RPS-BLAST 2.2.22 [Sep-27-2009]

Database: scop70_1_75 
           13,730 sequences; 2,407,596 total letters

Searching..................................................done

Query= gi|254780790|ref|YP_003065203.1| hypothetical protein
CLIBASIA_03405 [Candidatus Liberibacter asiaticus str. psy62]
         (129 letters)



>d1wlga_ b.152.1.1 (A:) Flagellar hook protein flgE {Salmonella
          typhimurium [TaxId: 90371]}
          Length = 293

 Score = 24.5 bits (52), Expect = 3.0
 Identities = 8/16 (50%), Positives = 9/16 (56%)

Query: 21 GFFILMKCGADPFYSR 36
          GFF L+      FYSR
Sbjct: 10 GFFRLVDSNGSVFYSR 25


>d1mxaa3 d.130.1.1 (A:232-383) S-adenosylmethionine synthetase
           {Escherichia coli [TaxId: 562]}
          Length = 152

 Score = 22.9 bits (49), Expect = 8.3
 Identities = 10/41 (24%), Positives = 14/41 (34%)

Query: 31  DPFYSRIFSIAVAFLVTWIPSRLFIFLKLRRKSFLETVRYG 71
           +   S   ++ V       P  L   L L    + ET  YG
Sbjct: 87  EKVPSEQLTLLVREFFDLRPYGLIQMLDLLHPIYKETAAYG 127


  Database: scop70_1_75
    Posted date:  Mar 27, 2010  6:21 PM
  Number of letters in database: 2,407,596
  Number of sequences in database:  13,730
  
Lambda     K      H
   0.345    0.153    0.464 

Gapped
Lambda     K      H
   0.267   0.0522    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 13730
Number of Hits to DB: 483,793
Number of extensions: 19715
Number of successful extensions: 74
Number of sequences better than 10.0: 1
Number of HSP's gapped: 74
Number of HSP's successfully gapped: 11
Length of query: 129
Length of database: 2,407,596
Length adjustment: 76
Effective length of query: 53
Effective length of database: 1,364,116
Effective search space: 72298148
Effective search space used: 72298148
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 15 ( 7.5 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 38 (21.6 bits)
S2: 48 (22.7 bits)