RPS-BLAST 2.2.22 [Sep-27-2009] Database: pdb70 24,244 sequences; 5,693,230 total letters Searching..................................................done Query= gi|254780790|ref|YP_003065203.1| hypothetical protein CLIBASIA_03405 [Candidatus Liberibacter asiaticus str. psy62] (129 letters) >2pff_B Fatty acid synthase subunit beta; fatty acid synthase, acyl-carrier-protein, beta-ketoacyl reductase, beta-ketoacyl synthase, dehydratase; 4.00A {Saccharomyces cerevisiae} Length = 2006 Score = 31.5 bits (71), Expect = 0.058 Identities = 6/31 (19%), Positives = 12/31 (38%), Gaps = 3/31 (9%) Query: 39 SIAVAFLVTWIPSRLFIFLKLRRKSFLETVR 69 S+ LV P+ F ++ F + + Sbjct: 15 SLEHVLLV---PTASFFIASQLQEQFNKILP 42 Score = 25.7 bits (56), Expect = 3.3 Identities = 8/38 (21%), Positives = 12/38 (31%), Gaps = 12/38 (31%) Query: 74 YFM-LSILNYAFYVKLLLTFQGLQPLLATVLSAVSSML 110 YF L L Y Y L+ ++ + L Sbjct: 169 YFEELRDL-YQTY----------HVLVGDLIKFSAETL 195 >3nyh_A Lactoperoxidase, LPO; bovine lactoperoxidase, oxidoreductase, bromide, chloride, I MPD, thiocyanate ION; HET: SEP HEM NAG MAN; 1.77A {Bos taurus} PDB: 2ips_A* 2nqx_A* 2pum_A* 2qpk_A* 2qqt_A* 2qrb_A* 2pt3_A* 3eri_A* 3gc1_A* 3gcj_A* 3gck_A* 3gcl_A* 3i6n_A* 3bxi_A* 3krq_A* 3erh_A* 3faq_A* 3fnl_A* 2z5z_A* 2o86_A* ... Length = 595 Score = 28.6 bits (63), Expect = 0.40 Identities = 16/119 (13%), Positives = 42/119 (35%), Gaps = 8/119 (6%) Query: 7 FIINIVVVFFIDVMGFFILMKCGADPFYSRIFSIAVAFLVTWIPSRLFIFLKLRRKSFLE 66 ++ ++ + + DP S +F+ A F +PS + + + E Sbjct: 312 YLPIVLGSEMQKWIPPYQGYNNSVDPRISNVFTFAFRFGHMEVPSTVSRLDENYQPWGPE 371 Query: 67 TVRYGVMYFMLSILNYAFYVKLLLTFQGLQPLLATVLSAVSSMLFVFLLYIRFMTRRVY 125 L + F ++ G+ PL+ +L+ S ++ + + +++ Sbjct: 372 AE--------LPLHTLFFNTWRIIKDGGIDPLVRGLLAKKSKLMNQDKMVTSELRNKLF 422 >3kp9_A Vkorc1/thioredoxin domain protein; warfarin, disulfide formation, blood coagulation, oxidoreductase, blood coagulation,oxidoreductase; HET: U10; 3.60A {Synechococcus SP} Length = 291 Score = 25.3 bits (55), Expect = 4.2 Identities = 7/92 (7%), Positives = 24/92 (26%), Gaps = 2/92 (2%) Query: 34 YSRIFSIAVAF--LVTWIPSRLFIFLKLRRKSFLETVRYGVMYFMLSILNYAFYVKLLLT 91 ++ I A L+ ++ L + + ++ + Y+ L+ Sbjct: 64 WAEFLGIPTAAVGLLGFLGVLALAVLPDGLPLVKRWRWPALFGLVSAMTAFEMYMLYLMV 123 Query: 92 FQGLQPLLATVLSAVSSMLFVFLLYIRFMTRR 123 Q + + + + + Sbjct: 124 AVLRQFCMYCTTAIILVAGLGLVTVLGHRWLD 155 >2gj1_A Lactoperoxidase, LPO; oxidoreductase, metal-binding protein; HET: NAG MAN HEM; 2.30A {Bos taurus} PDB: 3bxi_A* 2ips_A* 2nqx_A* 2pum_A* 2qpk_A* 2qqt_A* 2qrb_A* 2pt3_A* 3eri_A* 3gc1_A* 3gcj_A* 3gck_A* 3gcl_A* 3i6n_A* 3erh_A* 3faq_A* 2gjm_A* 3fnl_A* 2z5z_A* 2o86_A* ... Length = 583 Score = 24.7 bits (53), Expect = 6.2 Identities = 15/119 (12%), Positives = 42/119 (35%), Gaps = 8/119 (6%) Query: 7 FIINIVVVFFIDVMGFFILMKCGADPFYSRIFSIAVAFLVTWIPSRLFIFLKLRRKSFLE 66 ++ ++ + + DP S +F+ A F +PS + +++ Sbjct: 300 YLPIVLGSEMQKWIPPYQGYNNSVDPRISNVFTFAFRFGHMEVPS----TVSRLDENYQP 355 Query: 67 TVRYGVMYFMLSILNYAFYVKLLLTFQGLQPLLATVLSAVSSMLFVFLLYIRFMTRRVY 125 L + F ++ G+ PL+ +L+ S ++ + + +++ Sbjct: 356 WGPEAE----LPLHTLFFNTWRIIKDGGIDPLVRGLLAKKSKLMNQDKMVTSELRNKLF 410 Database: pdb70 Posted date: Jan 26, 2011 11:21 AM Number of letters in database: 5,693,230 Number of sequences in database: 24,244 Lambda K H 0.345 0.153 0.464 Gapped Lambda K H 0.267 0.0497 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 24244 Number of Hits to DB: 1,104,875 Number of extensions: 44649 Number of successful extensions: 198 Number of sequences better than 10.0: 1 Number of HSP's gapped: 198 Number of HSP's successfully gapped: 29 Length of query: 129 Length of database: 5,693,230 Length adjustment: 82 Effective length of query: 47 Effective length of database: 3,705,222 Effective search space: 174145434 Effective search space used: 174145434 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.5 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 38 (21.6 bits) S2: 51 (24.0 bits)