyl-phosphate beta-D-mannosyltransferase [Fusobacterium sp.
           3_1_27]
 gi|294487052|gb|EFG34414.1| dolichyl-phosphate beta-D-mannosyltransferase [Fusobacterium sp.
           3_1_27]
          Length = 360

 Score = 54.9 bits (131), Expect = 3e-06,   Method: Composition-based stats.
 Identities = 17/129 (13%), Positives = 49/129 (37%), Gaps = 11/129 (8%)

Query: 4   CIIFIINIVVVFFIDVM----GFFILMKCGADP-----FYSRIFSIAVAFLVTWIPSRLF 54
            + +I + +  F +D++       IL+  G          S I +  ++    +  ++ F
Sbjct: 233 FLKYIASAISSFILDILSFKWILIILIAFGNIERAAVITISTIVARVISSTFNFYLNKKF 292

Query: 55  IFLKLRRKSFLETVRYGVMYFMLSILNYAFYVKLLLTFQGLQPLLATVLSAVSSMLFVFL 114
           +F    + +    ++Y  +  +  +L+ A  V ++            ++      L  + 
Sbjct: 293 VFKYE-KNTKKSLLKYYSLCVVQMLLS-AVLVTVVWKHTKYPETRIKIVVDTILFLLSYF 350

Query: 115 LYIRFMTRR 123
           +  R++ +R
Sbjct: 351 VQQRWVFKR 359


>gi|294624651|ref|ZP_06703322.1| conserved hypothetical protein [Xanthomonas fuscans subsp.
           aurantifolii str. ICPB 11122]
 gi|294667258|ref|ZP_06732478.1| conserved hypothetical protein [Xanthomonas fuscans subsp.
           aurantifolii str. ICPB 10535]
 gi|292601045|gb|EFF45111.1| conserved hypothetical protein [Xanthomonas fuscans subsp.
           aurantifolii str. ICPB 11122]
 gi|292602930|gb|EFF46361.1| conserved hypothetical protein [Xanthomonas fuscans subsp.
           aurantifolii str. ICPB 10535]
          Length = 137

 Score = 54.9 bits (131), Expect = 3e-06,   Method: Composition-based stats.
 Identities = 18/123 (14%), Positives = 40/123 (32%), Gaps = 2/123 (1%)

Query: 2   KQCIIFIINIVVVFFIDVMGFFILMKCGADPFYSRIFSIAVAFLVTWIPSRLFIFLKLRR 61
           +Q   F+I   +   +D   F      G     + +       ++ +  +  + F +   
Sbjct: 15  RQGSQFMIIGALQLAVDCGIFIAATAAGMPAVPANLLGRIGGAMLGFWLNGRYTFAQQGD 74

Query: 62  KS--FLETVRYGVMYFMLSILNYAFYVKLLLTFQGLQPLLATVLSAVSSMLFVFLLYIRF 119
               +    R+ VM+  L++++       +      Q  LA  L      +  F L    
Sbjct: 75  ARLGWRRFRRFAVMWLTLTLISTWLLSTTVDLLGLRQAWLAKPLVEGGLAIVSFFLGRHV 134

Query: 120 MTR 122
           + R
Sbjct: 135 VYR 137


>gi|54297316|ref|YP_123685.1| hypothetical protein lpp1361 [Legionella pneumophila str. Paris]
 gi|53751101|emb|CAH12512.1| hypothetical protein lpp1361 [Legionella pneumophila str. Paris]
          Length = 388

 Score = 54.9 bits (131), Expect = 4e-06,   Method: Composition-based stats.
 Identities = 13/128 (10%), Positives = 36/128 (28%), Gaps = 7/128 (5%)

Query: 1   MKQCIIFIINIVVVFFIDVMGFFILMKCGADPFYSRIFSIAVAFLVTWIPSRLFIFLKL- 59
           ++Q +       +   I    +  L         S   +I  A +  +I      F +  
Sbjct: 243 LRQYLTMCCVGSIGALIQFSLYNWLRSSNHSALVSSQVAITAAIISNFIFHHSITFKQKT 302

Query: 60  ----RRKSFLETVRYGVMYFMLSILNYAFYVKLLLTF--QGLQPLLATVLSAVSSMLFVF 113
                + +F    ++ +    +      +    + +F    L+  +          +  +
Sbjct: 303 DFRVTKTTFSRFTQFIIYSTFMVYFQSLWVHIFVHSFGQGVLKENIIVASGLGIGSIINY 362

Query: 114 LLYIRFMT 121
           L Y   + 
Sbjct: 363 LFYSNIIW 370


>gi|256851233|ref|ZP_05556622.1| conserved hypothetical protein [Lactobacillus jensenii 27-2-CHN]
 gi|260660657|ref|ZP_05861572.1| conserved hypothetical protein [Lactobacillus jensenii 115-3-CHN]
 gi|282934700|ref|ZP_06339943.1| putative dolichyl-phosphate beta-D-mannosyltransferase
           [Lactobacillus jensenii 208-1]
 gi|297206100|ref|ZP_06923495.1| conserved hypothetical protein [Lactobacillus jensenii JV-V16]
 gi|256616295|gb|EEU21483.1| conserved hypothetical protein [Lactobacillus jensenii 27-2-CHN]
 gi|260548379|gb|EEX24354.1| conserved hypothetical protein [Lactobacillus jensenii 115-3-CHN]
 gi|281301275|gb|EFA93576.1| putative dolichyl-phosphate beta-D-mannosyltransferase
           [Lactobacillus jensenii 208-1]
 gi|297149226|gb|EFH29524.1| conserved hypothetical protein [Lactobacillus jensenii JV-V16]
          Length = 138

 Score = 54.9 bits (131), Expect = 4e-06,   Method: Composition-based stats.
 Identities = 18/123 (14%), Positives = 49/123 (39%), Gaps = 3/123 (2%)

Query: 2   KQCIIFIINIVVVFFIDVMGFFILMKCGADPF-YSRIFSIAVAFLVTWIPSRLFIFLKLR 60
           ++ +I+    V   FID   F++L K  + P   +   S + A +  +  +    F    
Sbjct: 15  REFVIYGFIGVFGLFIDFGLFWLLTKFTSLPVEIANFISSSCALVNNFYMNTYLNFHVRD 74

Query: 61  RKSFLETVRYGVMYFMLSILNYAFYVKLLLTFQGLQPLLATVLSAVSSMLFVFLLYIRFM 120
                  ++Y ++  + +++       + +T      ++  V+S   + +  F++   F 
Sbjct: 75  H-LLSRFIKYYIIGQITTLITTTCL-FIFVTLMHQNEMIVKVISTFLATMLQFVVNKVFT 132

Query: 121 TRR 123
            ++
Sbjct: 133 FKK 135


>gi|254303063|ref|ZP_04970421.1| dolichyl-phosphate beta-D-mannosyltransferase [Fusobacterium
           nucleatum subsp. polymorphum ATCC 10953]
 gi|148323255|gb|EDK88505.1| dolichyl-phosphate beta-D-mannosyltransferase [Fusobacterium
           nucleatum subsp. polymorphum ATCC 10953]
          Length = 360

 Score = 54.9 bits (131), Expect = 4e-06,   Method: Composition-based stats.
 Identities = 17/129 (13%), Positives = 49/129 (37%), Gaps = 11/129 (8%)

Query: 4   CIIFIINIVVVFFIDVM----GFFILMKCGADP-----FYSRIFSIAVAFLVTWIPSRLF 54
            + +I +    F +D++       IL+  G          S I +  ++    +  ++ F
Sbjct: 233 FLKYIASATSSFILDILSFKWILAILIAFGNIEGATVITVSTIIARIISSSFNFYLNKKF 292

Query: 55  IFLKLRRKSFLETVRYGVMYFMLSILNYAFYVKLLLTFQGLQPLLATVLSAVSSMLFVFL 114
           +F   +  +    ++Y  +  +  +L+ A  V ++  +         ++      L  + 
Sbjct: 293 VFKYEQN-TKKSLLKYYSLCIVQMLLS-AVLVSIVWKYTKYTETGIKIVVDSVLFLLSYF 350

Query: 115 LYIRFMTRR 123
           +  R++ +R
Sbjct: 351 VQQRWVFKR 359


>gi|26986780|ref|NP_742205.1| GtrA family protein [Pseudomonas putida KT2440]
 gi|148545306|ref|YP_001265408.1| GtrA family protein [Pseudomonas putida F1]
 gi|167031070|ref|YP_001666301.1| GtrA family protein [Pseudomonas putida GB-1]
 gi|170719239|ref|YP_001746927.1| GtrA family protein [Pseudomonas putida W619]
 gi|24981373|gb|AAN65669.1|AE016193_10 GtrA family protein [Pseudomonas putida KT2440]
 gi|148509364|gb|ABQ76224.1| GtrA family protein [Pseudomonas putida F1]
 gi|166857558|gb|ABY95965.1| GtrA family protein [Pseudomonas putida GB-1]
 gi|169757242|gb|ACA70558.1| GtrA family protein [Pseudomonas putida W619]
          Length = 139

 Score = 54.9 bits (131), Expect = 4e-06,   Method: Composition-based stats.
 Identities = 19/119 (15%), Positives = 43/119 (36%), Gaps = 4/119 (3%)

Query: 4   CIIFIINIVVVFFIDVMGFFILMKC-GADPFYSRIFSIAVAFLVTWIPSRLFIFLKLRRK 62
            I ++    +   +    F +L+      P  + I    V  + ++I +R   F+     
Sbjct: 12  LIRYLGIGFIATGVHYAVFLLLVTTEFVTPLLASICGGMVGAIASFIGNRALCFVADG-S 70

Query: 63  SFLETVRYGVMYFMLSILNYAFYVKLLLTFQGLQPLLATVLSAVSSMLFVFLLYIRFMT 121
              + VR+ ++    +  N        L    L PL++ V+  +S     F+ +  +  
Sbjct: 71  RKFQPVRFALVALTTNFGNGVGM--WFLIKSNLSPLISQVVVTLSLTALGFIAHRFWTF 127


>gi|255523354|ref|ZP_05390324.1| GtrA family protein [Clostridium carboxidivorans P7]
 gi|296188288|ref|ZP_06856680.1| GtrA-like protein [Clostridium carboxidivorans P7]
 gi|255513008|gb|EET89278.1| GtrA family protein [Clostridium carboxidivorans P7]
 gi|296047414|gb|EFG86856.1| GtrA-like protein [Clostridium carboxidivorans P7]
          Length = 139

 Score = 54.9 bits (131), Expect = 4e-06,   Method: Composition-based stats.
 Identities = 21/123 (17%), Positives = 51/123 (41%), Gaps = 4/123 (3%)

Query: 2   KQCIIFIINIVVVFFIDVMGFFILMKC-GADPFYSRIFSIAVAFLVTWIPSRLFIF--LK 58
           K    F +  +    ID + F I     G +   S++   +   + ++I ++ + F   K
Sbjct: 17  KSLSRFSLVGISNTLIDFIVFTIFQGLIGVNYTLSQVLGYSFGVVNSFIFNKKWTFQGGK 76

Query: 59  LRRKSFLETVRYGVMYFMLSILNYAFYVKLLLTFQGLQPLLATVLSAVSSMLFVFLLYIR 118
             +K + E  ++ ++  M   +    ++KLL+        +A V+    + +  F+ Y  
Sbjct: 77  SNKKIYHELFQFIIVNIMSLAITL-IFMKLLIKDFNFNVYVAKVVVTFIAQITNFIAYKL 135

Query: 119 FMT 121
           ++ 
Sbjct: 136 WVF 138


>gi|34763032|ref|ZP_00144007.1| Glycosyltransferase involved in cell wall biogenesis [Fusobacterium
           nucleatum subsp. vincentii ATCC 49256]
 gi|237742024|ref|ZP_04572505.1| glycosyltransferase [Fusobacterium sp. 4_1_13]
 gi|27887292|gb|EAA24388.1| Glycosyltransferase involved in cell wall biogenesis [Fusobacterium
           nucleatum subsp. vincentii ATCC 49256]
 gi|229429672|gb|EEO39884.1| glycosyltransferase [Fusobacterium sp. 4_1_13]
          Length = 360

 Score = 54.9 bits (131), Expect = 4e-06,   Method: Composition-based stats.
 Identities = 17/129 (13%), Positives = 49/129 (37%), Gaps = 11/129 (8%)

Query: 4   CIIFIINIVVVFFIDVM----GFFILMKCGADP-----FYSRIFSIAVAFLVTWIPSRLF 54
            + +I + +  F +D++       IL+  G          S I +  ++    +  ++ F
Sbjct: 233 FLKYIASAISSFILDILSFKWILIILIAFGNIERAAVITISTIVARVISSTFNFYLNKKF 292

Query: 55  IFLKLRRKSFLETVRYGVMYFMLSILNYAFYVKLLLTFQGLQPLLATVLSAVSSMLFVFL 114
           +F    + +    ++Y  +  +  +L+ A  V ++            ++      L  + 
Sbjct: 293 VFKYE-KNTKKSLLKYYSLCVVQMLLS-AVLVTVVWKHTKYPETRIKIVVDTILFLLSYF 350

Query: 115 LYIRFMTRR 123
           +  R++ +R
Sbjct: 351 VQQRWVFKR 359


>gi|229823179|ref|ZP_04449248.1| hypothetical protein GCWU000282_00476 [Catonella morbi ATCC 51271]
 gi|229787345|gb|EEP23459.1| hypothetical protein GCWU000282_00476 [Catonella morbi ATCC 51271]
          Length = 129

 Score = 54.9 bits (131), Expect = 4e-06,   Method: Composition-based stats.
 Identities = 20/120 (16%), Positives = 38/120 (31%), Gaps = 4/120 (3%)

Query: 3   QCIIFIINIVVVFFIDVMGFFILM-KCGADPFYSRIFSIAVAFLVTWIPSRLFIFLKL-- 59
           Q + F++   +   ID    + L    G     + I +  +A +  +  S  F F     
Sbjct: 8   QILSFLVVGGLSTLIDFAIVYGLNGILGWHYQLAVIIAFILATIFNYWASMRFTFESKFS 67

Query: 60  RRKSFLETVRYGVMYFMLSILNYAFYVKLLLTFQGLQPLLATVLSAVSSMLFVFLLYIRF 119
             +   E + + V+  +   L         +       + A V      M+F FL     
Sbjct: 68  PEQKHQEFLLFLVLSILGLALTAGLMWVA-VDAMHWPVMPAKVAVTAVVMVFNFLTRKLL 126


>gi|302525087|ref|ZP_07277429.1| predicted protein [Streptomyces sp. AA4]
 gi|302433982|gb|EFL05798.1| predicted protein [Streptomyces sp. AA4]
          Length = 412

 Score = 54.9 bits (131), Expect = 4e-06,   Method: Composition-based stats.
 Identities = 14/124 (11%), Positives = 40/124 (32%), Gaps = 6/124 (4%)

Query: 7   FIINIVVVFFIDVMGFFILMKCGADPFYSRIFSIAVAFLVTWIPSRLFIFLKL----RRK 62
           ++   VV   +     F+  +      ++ + ++A+  +      R   F        ++
Sbjct: 282 YLAAGVVTTGLQ-AVLFLAFRPEIGAQWANLAALAITTVGNTEFHRRVTFADRSGRAGKR 340

Query: 63  SFLETVRYGVMYFMLSILNYAFYVKLLLTFQGLQPLLATVLSAVSSMLFVFLLYIRFMTR 122
              + V +       S++  A    +     G Q   A + ++    +  F +   ++  
Sbjct: 341 HLQDLVTFAFYAGYGSVVLAALDALVETPSAG-QQTAALLAASFVGGVVRFAVLRWWVFA 399

Query: 123 RVYF 126
           R   
Sbjct: 400 RTRR 403


>gi|62262524|gb|AAX78077.1| unknown protein [synthetic construct]
          Length = 160

 Score = 54.9 bits (131), Expect = 4e-06,   Method: Composition-based stats.
 Identities = 24/126 (19%), Positives = 53/126 (42%), Gaps = 2/126 (1%)

Query: 2   KQCIIFIINIVVVFFIDVMGFFILMKCG-ADPFYSRIFSIAVAFLVTWIPSRLFIFLKLR 60
           KQ  +FII  ++    + +  +IL++     P  +  F+  +AF V++   R   F    
Sbjct: 30  KQLSLFIIVGILASITNFIIVWILVELNIFRPLVANFFAFLIAFNVSYFGHRFLTFSTTT 89

Query: 61  RKSFLETVRYGVMYFMLSILNYAFYVKLLLTFQGLQPLLATVLSAVSSMLFVFLLYIRFM 120
           +       ++ +   +   LN + Y   LL    +Q LLA  ++     ++ F++    +
Sbjct: 90  QSHKKAATQFFINVMIGLGLNESIYYV-LLHILKIQYLLALFITMGLVAVYTFVVSKFLI 148

Query: 121 TRRVYF 126
            +   +
Sbjct: 149 FKAYPY 154


>gi|326314900|ref|YP_004232572.1| GtrA family protein [Acidovorax avenae subsp. avenae ATCC 19860]
 gi|323371736|gb|ADX44005.1| GtrA family protein [Acidovorax avenae subsp. avenae ATCC 19860]
          Length = 143

 Score = 54.9 bits (131), Expect = 4e-06,   Method: Composition-based stats.
 Identities = 16/126 (12%), Positives = 42/126 (33%), Gaps = 7/126 (5%)

Query: 2   KQCIIFIINIVVVFFIDVMGFFILMKCGADPFYSRIFSIAVAFLVTWIPSRLFIFLKLRR 61
           +Q + F++   V    +                + I +  V     ++ +R F+F    +
Sbjct: 8   RQFLAFLVTGGVAALANFGSRIAFSHW-MPFSAAVIAAYCVGMCTAFLLARAFVFKASTQ 66

Query: 62  KSFLETVRYGVMYFMLSILNYAFYVKLLLTFQ------GLQPLLATVLSAVSSMLFVFLL 115
            +    + + ++  +     +A  + LL             P +A  +  V  +   +L 
Sbjct: 67  STHKSAMFFVLVNLLAVAQTWAVSMALLKWVLPALGITAFAPEIAHAVGVVVPVFTSYLG 126

Query: 116 YIRFMT 121
           + R+  
Sbjct: 127 HKRWSF 132


>gi|224438529|ref|ZP_03659449.1| teichoic acid glycosylation protein (putative) [Helicobacter
           cinaedi CCUG 18818]
          Length = 216

 Score = 54.9 bits (131), Expect = 4e-06,   Method: Composition-based stats.
 Identities = 20/124 (16%), Positives = 45/124 (36%), Gaps = 2/124 (1%)

Query: 1   MKQCIIF-IINIVVVFFIDVMGFFILMKCGADPFYSRIFSIAVAFLVTWIPSRLFIFLKL 59
           +KQ I+F  I   +     +  + +    G     + +    +A  +     R F+F   
Sbjct: 66  LKQLIVFFCIGGGITLLELLGFYILYKIFGVHYILASLIMFVLASGIGVWLYRRFVFGGT 125

Query: 60  RRKSFLETVRYGVMYFMLSILNYAFYVKLLLTFQGLQPLLATVLSAVSSMLFVFLLYIRF 119
                LE     ++  +   LN        + F G + ++A +L+++    + F      
Sbjct: 126 HLHRGLEVGLTYLINTIGIGLNTLILWLC-VEFLGFEAIVAKILASLLVAFYGFYARKLV 184

Query: 120 MTRR 123
           + R+
Sbjct: 185 IYRK 188


>gi|298244993|ref|ZP_06968799.1| GtrA family protein [Ktedonobacter racemifer DSM 44963]
 gi|297552474|gb|EFH86339.1| GtrA family protein [Ktedonobacter racemifer DSM 44963]
          Length = 171

 Score = 54.9 bits (131), Expect = 4e-06,   Method: Composition-based stats.
 Identities = 18/132 (13%), Positives = 49/132 (37%), Gaps = 11/132 (8%)

Query: 2   KQCIIFIINIVVVFFIDVMGFFILMKCG--------ADPFYSRIFSIAVAFLVTWIPSRL 53
           K+ + F +  ++   I+++     +                +++ S  V  ++ ++ ++L
Sbjct: 10  KRFVKFALIGLIGIPINLVALKFFLTVFALIGLRDNWLNVVAQVCSFEVGTIINFVLNQL 69

Query: 54  FIFLKLRRKSFLETVRYGV---MYFMLSILNYAFYVKLLLTFQGLQPLLATVLSAVSSML 110
             +      +F   V   +   +  M + L              + P +A  L  + + +
Sbjct: 70  ITYRDQMPTTFNAWVVKSIKAQVANMSAFLVATLISLFFSVVVHIDPYVANTLGIIINFV 129

Query: 111 FVFLLYIRFMTR 122
           + FL+  RF+ R
Sbjct: 130 YKFLVSDRFVFR 141


>gi|325977555|ref|YP_004287271.1| dolichyl-phosphate mannose synthase [Streptococcus gallolyticus
           subsp. gallolyticus ATCC BAA-2069]
 gi|325177483|emb|CBZ47527.1| dolichyl-phosphate mannose synthase [Streptococcus gallolyticus
           subsp. gallolyticus ATCC BAA-2069]
          Length = 294

 Score = 54.9 bits (131), Expect = 4e-06,   Method: Composition-based stats.
 Identities = 16/123 (13%), Positives = 44/123 (35%), Gaps = 8/123 (6%)

Query: 4   CIIFIINIVVVFFIDVMGFFILMKCGAD-----PFYSRIFSIAVAFLVTWIPSRLFIFLK 58
              +I + +  F +D++ F IL+             + I + A++ +V +  +   +F +
Sbjct: 167 FFKYIFSSLFSFLVDIVAFTILISLFNGLSFSAVTLASILARAISSVVNFTLNHKVVFKQ 226

Query: 59  LRRKSFLETVRYGVMYFMLSILNYAFYVKLLLTFQGLQPLLATVLSAVSSMLFVFLLYIR 118
            +  S    ++Y  +  +   L+      L      L   +  +L   +     + +   
Sbjct: 227 GQSNSA---IKYFTLVVVQIALSSLLVTVLGNALTMLPISVVKILVDGTLFFVSYFVQKH 283

Query: 119 FMT 121
            + 
Sbjct: 284 LIF 286


>gi|258645628|ref|ZP_05733097.1| conserved hypothetical protein [Dialister invisus DSM 15470]
 gi|260402989|gb|EEW96536.1| conserved hypothetical protein [Dialister invisus DSM 15470]
          Length = 143

 Score = 54.9 bits (131), Expect = 4e-06,   Method: Composition-based stats.
 Identities = 17/123 (13%), Positives = 49/123 (39%), Gaps = 3/123 (2%)

Query: 3   QCIIFIINIVVVFFIDVMGFFILMKC-GADPFYSRIFSIAVAFLVTWIPSRLFIFLKLRR 61
           + + F+I     F ++ +  ++L +  G     S   +  ++ LV ++     +F    +
Sbjct: 23  EILRFLIVGGGCFLLEYVLLYMLTEFAGIPYLTSSAIAFLISLLVNYLLCVTVVF-HTGK 81

Query: 62  KSFLETVRYGVMYFMLSILNYAFYVKLLLTFQGLQPLLATVLSAVSSMLFVFLLYIRFMT 121
           ++ +E   +         +N    +   +   GL  + A V+++   M++ +      + 
Sbjct: 82  RTKMEMFLFFATSAAGLGINQ-MTMWFFVEIAGLWYMFAKVIASGIVMIWNYATKRYILK 140

Query: 122 RRV 124
            +V
Sbjct: 141 GKV 143


>gi|21244320|ref|NP_643902.1| hypothetical protein XAC3595 [Xanthomonas axonopodis pv. citri str.
           306]
 gi|21109972|gb|AAM38438.1| hypothetical protein XAC3595 [Xanthomonas axonopodis pv. citri str.
           306]
          Length = 132

 Score = 54.9 bits (131), Expect = 4e-06,   Method: Composition-based stats.
 Identities = 12/127 (9%), Positives = 43/127 (33%), Gaps = 7/127 (5%)

Query: 2   KQCIIFIINIVVVFFIDVMGFFILMKCGADPFYSRIFSIAVAFLVTWIPSRLFIFLKLRR 61
           ++   F++   +   ++     +L         + I +  +  L  ++ +RLF+F +   
Sbjct: 4   QKFFKFLVAGGLAALVNFGSRILLNNF-MPYAQAIIIAYCIGMLTAFLLNRLFVFKESSN 62

Query: 62  KSFLETVRYGVMYFMLSILNYAFYVKLL------LTFQGLQPLLATVLSAVSSMLFVFLL 115
               +   + ++    ++      +         +        +A  +  ++ +   +L 
Sbjct: 63  HIHQQAAWFILINVAAALQTLLISLLFAKIIFPKMQMNFYPQAVAHAIGVIAPVAISYLG 122

Query: 116 YIRFMTR 122
           +  F  R
Sbjct: 123 HKHFTFR 129


>gi|325067445|ref|ZP_08126118.1| GtrA family membrane protein [Actinomyces oris K20]
          Length = 187

 Score = 54.5 bits (130), Expect = 4e-06,   Method: Composition-based stats.
 Identities = 18/123 (14%), Positives = 47/123 (38%), Gaps = 3/123 (2%)

Query: 4   CIIFIINIVVVFFIDVMGFFILM-KCGADPFYSRIFSIAVAFLVTWIPSRLFIFLKLRRK 62
            I + I     F +D+   ++           +     A+A + +++ +R   F      
Sbjct: 60  FIGYAIINGSAFLLDITCLWVFYNHLHWFYPVAVTVGYAIAAVYSFLLNRWLNFQAHGH- 118

Query: 63  SFLETVRYGVMYFMLSILNYAFYVKLLLTFQGLQPLLATVLSAVSSMLFVFLLYIRFMTR 122
             ++     +   +   + +   +  LL + G+   LA V+SA    +++++    ++ R
Sbjct: 119 -VVQQGAGYMAGVVSQYVIFILGLSSLLHWFGVNAELARVISACCEGIYLYVFIRLWVFR 177

Query: 123 RVY 125
            V 
Sbjct: 178 GVP 180


>gi|332141691|ref|YP_004427429.1| hypothetical protein MADE_1011475 [Alteromonas macleodii str. 'Deep
           ecotype']
 gi|327551713|gb|AEA98431.1| hypothetical protein MADE_1011475 [Alteromonas macleodii str. 'Deep
           ecotype']
          Length = 141

 Score = 54.5 bits (130), Expect = 4e-06,   Method: Composition-based stats.
 Identities = 19/126 (15%), Positives = 45/126 (35%), Gaps = 2/126 (1%)

Query: 3   QCIIFIINIVVVFFIDVMGFFILMKCGADP-FYSRIFSIAVAFLVTWIPSRLFIFLKLRR 61
           Q   F++   +   +    +F ++       F +      VA + ++   + F F     
Sbjct: 9   QLARFLLVGGIATAVHSSVYFCIVAINESWPFIANFAGYFVAVIFSFFGQKHFTFKNREA 68

Query: 62  KSFLETVRYGVMYFMLSILNYAFYVKLLLTFQGLQPLLATVLSAVSSMLFVFLLYIRFMT 121
                  ++     +   LN + +V  +++   L P  A +  AV +    F+L   ++ 
Sbjct: 69  AMKQTVSKFLFSSMLGLGLN-SIWVFFVVSLLNLHPYYALIGIAVVTPAISFVLLKYWVF 127

Query: 122 RRVYFI 127
           +    I
Sbjct: 128 KEKKLI 133


>gi|62389994|ref|YP_225396.1| hypothetical protein cg1254 [Corynebacterium glutamicum ATCC 13032]
 gi|21323871|dbj|BAB98497.1| Hypothetical membrane protein [Corynebacterium glutamicum ATCC
           13032]
 gi|41325330|emb|CAF19810.1| putative membrane protein [Corynebacterium glutamicum ATCC 13032]
          Length = 207

 Score = 54.5 bits (130), Expect = 4e-06,   Method: Composition-based stats.
 Identities = 17/162 (10%), Positives = 40/162 (24%), Gaps = 38/162 (23%)

Query: 2   KQCIIFIINIVVVFFIDVMGFFILMKCGA----------------------DPFYSRIFS 39
           +Q I F I       +++    +  K                                 +
Sbjct: 36  RQFIKFGIVGGSGTLVNLAVAALSKKIAGWTAGIHESDAFMNLLGSAFHIRWYHVFMTIA 95

Query: 40  IAVAFLVTWIPSRLFIFLKLR-RKSFLETVRYGVMYFMLSILNYAFYVKLLLTFQGLQ-- 96
             VA    +  +R++ F        +     +     +  I +      L+     +   
Sbjct: 96  FLVANTWNYQLNRMWTFKTATIVSWWRGFFPFLATGLVAFIASQVVATLLMNETSPIALS 155

Query: 97  -------------PLLATVLSAVSSMLFVFLLYIRFMTRRVY 125
                           A V+S + SM   F++   +  ++  
Sbjct: 156 SEIFDDSTGFRTKFYWALVISILVSMPVNFIVNKYWTFKKPK 197


>gi|305676450|ref|YP_003868122.1| putative integral inner membrane protein [Bacillus subtilis subsp.
           spizizenii str. W23]
 gi|305414694|gb|ADM39813.1| putative integral inner membrane protein [Bacillus subtilis subsp.
           spizizenii str. W23]
          Length = 129

 Score = 54.5 bits (130), Expect = 4e-06,   Method: Composition-based stats.
 Identities = 17/126 (13%), Positives = 51/126 (40%), Gaps = 5/126 (3%)

Query: 4   CIIFIINIVVVFFIDVMGFFILMKCG-ADPFYSRIFSIAVAFLVTWIPSRLFIFLKLRR- 61
            I++II  V    +++  F+IL++    D   + + +  ++ L  +I ++L++F +    
Sbjct: 1   MIMYIIMGVFTTIVNIASFYILVEIMNMDYKAATVAAWILSVLFAYITNKLYVFQQKTHD 60

Query: 62  --KSFLETVRYGVMYFMLSILNYAFYVKLLLTFQGLQPLLATVLSAVSSMLFVFLLYIRF 119
                 E   +  +  +   ++    + +L+        LA +L     ++  +      
Sbjct: 61  LQSLIKEITAFFSVRVLSLGIDLG-MMIILVGQFNTNETLAKILDNAVIVVVNYAASKWL 119

Query: 120 MTRRVY 125
           + ++  
Sbjct: 120 VFKKTK 125


>gi|306834915|ref|ZP_07467972.1| membrane protein [Corynebacterium accolens ATCC 49726]
 gi|304569214|gb|EFM44722.1| membrane protein [Corynebacterium accolens ATCC 49726]
          Length = 146

 Score = 54.5 bits (130), Expect = 4e-06,   Method: Composition-based stats.
 Identities = 17/125 (13%), Positives = 39/125 (31%), Gaps = 4/125 (3%)

Query: 2   KQCIIFIINIVVVFFIDVMGFFILMKCGADPFYSRIFSIAVAFLVTWIPSRLFIFLKLRR 61
           +Q + FI   V    ID     +L   G     ++        +  ++ +  + F     
Sbjct: 20  QQLVRFIAVGVFAAVIDYGLTLLLTHLGLHRSGAKAIGWVFGTIAAYLANARWTFGTKVS 79

Query: 62  KSFLETVRYGVMYFMLSILNYAFYVKLLLTFQGLQ----PLLATVLSAVSSMLFVFLLYI 117
                TV    +          + +   L   G +      +A V++   + +  F +  
Sbjct: 80  GRTAATVGVLYVSTFAVQNFLYWVLNEPLISLGFEGAVKDTIAFVIAQGVATVTNFAIQR 139

Query: 118 RFMTR 122
            F+ +
Sbjct: 140 VFIFK 144


>gi|150007723|ref|YP_001302466.1| hypothetical protein BDI_1078 [Parabacteroides distasonis ATCC
           8503]
 gi|255013572|ref|ZP_05285698.1| hypothetical protein B2_06675 [Bacteroides sp. 2_1_7]
 gi|256839983|ref|ZP_05545492.1| conserved hypothetical protein [Parabacteroides sp. D13]
 gi|262381769|ref|ZP_06074907.1| conserved hypothetical protein [Bacteroides sp. 2_1_33B]
 gi|298375668|ref|ZP_06985625.1| GtrA family protein [Bacteroides sp. 3_1_19]
 gi|301310240|ref|ZP_07216179.1| putative GtrA family protein [Bacteroides sp. 20_3]
 gi|149936147|gb|ABR42844.1| conserved hypothetical protein [Parabacteroides distasonis ATCC
           8503]
 gi|256738913|gb|EEU52238.1| conserved hypothetical protein [Parabacteroides sp. D13]
 gi|262296946|gb|EEY84876.1| conserved hypothetical protein [Bacteroides sp. 2_1_33B]
 gi|298268168|gb|EFI09824.1| GtrA family protein [Bacteroides sp. 3_1_19]
 gi|300831814|gb|EFK62445.1| putative GtrA family protein [Bacteroides sp. 20_3]
          Length = 126

 Score = 54.5 bits (130), Expect = 4e-06,   Method: Composition-based stats.
 Identities = 17/121 (14%), Positives = 42/121 (34%), Gaps = 2/121 (1%)

Query: 3   QCIIFIINIVVVFFIDVMGFFILM-KCGADPFYSRIFSIAVAFLVTWIPSRLFIFLKLRR 61
           + + F I       I  +  +ILM     +  +S +     A +  +  S+ ++F   + 
Sbjct: 6   RILRFAIVGSSNALITALVIWILMDILDCNYLWSNMAGYVAALVNNFFWSKYWVFSSGKG 65

Query: 62  KSFLETVRYGVMYFMLSILNYAFYVKLLLTFQGLQPLLATVLSAVSSMLFVFLLYIRFMT 121
             + E   + + +       +  ++ L++    L   L   L         F++  R   
Sbjct: 66  NFWKEIPLFLIAFGCAYATQF-IFLLLMVEVIDLNEYLGQFLGLFVYGAVNFMMNKRLTF 124

Query: 122 R 122
           +
Sbjct: 125 K 125


>gi|94971204|ref|YP_593252.1| GtrA-like protein [Candidatus Koribacter versatilis Ellin345]
 gi|94553254|gb|ABF43178.1| GtrA-like protein [Candidatus Koribacter versatilis Ellin345]
          Length = 136

 Score = 54.5 bits (130), Expect = 4e-06,   Method: Composition-based stats.
 Identities = 17/125 (13%), Positives = 44/125 (35%), Gaps = 5/125 (4%)

Query: 3   QCIIFIINIVVVFFIDVMGFFILMKCGAD-PFYSRIFSIAVAFLVTWIPSRLFIFLKL-- 59
           +   F +       + +      M           + ++  A L  +     + +     
Sbjct: 6   RWWRFNLVGAGGVLVQLGLLQAWMHFALGNYLLGTVLAVEGAVLHNFGWHCAYTWKDRPA 65

Query: 60  --RRKSFLETVRYGVMYFMLSILNYAFYVKLLLTFQGLQPLLATVLSAVSSMLFVFLLYI 117
             R + +    R+ +    +S+      ++ L+   G+  L+A V++ VS  +  F L  
Sbjct: 66  RQRAEIWGRLARFHLSNGAVSVAGNLLIMRALVDGMGVPVLVANVVAIVSCSVVNFFLGD 125

Query: 118 RFMTR 122
           R++ +
Sbjct: 126 RWVFQ 130


>gi|325924756|ref|ZP_08186193.1| hypothetical protein XPE_0109 [Xanthomonas perforans 91-118]
 gi|325544848|gb|EGD16194.1| hypothetical protein XPE_0109 [Xanthomonas perforans 91-118]
          Length = 127

 Score = 54.5 bits (130), Expect = 5e-06,   Method: Composition-based stats.
 Identities = 18/123 (14%), Positives = 40/123 (32%), Gaps = 2/123 (1%)

Query: 2   KQCIIFIINIVVVFFIDVMGFFILMKCGADPFYSRIFSIAVAFLVTWIPSRLFIFLKLRR 61
           +Q   F+I   +   +D   F      G     + +       ++ +  +  + F +   
Sbjct: 5   RQGSQFMIIGALQLVVDCGIFIAATAAGMPAVPANLLGRIGGAMLGFWLNGRYTFAQQGD 64

Query: 62  KS--FLETVRYGVMYFMLSILNYAFYVKLLLTFQGLQPLLATVLSAVSSMLFVFLLYIRF 119
               +    R+ VM+  L++++       +      Q  LA  L      +  F L    
Sbjct: 65  ARLGWRRFGRFAVMWLTLTLISTWLLSTTVDLLGLRQAWLAKPLVEGGLAVVSFFLGRHV 124

Query: 120 MTR 122
           + R
Sbjct: 125 VYR 127


>gi|317481787|ref|ZP_07940815.1| hypothetical protein HMPREF0177_00207 [Bifidobacterium sp.
           12_1_47BFAA]
 gi|291517195|emb|CBK70811.1| Predicted membrane protein [Bifidobacterium longum subsp. longum
           F8]
 gi|316916724|gb|EFV38118.1| hypothetical protein HMPREF0177_00207 [Bifidobacterium sp.
           12_1_47BFAA]
          Length = 161

 Score = 54.5 bits (130), Expect = 5e-06,   Method: Composition-based stats.
 Identities = 15/122 (12%), Positives = 38/122 (31%), Gaps = 8/122 (6%)

Query: 4   CIIFIINIVVVFFIDVMGFFILMKCGADPFYSRIFSIAVAFLVTWIPSRLFIFLKLRRKS 63
              ++        ++   F IL   G     +   ++  +    ++ +R   F       
Sbjct: 45  LGKYVGVSATQTIVEYATFAILHLIGVPSQIANGIAVVCSATYNFVMNRNVTFKSSSN-- 102

Query: 64  FLETVRYGVMYFMLSILNY---AFYVKLLLTFQGLQPLLATVLSAVSSMLFVFLLYIRFM 120
                R   ++ +L I N+      +  +    GL P +   ++      + + L    +
Sbjct: 103 ---FTRSVALFVLLWIWNFTFSTLLIGWMPGATGLSPYVVKFIAMACQFGWGYPLCKYVI 159

Query: 121 TR 122
            R
Sbjct: 160 FR 161


>gi|322690710|ref|YP_004220280.1| hypothetical protein BLLJ_0519 [Bifidobacterium longum subsp.
           longum JCM 1217]
 gi|320455566|dbj|BAJ66188.1| conserved hypothetical protein [Bifidobacterium longum subsp.
           longum JCM 1217]
          Length = 159

 Score = 54.5 bits (130), Expect = 5e-06,   Method: Composition-based stats.
 Identities = 15/122 (12%), Positives = 38/122 (31%), Gaps = 8/122 (6%)

Query: 4   CIIFIINIVVVFFIDVMGFFILMKCGADPFYSRIFSIAVAFLVTWIPSRLFIFLKLRRKS 63
              ++        ++   F IL   G     +   ++  +    ++ +R   F       
Sbjct: 43  LGKYVGVSATQTIVEYATFAILHLIGVPSQIANGIAVVCSATYNFVMNRNVTFKSSSN-- 100

Query: 64  FLETVRYGVMYFMLSILNY---AFYVKLLLTFQGLQPLLATVLSAVSSMLFVFLLYIRFM 120
                R   ++ +L I N+      +  +    GL P +   ++      + + L    +
Sbjct: 101 ---FTRSVALFVLLWIWNFTFSTLLIGWMPGATGLSPYVVKFIAMACQFGWGYPLCKYVI 157

Query: 121 TR 122
            R
Sbjct: 158 FR 159


>gi|154487292|ref|ZP_02028699.1| hypothetical protein BIFADO_01137 [Bifidobacterium adolescentis
           L2-32]
 gi|154083810|gb|EDN82855.1| hypothetical protein BIFADO_01137 [Bifidobacterium adolescentis
           L2-32]
          Length = 131

 Score = 54.5 bits (130), Expect = 5e-06,   Method: Composition-based stats.
 Identities = 13/122 (10%), Positives = 41/122 (33%), Gaps = 2/122 (1%)

Query: 1   MKQCIIFIINIVVVFFIDVMGFFILMKCGADPFYSRIFSIAVAFLVTWIPSRLFIFLKLR 60
           ++Q   +     +  F++   F +L   G     +   ++  +    ++ +R   F    
Sbjct: 12  VRQLFSYGGVSAMQTFVEFGVFAVLQLAGLPFRLANAVAVFCSGSFNYVMNRNVTFKSSS 71

Query: 61  RKSFLETVRYGVMYFMLSILNYAFYVKLLLTFQGLQPLLATVLSAVSSMLFVFLLYIRFM 120
                    +  MY    + +    +  +    G   ++  +++     ++ FLL    +
Sbjct: 72  N-YTRSIAMFVAMYCWNLLFSN-LMMAWIPGLLGWPTMVVKIVTMGMQAVWGFLLCRYVI 129

Query: 121 TR 122
            +
Sbjct: 130 FK 131


>gi|154482542|ref|ZP_02024990.1| hypothetical protein EUBVEN_00209 [Eubacterium ventriosum ATCC
           27560]
 gi|149736567|gb|EDM52453.1| hypothetical protein EUBVEN_00209 [Eubacterium ventriosum ATCC
           27560]
          Length = 166

 Score = 54.5 bits (130), Expect = 5e-06,   Method: Composition-based stats.
 Identities = 13/124 (10%), Positives = 46/124 (37%), Gaps = 5/124 (4%)

Query: 3   QCIIFIINIVVVFFIDVMGFFILMKCGADPFYSRIFSIAVAFLVTWIPSRLFIFLKLRRK 62
           + + ++   +    +D + F            + I S   A + +++ ++ ++F      
Sbjct: 32  EMLTYVFFGIGTAIVDYLVFTFFNAGKVSALIANIISTFCAIIFSYVTNKRWVFKSKTSG 91

Query: 63  ---SFLETVRYGVMYFMLSILNYAFYVKLLLTFQGLQ--PLLATVLSAVSSMLFVFLLYI 117
                 E +R+        I++       +  +   Q    ++ ++S V +++  +++  
Sbjct: 92  FMEVLHEFLRFARARIATLIMSEVIIFASVAIYGNNQKVNQISKLISMVLTVILNYIISK 151

Query: 118 RFMT 121
            F+ 
Sbjct: 152 LFIF 155


>gi|212715864|ref|ZP_03323992.1| hypothetical protein BIFCAT_00770 [Bifidobacterium catenulatum DSM
           16992]
 gi|212661231|gb|EEB21806.1| hypothetical protein BIFCAT_00770 [Bifidobacterium catenulatum DSM
           16992]
          Length = 131

 Score = 54.5 bits (130), Expect = 5e-06,   Method: Composition-based stats.
 Identities = 13/122 (10%), Positives = 40/122 (32%), Gaps = 2/122 (1%)

Query: 1   MKQCIIFIINIVVVFFIDVMGFFILMKCGADPFYSRIFSIAVAFLVTWIPSRLFIFLKLR 60
           ++Q   +     +  F++   F +L   G     +   ++  +    ++ +R   F    
Sbjct: 12  VRQLFSYGGVSAMQTFVEFGVFAVLQLAGLPFRLANAVAVFCSGSFNYVMNRNVTFKSSS 71

Query: 61  RKSFLETVRYGVMYFMLSILNYAFYVKLLLTFQGLQPLLATVLSAVSSMLFVFLLYIRFM 120
                    +  MY    + +    +  +    G   +   +++     ++ FLL    +
Sbjct: 72  N-YARSIAMFVAMYCWNLLFSN-LMMAWIPGLLGWPTMAVKIVTMGMQAVWGFLLCRYVI 129

Query: 121 TR 122
            +
Sbjct: 130 FK 131


>gi|283782708|ref|YP_003373462.1| GtrA-like protein [Gardnerella vaginalis 409-05]
 gi|298253124|ref|ZP_06976916.1| hypothetical membrane protein [Gardnerella vaginalis 5-1]
 gi|283441584|gb|ADB14050.1| GtrA-like protein [Gardnerella vaginalis 409-05]
 gi|297532519|gb|EFH71405.1| hypothetical membrane protein [Gardnerella vaginalis 5-1]
          Length = 171

 Score = 54.5 bits (130), Expect = 5e-06,   Method: Composition-based stats.
 Identities = 18/129 (13%), Positives = 49/129 (37%), Gaps = 10/129 (7%)

Query: 1   MKQCIIFIINIVVVFFIDVMGFFILMKCGADPFYSRIFSIAVAFLVTWIPSRLFIFLKL- 59
           ++Q + F I  ++   IDV    +LM    +   +   S  ++ +  +I S  ++F    
Sbjct: 8   IEQVVKFGIVGIIALIIDVALLNLLMLAHLNNVVAGTISFVISLIFNYIASMKYVFKHRE 67

Query: 60  RRKSFLETVRYGVMYFMLSILNYAFYVKLLLTFQ---------GLQPLLATVLSAVSSML 110
               ++E + + +   +  ++N        L             L+  +  +++ V   +
Sbjct: 68  DMAKWMELLIFVISAVIGLLINDLIIWASTLGMVESLRGSAVYVLRTNIGKLVATVVVAV 127

Query: 111 FVFLLYIRF 119
           + F++    
Sbjct: 128 WNFVIRKWL 136


>gi|153952704|ref|YP_001393469.1| hypothetical protein CKL_0042 [Clostridium kluyveri DSM 555]
 gi|146345585|gb|EDK32121.1| Conserved hypothetical protein [Clostridium kluyveri DSM 555]
          Length = 128

 Score = 54.5 bits (130), Expect = 5e-06,   Method: Composition-based stats.
 Identities = 18/119 (15%), Positives = 59/119 (49%), Gaps = 2/119 (1%)

Query: 3   QCIIFIINIVVVFFIDVMGFFILMKCGADPFYSRIFSIAVAFLVTWIPSRLFIFLKLRRK 62
           + I + I+  +   I ++ + IL++ G +   S + +  +  +  +I  ++++F    +K
Sbjct: 11  KFIKYAISGTINTLITLLIYNILIQIGVNYMISNVIAYFLGIINGFILDKIWVFK-SNKK 69

Query: 63  SFLETVRYGVMYFMLSILNYAFYVKLLLTFQGLQPLLATVLSAVSSMLFVFLLYIRFMT 121
             +   ++ ++  +  + N +  +  L+   GL  +L+ ++S +S+ +F +++   +  
Sbjct: 70  IVILFSKFIIVNIISLLFN-SIILFTLVNNIGLDSVLSQLISTISTGMFNYIMNKVWTF 127


>gi|54023953|ref|YP_118195.1| hypothetical protein nfa19850 [Nocardia farcinica IFM 10152]
 gi|54015461|dbj|BAD56831.1| hypothetical protein [Nocardia farcinica IFM 10152]
          Length = 157

 Score = 54.5 bits (130), Expect = 5e-06,   Method: Composition-based stats.
 Identities = 18/126 (14%), Positives = 42/126 (33%), Gaps = 6/126 (4%)

Query: 2   KQCIIFIINIVVVFFIDVMG----FFILMKCGADPFYSRIFSIAVAFLVTWIPSRLFIFL 57
           +Q + F +       + ++       +L      P  +   + A+   V ++  R  +F 
Sbjct: 23  RQEVGFALIGGFNTVLGMVLTVAWLTVLPDRPWAPSAAVALAYAIGITVAFVLHRTLVFR 82

Query: 58  KLRRKSFLETVRYGVMYFMLSILNYAFYVKLLLTFQGLQPLLATVLSAVSSMLFVFLLYI 117
              R    + + +  +     +LN A      ++  GL    + V+      +  F  + 
Sbjct: 83  VRGR-VLRDFLGFVAVNSGGLVLNMALLSLA-VSVCGLPEKPSAVVVMGVVAVASFFGHR 140

Query: 118 RFMTRR 123
               RR
Sbjct: 141 HISFRR 146


>gi|313144956|ref|ZP_07807149.1| predicted protein [Helicobacter cinaedi CCUG 18818]
 gi|313129987|gb|EFR47604.1| predicted protein [Helicobacter cinaedi CCUG 18818]
          Length = 218

 Score = 54.5 bits (130), Expect = 5e-06,   Method: Composition-based stats.
 Identities = 20/124 (16%), Positives = 45/124 (36%), Gaps = 2/124 (1%)

Query: 1   MKQCIIF-IINIVVVFFIDVMGFFILMKCGADPFYSRIFSIAVAFLVTWIPSRLFIFLKL 59
           +KQ I+F  I   +     +  + +    G     + +    +A  +     R F+F   
Sbjct: 68  LKQLIVFFCIGGGITLLELLGFYILYKIFGVHYILASLIMFVLASGIGVWLYRRFVFGGT 127

Query: 60  RRKSFLETVRYGVMYFMLSILNYAFYVKLLLTFQGLQPLLATVLSAVSSMLFVFLLYIRF 119
                LE     ++  +   LN        + F G + ++A +L+++    + F      
Sbjct: 128 HLHRGLEVGLTYLINTIGIGLNTLILWLC-VEFLGFEAIVAKILASLLVAFYGFYARKLV 186

Query: 120 MTRR 123
           + R+
Sbjct: 187 IYRK 190


>gi|254382734|ref|ZP_04998091.1| sugar translocase [Streptomyces sp. Mg1]
 gi|194341636|gb|EDX22602.1| sugar translocase [Streptomyces sp. Mg1]
          Length = 150

 Score = 54.5 bits (130), Expect = 5e-06,   Method: Composition-based stats.
 Identities = 17/119 (14%), Positives = 50/119 (42%), Gaps = 4/119 (3%)

Query: 1   MKQCIIFIINIVVVFFIDVMGFFILMKCGADPFYSRIFSIAVAFLVTWIPSRLFIFLKLR 60
           + Q + F +   V         ++L+      F +   +  ++ + ++  +  F +    
Sbjct: 15  LGQVLRFALVGGVNTGTFFGI-YLLLHPWMPYFAAYTLAFLLSMVGSFFMNTYFTY--RT 71

Query: 61  RKSFLETVRYGVMYFMLSILNYAFYVKLLLTFQGLQPLLATVLSAVSSMLFVFLLYIRF 119
           R ++ + + + +      ++        L+T+ G+   +A +++AV ++ F FLL  + 
Sbjct: 72  RPTWKKFLLFPLTNITNYVIQSVGLYA-LVTWAGMDTRIAPLVAAVVAIPFTFLLSRKI 129


>gi|239622264|ref|ZP_04665295.1| conserved hypothetical protein [Bifidobacterium longum subsp.
           infantis CCUG 52486]
 gi|312133106|ref|YP_004000445.1| membrane protein [Bifidobacterium longum subsp. longum BBMN68]
 gi|322688725|ref|YP_004208459.1| hypothetical protein BLIF_0538 [Bifidobacterium longum subsp.
           infantis 157F]
 gi|239514261|gb|EEQ54128.1| conserved hypothetical protein [Bifidobacterium longum subsp.
           infantis CCUG 52486]
 gi|311774103|gb|ADQ03591.1| Hypothetical Membrane protein [Bifidobacterium longum subsp. longum
           BBMN68]
 gi|320460061|dbj|BAJ70681.1| conserved hypothetical protein [Bifidobacterium longum subsp.
           infantis 157F]
          Length = 159

 Score = 54.5 bits (130), Expect = 5e-06,   Method: Composition-based stats.
 Identities = 15/122 (12%), Positives = 38/122 (31%), Gaps = 8/122 (6%)

Query: 4   CIIFIINIVVVFFIDVMGFFILMKCGADPFYSRIFSIAVAFLVTWIPSRLFIFLKLRRKS 63
              ++        ++   F IL   G     +   ++  +    ++ +R   F       
Sbjct: 43  LGKYVGVSATQTIVEYATFAILHLIGVPSQIANGIAVVCSATYNFVMNRNVTFKSSSN-- 100

Query: 64  FLETVRYGVMYFMLSILNY---AFYVKLLLTFQGLQPLLATVLSAVSSMLFVFLLYIRFM 120
                R   ++ +L I N+      +  +    GL P +   ++      + + L    +
Sbjct: 101 ---FTRSVALFVLLWIWNFTFSTLLIGWMPGATGLSPYVVKFIAMACQFGWGYPLCKYVI 157

Query: 121 TR 122
            R
Sbjct: 158 FR 159


>gi|311032018|ref|ZP_07710108.1| putative glycosyltransferase [Bacillus sp. m3-13]
          Length = 292

 Score = 54.5 bits (130), Expect = 5e-06,   Method: Composition-based stats.
 Identities = 15/131 (11%), Positives = 49/131 (37%), Gaps = 10/131 (7%)

Query: 4   CIIFIINIVVVFFIDVMGFFILMKCGADPFY------SRIFSIAVAFLVTWIPSRLFIFL 57
            + F+++ V+ F +D++ F + +      F       + + S  ++ L  +  +R  +F 
Sbjct: 163 FLKFVLSSVLSFGLDILLFALFVMMLNGVFVESYIILATVLSRVLSSLFNFTVNRKVVFK 222

Query: 58  KLRRKSFLETVRYGVMYFMLSILNYAFYVKLLLTFQGLQPLLATVLSAVSSMLFVFLLYI 117
                +    V+Y  +     + +      +     G   +   ++      L  +++  
Sbjct: 223 STSSYA---MVKYFSLSIAQMLASAGGVYLIF-ELVGFGEVGIKIVVDGLLFLASYVIQK 278

Query: 118 RFMTRRVYFIK 128
            ++ +  Y ++
Sbjct: 279 EWVFKEKYQVR 289


>gi|291439220|ref|ZP_06578610.1| integral membrane protein [Streptomyces ghanaensis ATCC 14672]
 gi|291342115|gb|EFE69071.1| integral membrane protein [Streptomyces ghanaensis ATCC 14672]
          Length = 182

 Score = 54.5 bits (130), Expect = 5e-06,   Method: Composition-based stats.
 Identities = 18/126 (14%), Positives = 41/126 (32%), Gaps = 5/126 (3%)

Query: 2   KQCIIFIINIVVVFFIDVMGFFILMKCGADPFY-SRIFSIAVAFLVTWIPSRLFIFLKLR 60
           ++   F     V   +++  F ++          + + +  VA +  +I  R F +    
Sbjct: 30  REVAKFGAVGGVGVLVNLGVFNLVRHVTDLQVVRASVIATVVAIVFNYIGFRYFAYRDRD 89

Query: 61  RKSFL-ETVRYGVMYFMLSILNYAFYVKLLLTFQGLQPLLA---TVLSAVSSMLFVFLLY 116
           +     E   + +   +  ++           F    PL +     L    + LF F  Y
Sbjct: 90  KTRRTREMSLFLLFSAIGLVIENGVLYTATYGFGWDSPLQSNVFKFLGIGIATLFRFWSY 149

Query: 117 IRFMTR 122
             ++ R
Sbjct: 150 RSWVFR 155


>gi|167933010|ref|ZP_02520097.1| hypothetical protein cdivTM7_00189 [candidate division TM7
           single-cell isolate TM7b]
 gi|167957430|ref|ZP_02544504.1| hypothetical protein cdiviTM7_02105 [candidate division TM7
           single-cell isolate TM7c]
          Length = 136

 Score = 54.5 bits (130), Expect = 5e-06,   Method: Composition-based stats.
 Identities = 21/128 (16%), Positives = 53/128 (41%), Gaps = 7/128 (5%)

Query: 3   QCIIFIINIVVVFFIDVMGFFILMKCGADPFYSRIFSIAVAFLVTWIPSRLFIFLKLRRK 62
           Q   F +  +V   ID    F+L   G     +   S  +AF+ ++  ++ + F    + 
Sbjct: 6   QISRFAVVGLVNTVIDFGLLFLLTFLGLPKIAANTVSTGLAFIFSFFANKKYTFKSTSKN 65

Query: 63  SFLETVRYGVMYFMLSI-------LNYAFYVKLLLTFQGLQPLLATVLSAVSSMLFVFLL 115
              E + + ++                   +K ++  + L   +A +L+ + S+++ + L
Sbjct: 66  IIYEIILFIIITLFGLWVLQNSIIWLATPSIKNIIPQEQLALFIAKLLATIVSLVWNYCL 125

Query: 116 YIRFMTRR 123
           Y +F+ ++
Sbjct: 126 YDKFVFKK 133


>gi|310657763|ref|YP_003935484.1| membrane protein [Clostridium sticklandii DSM 519]
 gi|308824541|emb|CBH20579.1| membrane protein, GtrA family [Clostridium sticklandii]
          Length = 133

 Score = 54.5 bits (130), Expect = 5e-06,   Method: Composition-based stats.
 Identities = 14/120 (11%), Positives = 45/120 (37%), Gaps = 3/120 (2%)

Query: 4   CIIFIINIVVVFFIDVMGFFILMKCGADPFYSRIFSIAVAFLVTWIPSRLFIFLKLRRKS 63
              F +   +      + + +L++       + I +      V+++ +  F+F +   K+
Sbjct: 14  FFGFALVGAINTGFSFIIYILLLRLDLYYILASILAYIAGIAVSYLLNTKFVFKEE--KT 71

Query: 64  FLETVRYGVMYFMLSILNYAFYVKLLLTFQGLQPLLATVLSAVSSMLFVFLLYIRFMTRR 123
                ++  +Y    ++N       L+   G  P+L  +      + + ++L   +  ++
Sbjct: 72  IGNLSKFVSVYLTALVINTGLLYA-LVNLIGFNPVLGQIGVTCLVLFYNYVLQKLWTFKK 130


>gi|170741566|ref|YP_001770221.1| GtrA family protein [Methylobacterium sp. 4-46]
 gi|168195840|gb|ACA17787.1| GtrA family protein [Methylobacterium sp. 4-46]
          Length = 151

 Score = 54.5 bits (130), Expect = 5e-06,   Method: Composition-based stats.
 Identities = 20/121 (16%), Positives = 44/121 (36%), Gaps = 3/121 (2%)

Query: 2   KQCIIFIINIVVVFFIDVMGFFILMKCG-ADPFYSRIFSIAVAFLVTWIPSRLFIFLKLR 60
           +Q   ++        +      +L++ G  DP  + I        V++  +R   +    
Sbjct: 24  RQFTTYVTIGFGALAVHYGLLVLLVELGRVDPVPAAILGYVAGGFVSYTLNRRHTY-ASD 82

Query: 61  RKSFLETVRYGVMYFMLSILNYAFYVKLLLTFQGLQPLLATVLSAVSSMLFVFLLYIRFM 120
           R       R+ V+     +L +   + LL+ + GL  L A V++    + + F     + 
Sbjct: 83  RPHGEALWRFVVVAGCGLVLTW-VLMALLIRWAGLTYLPAQVVTTGLVVFWNFSGNKLWT 141

Query: 121 T 121
            
Sbjct: 142 F 142


>gi|68146472|emb|CAH10159.1| ChaS3 protein [Streptomyces chartreusis]
          Length = 132

 Score = 54.1 bits (129), Expect = 5e-06,   Method: Composition-based stats.
 Identities = 18/112 (16%), Positives = 42/112 (37%), Gaps = 4/112 (3%)

Query: 14  VFFIDVMGFFILMKCGADPFYSRIFSIAVAFLVTWIPSRLFIFLKLRRKSF-LETVRYGV 72
                     + +     P  S   +  +A  +++  +R + F   RR +   E   + V
Sbjct: 6   STVAIAGTSVLHVGLRVGPLTSNAIATLLATTLSFAGNRWWTFRHRRRSNLVQEYALFFV 65

Query: 73  MYFMLSILNY---AFYVKLLLTFQGLQPLLATVLSAVSSMLFVFLLYIRFMT 121
           +     ++     AF V++L     +   +A ++    + L  FL Y +++ 
Sbjct: 66  LNGAGLLIQLLAIAFAVRVLDRDDPVSYHVALLVGVAVASLVRFLSYKKWVF 117


>gi|218261766|ref|ZP_03476501.1| hypothetical protein PRABACTJOHN_02172 [Parabacteroides johnsonii
           DSM 18315]
 gi|218223780|gb|EEC96430.1| hypothetical protein PRABACTJOHN_02172 [Parabacteroides johnsonii
           DSM 18315]
          Length = 125

 Score = 54.1 bits (129), Expect = 6e-06,   Method: Composition-based stats.
 Identities = 18/123 (14%), Positives = 47/123 (38%), Gaps = 2/123 (1%)

Query: 1   MKQCIIFIINIVVVFFIDVMGFFILM-KCGADPFYSRIFSIAVAFLVTWIPSRLFIFLKL 59
           M + + FI+   +   I V+  +++M K   +   + I +  +A +  +  S+ +IF   
Sbjct: 1   MVRVMRFILIGTLNALITVLIVWLMMDKLDCNYIATNITAYVIAQINNFFWSKYWIFSSR 60

Query: 60  RRKSFLETVRYGVMYFMLSILNYAFYVKLLLTFQGLQPLLATVLSAVSSMLFVFLLYIRF 119
             K   E   + + +       +   + +++    L   LA  L         +++  + 
Sbjct: 61  TGKFRREIPLFLIAFGCAYCSQF-LALLIMVEIFDLNEYLAQFLGLFIYGAVNYMMNKKI 119

Query: 120 MTR 122
             +
Sbjct: 120 TFQ 122


>gi|16080872|ref|NP_391700.1| integral inner membrane protein [Bacillus subtilis subsp. subtilis
           str. 168]
 gi|221311786|ref|ZP_03593633.1| hypothetical protein Bsubs1_20626 [Bacillus subtilis subsp.
           subtilis str. 168]
 gi|221316112|ref|ZP_03597917.1| hypothetical protein BsubsN3_20547 [Bacillus subtilis subsp.
           subtilis str. NCIB 3610]
 gi|221321024|ref|ZP_03602318.1| hypothetical protein BsubsJ_20485 [Bacillus subtilis subsp.
           subtilis str. JH642]
 gi|221325308|ref|ZP_03606602.1| hypothetical protein BsubsS_20646 [Bacillus subtilis subsp.
           subtilis str. SMY]
 gi|321313378|ref|YP_004205665.1| putative integral inner membrane protein [Bacillus subtilis BSn5]
 gi|732349|sp|P39602|YWCD_BACSU RecName: Full=Uncharacterized membrane protein ywcD
 gi|413958|emb|CAA51590.1| ipa-34d [Bacillus subtilis subsp. subtilis str. 168]
 gi|2636356|emb|CAB15847.1| putative integral inner membrane protein [Bacillus subtilis subsp.
           subtilis str. 168]
 gi|291486413|dbj|BAI87488.1| hypothetical protein BSNT_05844 [Bacillus subtilis subsp. natto
           BEST195]
 gi|320019652|gb|ADV94638.1| putative integral inner membrane protein [Bacillus subtilis BSn5]
          Length = 127

 Score = 54.1 bits (129), Expect = 6e-06,   Method: Composition-based stats.
 Identities = 16/123 (13%), Positives = 50/123 (40%), Gaps = 5/123 (4%)

Query: 7   FIINIVVVFFIDVMGFFILMKCGA-DPFYSRIFSIAVAFLVTWIPSRLFIFLKLRR---K 62
           +II  V    +++  F+IL++    D   + + +  ++ L  +I ++L++F +       
Sbjct: 2   YIIMGVFTTIVNIASFYILVEIMNVDYKAATVAAWILSVLFAYITNKLYVFQQKTHDLQS 61

Query: 63  SFLETVRYGVMYFMLSILNYAFYVKLLLTFQGLQPLLATVLSAVSSMLFVFLLYIRFMTR 122
              E   +  +  +   ++    + +L+        LA +L     ++  ++     + +
Sbjct: 62  LLKELTAFFSVRVLSLGIDLG-MMIILVGQFNTNETLAKILDNAVIVVVNYVASKWLVFK 120

Query: 123 RVY 125
           +  
Sbjct: 121 KTK 123


>gi|120609298|ref|YP_968976.1| GtrA family protein [Acidovorax citrulli AAC00-1]
 gi|120587762|gb|ABM31202.1| GtrA family protein [Acidovorax citrulli AAC00-1]
          Length = 134

 Score = 54.1 bits (129), Expect = 6e-06,   Method: Composition-based stats.
 Identities = 21/123 (17%), Positives = 40/123 (32%), Gaps = 2/123 (1%)

Query: 1   MKQCIIFIINIVVVFFIDVMGFFILMKC-GADPFYSRIFSIAVAFLVTWIPSRLFIFLKL 59
           + Q + F++         +    +L+   G  P  + + +  VAF V++    L  F   
Sbjct: 6   LPQGVQFVLVGGAAAATHLGTMGLLVALAGMPPLAANVLAFLVAFAVSYNGHALLTFAAS 65

Query: 60  RRKSFLETVRYGVMYFMLSILNYAFYVKLLLTFQGLQPLLATVLSAVSSMLFVFLLYIRF 119
           RR+      RY  +  +    N        L         +     V   L  F+L   +
Sbjct: 66  RRRGPTAMARYFAVACLTFAANE-LMYFTALHILHWHYFWSQAGVLVLVALGTFVLSKFW 124

Query: 120 MTR 122
             +
Sbjct: 125 AFK 127


>gi|226324425|ref|ZP_03799943.1| hypothetical protein COPCOM_02206 [Coprococcus comes ATCC 27758]
 gi|225206873|gb|EEG89227.1| hypothetical protein COPCOM_02206 [Coprococcus comes ATCC 27758]
          Length = 177

 Score = 54.1 bits (129), Expect = 6e-06,   Method: Composition-based stats.
 Identities = 13/126 (10%), Positives = 57/126 (45%), Gaps = 5/126 (3%)

Query: 2   KQCIIFIINIVVVFFIDVMGFFIL-MKCGADPFYSRIFSIAVAFLVTWIPSRLFIFLKLR 60
           K+ ++++    + F + ++ +  L ++ G +   + I S  +A    ++ +R+++F    
Sbjct: 53  KEILLYLFFGGLTFLVSIISYAFLNIQIGWNALIANIGSWILAVSFAYVTNRVWVF-DSN 111

Query: 61  RKSFLETVRYGVMYFMLSILNYA---FYVKLLLTFQGLQPLLATVLSAVSSMLFVFLLYI 117
            ++  + ++    +    +         + + +T  G+  +L  +++ V  ++  +++  
Sbjct: 112 AETTADFIKEITSFIGGRVATLVIEELILFIFITNLGMNSMLVKIVAQVIVIVLNYVISK 171

Query: 118 RFMTRR 123
             + ++
Sbjct: 172 LIVFKK 177


>gi|255009373|ref|ZP_05281499.1| hypothetical protein Bfra3_09552 [Bacteroides fragilis 3_1_12]
 gi|313147130|ref|ZP_07809323.1| conserved hypothetical protein [Bacteroides fragilis 3_1_12]
 gi|313135897|gb|EFR53257.1| conserved hypothetical protein [Bacteroides fragilis 3_1_12]
          Length = 127

 Score = 54.1 bits (129), Expect = 6e-06,   Method: Composition-based stats.
 Identities = 19/122 (15%), Positives = 47/122 (38%), Gaps = 2/122 (1%)

Query: 3   QCIIFIINIVVVFFIDVMGFFILM-KCGADPFYSRIFSIAVAFLVTWIPSRLFIFL-KLR 60
           +   F +   +   I     +++M +   D   + I +  VA +  +I S+ +IF  + +
Sbjct: 6   RIFRFAVIGTLNALITAFVIWLMMDELSYDYIPANITAYIVAQIHNFIWSKYWIFPIENK 65

Query: 61  RKSFLETVRYGVMYFMLSILNYAFYVKLLLTFQGLQPLLATVLSAVSSMLFVFLLYIRFM 120
           + +  + + +    F L+      ++  L+    +   LA  L         F++  +  
Sbjct: 66  KNNIWKQILFFCSAFGLAYSAQFLFLVTLVECGDVNEYLAQFLGLFIYGTVNFIVNKKLT 125

Query: 121 TR 122
            R
Sbjct: 126 FR 127


>gi|153812332|ref|ZP_01965000.1| hypothetical protein RUMOBE_02731 [Ruminococcus obeum ATCC 29174]
 gi|149831494|gb|EDM86581.1| hypothetical protein RUMOBE_02731 [Ruminococcus obeum ATCC 29174]
          Length = 140

 Score = 54.1 bits (129), Expect = 6e-06,   Method: Composition-based stats.
 Identities = 15/122 (12%), Positives = 44/122 (36%), Gaps = 5/122 (4%)

Query: 4   CIIFIINIVVVFFIDVMGFFILMKC-GADPFYSRIFSIAVAFLVTWIPSRLFIFLKLR-- 60
            + ++        ++++ F+IL      +   + + SI VA +  +I +  ++F      
Sbjct: 16  VVRYVFFGGCTTLVNLVCFYILWNLCHLNLNIANVISIIVAIIFAYIVNSKYVFQDKCET 75

Query: 61  -RKSFLETVRYGVMYFMLSILNYAFYVKLLLTFQGLQPLLATVLSAVSSMLFVFLLYIRF 119
            R       ++     +  ++     V LL    G+  ++    +    +   ++    F
Sbjct: 76  LRDHIRPFCKFISARLLTMVIEVG-GVWLLCEKMGMNGMVGKFCTQFIVLALNYVFSKFF 134

Query: 120 MT 121
           + 
Sbjct: 135 VF 136


>gi|294500719|ref|YP_003564419.1| GtrA-like protein [Bacillus megaterium QM B1551]
 gi|294350656|gb|ADE70985.1| GtrA-like protein [Bacillus megaterium QM B1551]
          Length = 140

 Score = 54.1 bits (129), Expect = 6e-06,   Method: Composition-based stats.
 Identities = 14/126 (11%), Positives = 44/126 (34%), Gaps = 9/126 (7%)

Query: 4   CIIFIINIVVVFFIDVMGFFILMKCGADPFYSRIFSIAVAFLVTWIPSRLFIFLKLRRKS 63
            + F++  +V   + +   ++L+      + +     A   +V+++ +R+F F       
Sbjct: 5   FVRFLVVGLVNTGVGLSIMYVLLHIFHHYWAATFVGNAAGAVVSYVLNRIFTFK-SGVHL 63

Query: 64  FLETVRYGVMYFMLSILNYAFYVKLLLTFQGLQPL--------LATVLSAVSSMLFVFLL 115
               +R+ ++  +   L+Y   ++         P         +  ++      L  +  
Sbjct: 64  SKSILRFILVIGVCYGLSYYIGLQFSSWLLHQLPAAVRPFKKDVGILIGTGLYTLLNYTG 123

Query: 116 YIRFMT 121
              F+ 
Sbjct: 124 QKYFVF 129


>gi|120608769|ref|YP_968447.1| GtrA family protein [Acidovorax citrulli AAC00-1]
 gi|120587233|gb|ABM30673.1| GtrA family protein [Acidovorax citrulli AAC00-1]
          Length = 143

 Score = 54.1 bits (129), Expect = 7e-06,   Method: Composition-based stats.
 Identities = 16/126 (12%), Positives = 42/126 (33%), Gaps = 7/126 (5%)

Query: 2   KQCIIFIINIVVVFFIDVMGFFILMKCGADPFYSRIFSIAVAFLVTWIPSRLFIFLKLRR 61
           +Q + F++   V    +                + I +  V     ++ +R F+F    +
Sbjct: 8   RQFLAFLVTGGVAALANFGSRIAFSHW-MPFSAAVIAAYCVGMCTAFVLARAFVFKASTQ 66

Query: 62  KSFLETVRYGVMYFMLSILNYAFYVKLLLTFQ------GLQPLLATVLSAVSSMLFVFLL 115
            +    + + ++  +     +A  + LL             P +A  +  V  +   +L 
Sbjct: 67  STHKSAMFFVLVNLLAVAQTWAVSMALLQWVLPALGITAFAPEIAHAVGVVVPVFTSYLG 126

Query: 116 YIRFMT 121
           + R+  
Sbjct: 127 HKRWSF 132


>gi|325272086|ref|ZP_08138522.1| GtrA family protein [Pseudomonas sp. TJI-51]
 gi|324102782|gb|EGC00193.1| GtrA family protein [Pseudomonas sp. TJI-51]
          Length = 139

 Score = 54.1 bits (129), Expect = 7e-06,   Method: Composition-based stats.
 Identities = 19/119 (15%), Positives = 43/119 (36%), Gaps = 4/119 (3%)

Query: 4   CIIFIINIVVVFFIDVMGFFILMKCGAD-PFYSRIFSIAVAFLVTWIPSRLFIFLKLRRK 62
            I ++    +   I    F +L+      P  + I    V  + ++I +R   F+     
Sbjct: 12  LIRYLGIGFIATGIHYAVFLVLVTTELSTPLLASICGGMVGAIASFIGNRALCFVSDG-S 70

Query: 63  SFLETVRYGVMYFMLSILNYAFYVKLLLTFQGLQPLLATVLSAVSSMLFVFLLYIRFMT 121
              + VR+ ++    +  N        L    L PL++ ++  +S     F+ +  +  
Sbjct: 71  RKFQPVRFALVALATNFGNGVGM--WFLIKSNLSPLISQLVVTLSLTALGFIAHRFWTF 127


>gi|225026775|ref|ZP_03715967.1| hypothetical protein EUBHAL_01027 [Eubacterium hallii DSM 3353]
 gi|224955894|gb|EEG37103.1| hypothetical protein EUBHAL_01027 [Eubacterium hallii DSM 3353]
          Length = 172

 Score = 54.1 bits (129), Expect = 7e-06,   Method: Composition-based stats.
 Identities = 16/125 (12%), Positives = 52/125 (41%), Gaps = 5/125 (4%)

Query: 2   KQCIIFIINIVVVFFIDVMGF-FILMKCGADPFYSRIFSIAVAFLVTWIPSRLFIF---L 57
           K+ ++++    +   I +  + +  +  G DP  + I S  +A    ++ +++++F    
Sbjct: 46  KEMLLYLFFGGMTAVISIGSYSYCDVGLGFDPLIANIISWILAVTFAYVTNKVWVFSVET 105

Query: 58  KLRRKSFLETVRYGVMYFMLSILNYAFYVKLLLTFQGLQPLLATVLSAVSSMLFVFLLYI 117
               + F+E   +        I+  A  +   ++      ++  V++ V  ++  +++  
Sbjct: 106 HGMHELFIEAFHFFTGRLFTLIVEEAILLI-FISKLHFNSIVVKVVAQVVVVVLNYIISK 164

Query: 118 RFMTR 122
             + R
Sbjct: 165 LIVFR 169


>gi|325915879|ref|ZP_08178175.1| hypothetical protein XVE_2108 [Xanthomonas vesicatoria ATCC 35937]
 gi|325537846|gb|EGD09546.1| hypothetical protein XVE_2108 [Xanthomonas vesicatoria ATCC 35937]
          Length = 128

 Score = 53.7 bits (128), Expect = 7e-06,   Method: Composition-based stats.
 Identities = 18/124 (14%), Positives = 39/124 (31%), Gaps = 3/124 (2%)

Query: 2   KQCIIFIINIVVVFFIDVMGFFILMKCGADPFYSRIFSIAVAFLVTWIPSRLFIF---LK 58
           +Q   F +   +   +D   F      G     + +       ++ +  +  + F     
Sbjct: 5   RQGSQFTLIGGLQLAVDCGIFIAATAAGMPTVPANLLGRISGAVLGFWLNGRYTFAQQGG 64

Query: 59  LRRKSFLETVRYGVMYFMLSILNYAFYVKLLLTFQGLQPLLATVLSAVSSMLFVFLLYIR 118
             R  +    R+ VM+  L++++       +      Q  LA  L      +  F L   
Sbjct: 65  GARLGWQRFRRFAVMWLALTVISTWLLSATVDLVGLRQAWLAKPLVEGGLAIVSFFLGRH 124

Query: 119 FMTR 122
            + R
Sbjct: 125 VVYR 128


>gi|300857526|ref|YP_003782509.1| hypothetical protein cpfrc_00109 [Corynebacterium
           pseudotuberculosis FRC41]
 gi|300684980|gb|ADK27902.1| putative membrane protein [Corynebacterium pseudotuberculosis
           FRC41]
 gi|302205264|gb|ADL09606.1| Putative membrane protein [Corynebacterium pseudotuberculosis C231]
 gi|302329820|gb|ADL20014.1| Putative membrane protein [Corynebacterium pseudotuberculosis 1002]
 gi|308275505|gb|ADO25404.1| Putative membrane protein [Corynebacterium pseudotuberculosis I19]
          Length = 152

 Score = 53.7 bits (128), Expect = 7e-06,   Method: Composition-based stats.
 Identities = 20/127 (15%), Positives = 48/127 (37%), Gaps = 9/127 (7%)

Query: 3   QCIIFIINIVVVFFIDVMGFFIL-MKCGADPFYSRIFSIAVAFLVTWIPSRLFIFLKLRR 61
           Q I FII+  +   +D+   ++  +  G      R        +  ++ +R + F     
Sbjct: 28  QGIKFIISGGISAVVDLGLTYLCQIVFGFSAAGGRTIGFIFGTITAYLINRRWTFQAE-- 85

Query: 62  KSFLETVRYGVMYFMLSILNYAFYVKLLLTFQG------LQPLLATVLSAVSSMLFVFLL 115
            S    ++  V+Y +   +N   +  L            +  ++A V+S  ++ +  F +
Sbjct: 86  ASTKRFLQVAVLYTITYFVNVGGHSLLFSLLTHYGVSEQIALVIAFVISQGTATVINFFV 145

Query: 116 YIRFMTR 122
              F+ +
Sbjct: 146 QRIFIFK 152


>gi|295426443|ref|ZP_06819093.1| probable cell wall teichoic acid glycosylation protein
           [Lactobacillus amylolyticus DSM 11664]
 gi|295063811|gb|EFG54769.1| probable cell wall teichoic acid glycosylation protein
           [Lactobacillus amylolyticus DSM 11664]
          Length = 181

 Score = 53.7 bits (128), Expect = 7e-06,   Method: Composition-based stats.
 Identities = 17/126 (13%), Positives = 48/126 (38%), Gaps = 6/126 (4%)

Query: 2   KQCIIFIINIVVVFFIDVMGFFILM-KCGADPFYSRIFSIAVAFLVTWIPSRLFIF---L 57
           +   ++++   V   I+ + F IL     +    S   +  V+ L ++  ++  +F   +
Sbjct: 31  RNLCVYMLFGFVAALINTVAFMILHQWWHSAVVISNTIAFIVSNLASFYFNQKAVFINNV 90

Query: 58  KLRRKSFLETVRYGVMYFMLSILNYAFYVKLLLTFQGLQPLLATVLSAVSSMLFVFLLYI 117
                ++ + V +     +  I +    +  L     L  LL  ++  +   +F +L   
Sbjct: 91  DHEHSTWHKLVAFFTYRIISLIPDTLIMLVGLSWL-HLNALLVKIIDQILVGIFNYLTTR 149

Query: 118 RFMTRR 123
             + ++
Sbjct: 150 S-VFQK 154


>gi|53713671|ref|YP_099663.1| hypothetical protein BF2380 [Bacteroides fragilis YCH46]
 gi|60681944|ref|YP_212088.1| hypothetical protein BF2464 [Bacteroides fragilis NCTC 9343]
 gi|253565619|ref|ZP_04843074.1| conserved hypothetical protein [Bacteroides sp. 3_2_5]
 gi|52216536|dbj|BAD49129.1| conserved hypothetical protein [Bacteroides fragilis YCH46]
 gi|60493378|emb|CAH08164.1| conserved hypothetical membrane protein [Bacteroides fragilis NCTC
           9343]
 gi|251945898|gb|EES86305.1| conserved hypothetical protein [Bacteroides sp. 3_2_5]
          Length = 127

 Score = 53.7 bits (128), Expect = 7e-06,   Method: Composition-based stats.
 Identities = 19/122 (15%), Positives = 47/122 (38%), Gaps = 2/122 (1%)

Query: 3   QCIIFIINIVVVFFIDVMGFFILM-KCGADPFYSRIFSIAVAFLVTWIPSRLFIFL-KLR 60
           +   F +   +   I     +++M +   D   + I +  VA +  +I S+ +IF  + +
Sbjct: 6   RIFRFAVIGTLNALITAFVIWLMMDELSYDYIPANITAYIVAQIHNFIWSKYWIFPIENK 65

Query: 61  RKSFLETVRYGVMYFMLSILNYAFYVKLLLTFQGLQPLLATVLSAVSSMLFVFLLYIRFM 120
           + +  + +