HHsearch alignment for GI: 254780793 and conserved domain: PRK09575

>PRK09575 vmrA multidrug efflux pump VmrA; Reviewed.
Probab=100.00  E-value=0  Score=264.49  Aligned_cols=417  Identities=12%  Similarity=0.036  Sum_probs=338.4

Q ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCHHHHHH
Q ss_conf             36889999999999999999999999999577757899999999789999999757789999999999984489789999
Q gi|254780793|r    3 IIRNFLTVCASTLGSRFLGFIRETLVAATLGVGKVTDVFYVAFYLTFIFRRLAAEGIFHNSFIPLFSQEKENNGSESAQR   82 (518)
Q Consensus         3 ~~k~~~~~~~~~~~skilG~~r~~~~a~~~G~~~~~da~~~a~~i~~~~~~l~~~G~~~~a~ip~~~~~~~~~~~~~~~~   82 (518)
T Consensus        17 ~~~laiP~i~~~l~~~ly~ivD~~fvG~~~G~~alA-Av~~~~pi~~~~~~~~~--~lg~G~~~lis~~~G~~~~~~a~~   93 (456)
T PRK09575         17 FWRYTIPSIAAMLVNGLYQIVDGIFIGHYVGAEGLA-GINMAWPVIGIILGIGL--MVGMGTGSLLSIYRGEGDLQKAKT   93 (456)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCHHHHH-HHHHHHHHHHHHHHHHH--HHHHHHHHHHHHHHCCCCHHHHHH
T ss_conf             999999999999999999999999944726898999-99999999999999999--999999999999976999999999


Q ss_pred             HHHHHHHHHHHHHHHHHHHHHHHCCCCCCCCCCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCHHHHH
Q ss_conf             99999999999999999999996534344457887541011112456554443321246888765688998842227999
Q gi|254780793|r   83 LSSEIFSILILSLVVLTVVVELILPLLIRFIIAPGFADQSDKYFLTIQLSRVMFPSIIFISLASLVTGMLFALGRYFIAS  162 (518)
Q Consensus        83 ~~~~~~~~~~~~~~~l~~l~~~~~~~~~~~l~a~g~~~~~~~~~la~~~~~i~~p~~~~~~~~~~~~~~l~~~~~f~~~a  162 (518)
T Consensus        94 ~~~~~~~~~~~~~~i~~~~~~~~~~~il~~lga-----~~~v~~~a~~Yl~i~~~g~~~~~~~~~~~~~lra~G~~~~~~  168 (456)
T PRK09575         94 ILTTGLLLLLLLGPIVSIILWLFADDFLLAQGA-----EGRTLELGLQYIQVLTWGCLFTIGAIALPMLVRNDESPNLAT  168 (456)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCC-----CHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCHHH
T ss_conf             999999999999999999999999999988397-----899999999999999998899999999999998289983058


Q ss_pred             HHHHHHHCHHHHHHHHHHCCCCCCCCCCEEHHHHHHHHHHHHHCCCCCHHHCCCC--CCCCC-CCCCCCCCCHHHHHHHH
Q ss_conf             9998540103467777623568654432000122111011100023101210365--44456-77543241000134688
Q gi|254780793|r  163 IAPIVINVFPIFALTYALWHPSSPQETTYLLAWGVFLSNVVHFWIVYCCAKNDGV--KLRFQ-YPRLTHNVKFFLKLTFP  239 (518)
Q Consensus       163 ~~~vi~ni~~i~~~~~~~~~~~~~~~~~~~~a~~~~~g~~~~~~~~~~~~~~~~~--~~~~~-~~~~~~~~k~~l~~~~p  239 (518)
T Consensus       169 ~~~i~~~i~NiiLd~lfI---~~~~lGv~GAAlATvisq~i~~~~~l~~~~~~~~~l~~~~~~~~~~~~~~~~i~~iG~p  245 (456)
T PRK09575        169 GLMVLGALINIVLDYLFI---GVLDWGLTGAAIATALAQLVVTILGLGYFFSSRANIKLSLKELLFNWSLAPQIVLLGSS  245 (456)
T ss_pred             HHHHHHHHHHHHHHHHHH---CCCCCCCCHHHHHHHHHHHHHHHHHHHHHHCCCCCEEEEHHHCCCCHHHHHHHHHHHHH
T ss_conf             999997788998999997---20899864499999999999999999999906861475376311569999999998479


Q ss_pred             HHHHHHHCCCHHH-HHCCCCCCCCC-CHHHHHHHHHHHHCCCCCCCCCCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHCC
Q ss_conf             8764320120233-32025565566-305777753321100000011123221002344443322367899989754113
Q gi|254780793|r  240 LMVTGGIIQISNI-VGRAIASRETG-IISAIQYAERIYSLPVGVIGGAMMIVILPALSRSLRSKNKQKSFELQNQAIECI  317 (518)
Q Consensus       240 ~~l~~~~~~i~~~-i~~~~as~~~g-~vs~~~~a~~l~~l~~~i~~~ai~~~~~P~ls~~~~~~d~~~~~~~~~~~~~~~  317 (518)
T Consensus       246 ~~i~~~~~s~~~~~~n~~~~~~g~~~~vAa~~i~~~i~~~~~-~~~~Gl~~a~~~lvg~n~GA~~~~rv~~~~~~~~~~~  324 (456)
T PRK09575        246 SFFMYLYGSFVVALHNRLFMEYGSSLTVGAFAIVGYLMVLYY-LVAEGIAEGMQPPVSYYFGARQYDNIKKLLKLAMKVS  324 (456)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHCCHHHHHHHHHHHHHHHHHH-HHHHHHHHHHHHHHHHHHCCCCHHHHHHHHHHHHHHH
T ss_conf             999999999999999999999776999999999999999999-9999998878999999856998899999999999999


Q ss_pred             CCCHHHHHHHHHHCCCCCCCHHHHCCCCCHHHHHHHHHHHHHHHCHHHHHHHHCCCCHHHHHHHHHHHHHHHHHHHHHHH
Q ss_conf             44215899999852572311121047864455456666555420105677531232023544331013467778886899
Q gi|254780793|r  318 SFFGIPSAVALFMLSKEIVQTLYE