RPS-BLAST 2.2.22 [Sep-27-2009] Database: CddB 21,608 sequences; 5,994,473 total letters Searching..................................................done Query= gi|254780790|ref|YP_003065203.1| hypothetical protein CLIBASIA_03405 [Candidatus Liberibacter asiaticus str. psy62] (129 letters) >gnl|CDD|177477 PHA02695, PHA02695, hypothetical protein; Provisional. Length = 725 Score = 26.9 bits (59), Expect = 1.6 Identities = 15/40 (37%), Positives = 19/40 (47%), Gaps = 5/40 (12%) Query: 13 VVFFIDVMGFFILMKCGADPFYSRIFSIAVAFLVTWIPSR 52 VV F+D + L+ GADPF S F +WI R Sbjct: 367 VVDFLDTVPLRTLLAVGADPFASD-----YVFSTSWINDR 401 >gnl|CDD|181716 PRK09236, PRK09236, dihydroorotase; Reviewed. Length = 444 Score = 26.0 bits (58), Expect = 2.6 Identities = 11/20 (55%), Positives = 11/20 (55%) Query: 24 ILMKCGADPFYSRIFSIAVA 43 IL KCG PF R F VA Sbjct: 397 ILYKCGWSPFEGRTFRSRVA 416 >gnl|CDD|183120 PRK11404, PRK11404, putative PTS system transporter subunits IIBC; Provisional. Length = 482 Score = 26.0 bits (57), Expect = 2.9 Identities = 28/103 (27%), Positives = 46/103 (44%), Gaps = 12/103 (11%) Query: 15 FFIDVMGFFILMKCGADPFYSRIFSIAVAFLVTWIPSRLFIFLKLRRKSFLETVRYGVMY 74 F I +MG +I P + A AFLV ++ + + FL V G Sbjct: 186 FMIPIMGAYIASSIADKP------AFAPAFLVCYLANDKALLGTQSGAGFLGAVVLG--- 236 Query: 75 FMLSILNYAFYVKLLLTFQGLQPLLATVL-SAVSSMLFVFLLY 116 L+I + F+ + + + LQPLL ++L V+ ++F L Y Sbjct: 237 --LAIGYFVFWFRKVRLGKALQPLLGSMLIPFVTLLVFGVLTY 277 >gnl|CDD|183572 PRK12523, PRK12523, RNA polymerase sigma factor; Reviewed. Length = 172 Score = 25.6 bits (56), Expect = 3.7 Identities = 16/57 (28%), Positives = 27/57 (47%), Gaps = 8/57 (14%) Query: 62 KSFLETVRYGVM--YFMLSILNYAFYVKLLLTFQGLQP------LLATVLSAVSSML 110 ++FL V G+M +F + L A+ +L L + QP L+ L A+ +L Sbjct: 61 RAFLAAVAKGLMFDHFRRAALEQAYLAELALVPEAEQPSPEEQHLILEDLKAIDRLL 117 >gnl|CDD|184006 PRK13367, PRK13367, protocatechuate 4,5-dioxygenase; Provisional. Length = 420 Score = 25.5 bits (56), Expect = 4.3 Identities = 7/19 (36%), Positives = 13/19 (68%) Query: 59 LRRKSFLETVRYGVMYFML 77 +RR+ + + YGV +F+L Sbjct: 358 IRRRDWRGLIHYGVSFFLL 376 >gnl|CDD|115749 pfam07115, DUF1371, Protein of unknown function (DUF1371). This family consists of several hypothetical bacterial proteins of around 110 residues in length. The function of this family is unknown but members seem to be specific to Borrelia burgdorferi (Lyme disease spirochete). Length = 110 Score = 24.8 bits (54), Expect = 7.5 Identities = 15/38 (39%), Positives = 19/38 (50%), Gaps = 8/38 (21%) Query: 52 RLFIFLKLRRKSFLETVRYGVMYFMLSILNYAFYVKLL 89 RLFIFLK R S +G L+Y+ +KLL Sbjct: 29 RLFIFLKTLRGSLSYAPNWG--------LDYSLLLKLL 58 >gnl|CDD|152269 pfam11833, DUF3353, Protein of unknown function (DUF3353). This family of proteins are functionally uncharacterized. This protein is found in bacteria and eukaryotes. Proteins in this family are typically between 205 to 258 amino acids in length. Length = 193 Score = 24.5 bits (54), Expect = 8.0 Identities = 11/62 (17%), Positives = 27/62 (43%) Query: 53 LFIFLKLRRKSFLETVRYGVMYFMLSILNYAFYVKLLLTFQGLQPLLATVLSAVSSMLFV 112 FL + + F + + + ++ +L + LL F PL + ++ ++L + Sbjct: 127 CIYFLNRKGRRFGRALLWSLGGLVVGLLLGSLLAVLLPPFILPGPLSPEQIQSLFALLLL 186 Query: 113 FL 114 +L Sbjct: 187 WL 188 >gnl|CDD|181433 PRK08455, fliL, flagellar basal body-associated protein FliL; Reviewed. Length = 182 Score = 24.3 bits (53), Expect = 9.0 Identities = 7/28 (25%), Positives = 15/28 (53%) Query: 5 IIFIINIVVVFFIDVMGFFILMKCGADP 32 ++ II VVV + ++G ++ G+ Sbjct: 19 LLIIIIGVVVLLLLIVGVIAMLLMGSKE 46 >gnl|CDD|183943 PRK13279, arnT, 4-amino-4-deoxy-L-arabinose transferase; Provisional. Length = 552 Score = 24.5 bits (54), Expect = 9.2 Identities = 15/48 (31%), Positives = 25/48 (52%), Gaps = 4/48 (8%) Query: 37 IFSIAV-AFLVTWIPSRLFIFLKLRRKSFLETVRYGVMYFMLSILNYA 83 +FS + A LV W+ RL+ + RR + L + Y ++ + I YA Sbjct: 89 VFSTLLSALLVYWLALRLW---RDRRTALLAALIYLSLFLVYGIGTYA 133 Database: CddB Posted date: Feb 4, 2011 9:54 PM Number of letters in database: 5,994,473 Number of sequences in database: 21,608 Lambda K H 0.345 0.153 0.464 Gapped Lambda K H 0.267 0.0744 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 21608 Number of Hits to DB: 2,130,106 Number of extensions: 130811 Number of successful extensions: 811 Number of sequences better than 10.0: 1 Number of HSP's gapped: 804 Number of HSP's successfully gapped: 113 Length of query: 129 Length of database: 5,994,473 Length adjustment: 83 Effective length of query: 46 Effective length of database: 4,201,009 Effective search space: 193246414 Effective search space used: 193246414 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.5 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 38 (21.6 bits) S2: 51 (23.4 bits)