RPS-BLAST 2.2.22 [Sep-27-2009] Database: CddA 21,609 sequences; 6,263,737 total letters Searching..................................................done Query= gi|254780790|ref|YP_003065203.1| hypothetical protein CLIBASIA_03405 [Candidatus Liberibacter asiaticus str. psy62] (129 letters) >gnl|CDD|146661 pfam04138, GtrA, GtrA-like protein. Members of this family are predicted to be integral membrane proteins with three or four transmembrane spans. They are involved in the synthesis of cell surface polysaccharides. The GtrA family are a subset of this family. GtrA is predicted to be an integral membrane protein with 4 transmembrane spans. It is involved is in O antigen modification by Shigella flexneri bacteriophage X (SfX), but does not determine the specificity of glucosylation. Its function remains unknown, but it may play a role in translocation of undecaprenyl phosphate linked glucose (UndP-Glc) across the cytoplasmic membrane. Another member of this family is a DTDP-glucose-4-keto-6-deoxy-D-glucose reductase, which catalyses the conversion of dTDP-4-keto-6-deoxy-D-glucose to dTDP-D-fucose, which is involved in the biosynthesis of the serotype-specific polysaccharide antigen of Actinobacillus actinomycetemcomitans Y4 (serotype b). This family also includes the teichoic acid glycosylation protein, GtcA, which is a serotype-specific protein in some Listeria innocua and monocytogenes strains. Its exact function is not known, but it is essential for decoration of cell wall teichoic acids with glucose and galactose. Length = 116 Score = 35.6 bits (83), Expect = 0.004 Identities = 27/114 (23%), Positives = 52/114 (45%), Gaps = 2/114 (1%) Query: 7 FIINIVVVFFIDVMGFFILMK-CGADPFYSRIFSIAVAFLVTWIPSRLFIFLKLRRKSFL 65 F++ V+ +D+ F +L+ G + + VA L ++ +R + F R S Sbjct: 2 FLLVGVLGTLVDLGVFLLLLNLLGLSYLLANAIAFLVAILFNYLLNRRWTFRSRGRGSLR 61 Query: 66 ETVRYGVMYFMLSILNYAFYVKLLLTFQGLQPLLATVLSAVSSMLFVFLLYIRF 119 + +R+ ++ + +LN LL+ GL PLLA ++ + FLL + Sbjct: 62 QFLRFFLVSLLGLLLNLLLLY-LLVDLLGLDPLLAKLIGIAVVTVVNFLLSKFW 114 >gnl|CDD|153393 cd07923, Gallate_dioxygenase_C, The C-terminal domain of Gallate Dioxygenase, which catalyzes the oxidization and subsequent ring-opening of gallate. Gallate Dioxygenase catalyzes the oxidization and subsequent ring-opening of gallate, an intermediate in the degradation of the aromatic compound, syringate. The reaction product of gallate dioxygenase is 4-oxalomesaconate. The amino acid sequence of the N-terminal and C-terminal regions of gallate dioxygenase exhibits homology with the sequence of the PCA 4,5-dioxygenase B (catalytic) and A subunits, respectively. This model represents the C-terminal domain, which is similar to the A subunit of PCA 4,5-dioxygenase (or LigAB). The enzyme is estimated to be a homodimer according to the Escherichia coli enzyme. Since enzymes in this subfamily have fused A and B subunits, the dimer interface may resemble the tetramer interface of classical LigAB enzymes. This enzyme belongs to the class III extradiol dioxygenase family, composed of enzymes which use a non-heme Fe(II) to cleave aromatic rings between a hydroxylated carbon and an adjacent non-hydroxylated carbon. Length = 94 Score = 25.9 bits (57), Expect = 3.4 Identities = 7/19 (36%), Positives = 15/19 (78%) Query: 59 LRRKSFLETVRYGVMYFML 77 +R + ++ +RYGV++F+L Sbjct: 45 IRNRDWIGMIRYGVIFFVL 63 >gnl|CDD|37513 KOG2302, KOG2302, KOG2302, T-type voltage-gated Ca2+ channel, pore-forming alpha1I subunit [Inorganic ion transport and metabolism, Signal transduction mechanisms]. Length = 1956 Score = 25.4 bits (55), Expect = 4.4 Identities = 15/47 (31%), Positives = 26/47 (55%), Gaps = 5/47 (10%) Query: 76 MLSILNYAFYVKLLLTFQGLQPLLATVLSAVSS-----MLFVFLLYI 117 ++ +L A +KLL G++ LL TV+ A+ +LF+ L +I Sbjct: 1540 IMRVLRIARVLKLLKMATGMRALLDTVVQALPQVGNLGLLFMLLFFI 1586 >gnl|CDD|33895 COG4139, BtuC, ABC-type cobalamin transport system, permease component [Coenzyme metabolism]. Length = 326 Score = 24.9 bits (54), Expect = 6.4 Identities = 12/38 (31%), Positives = 19/38 (50%) Query: 86 VKLLLTFQGLQPLLATVLSAVSSMLFVFLLYIRFMTRR 123 + +L QG P A L A++ L + L+ +RF R Sbjct: 102 IAAVLLGQGQLPNWALGLCAIAGALIITLILLRFARRH 139 Database: CddA Posted date: Feb 4, 2011 9:38 PM Number of letters in database: 6,263,737 Number of sequences in database: 21,609 Lambda K H 0.345 0.153 0.464 Gapped Lambda K H 0.267 0.0839 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 21609 Number of Hits to DB: 1,672,217 Number of extensions: 90515 Number of successful extensions: 850 Number of sequences better than 10.0: 1 Number of HSP's gapped: 831 Number of HSP's successfully gapped: 135 Length of query: 129 Length of database: 6,263,737 Length adjustment: 83 Effective length of query: 46 Effective length of database: 4,470,190 Effective search space: 205628740 Effective search space used: 205628740 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.5 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 38 (21.6 bits) S2: 52 (23.6 bits)