HHsearch results for GI: 254780793 and protein with PDBid: 3mkt_A

>3mkt_A Multi antimicrobial extrusion protein (Na(+)/drug antiporter) MATE-like MDR efflux...; multidrug transporter, cation-bound, transport protein; 3.65A {Vibrio cholerae} PDB: 3mku_A
Probab=99.90  E-value=8.1e-23  Score=135.82  Aligned_cols=241  Identities=14%  Similarity=0.214  Sum_probs=189.1

Q ss_pred             CCCCCCCCHHHHHHHHHHHHHHHCCCHHHHHCCCCC-CCCCCHHHHHHHHHHHHCCCCCCCCCCCCCCCHHHHHHHHHHH
Q ss_conf             754324100013468887643201202333202556-5566305777753321100000011123221002344443322
Q gi|254780793|r  224 PRLTHNVKFFLKLTFPLMVTGGIIQISNIVGRAIAS-RETGIISAIQYAERIYSLPVGVIGGAMMIVILPALSRSLRSKN  302 (518)
Q Consensus       224 ~~~~~~~k~~l~~~~p~~l~~~~~~i~~~i~~~~as-~~~g~vs~~~~a~~l~~l~~~i~~~ai~~~~~P~ls~~~~~~d  302 (518)
                      ++.+++.|++++.+.|.++++...++..++|+.+.+ .++.+.++.+.+..+..+.. .+...++...-+.+||.+++||
T Consensus         5 ~~~~~~~k~l~~la~P~~~~~l~~~~~~~vD~~~vg~lg~~~laav~~~~~i~~~~~-~~~~gl~~g~~~lvaq~~G~~~   83 (460)
T 3mkt_A            5 HRYKKEASNLIKLATPVLIASVAQTGMGFVDTIMAGGVSAIDMAAVSIAASIWLPSI-LFGVGLLMALVPVVAQLNGAGR   83 (460)
T ss_dssp             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHTHHHHTTTTSSHHHHHHHHHHHHH-HHHHHHHHHHGGGCTTTTSSSS
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCHHHHHHHHHHHHHHHHHH-HHHHHHHHHHHHHHHHHHCCCC
T ss_conf             799999999999999999999999999999999987528899999999999999999-9999999999999999973999


Q ss_pred             HHHHHHHHHHHHHCCCCCHHHHHHHHHHCCCCCCCHHHHCCCCCHHHHHHHHHHHHHHHCHHHHHHHHCCCCHHHHHHHH
Q ss_conf             36789998975411344215899999852572311121047864455456666555420105677531232023544331
Q gi|254780793|r  303 KQKSFELQNQAIECISFFGIPSAVALFMLSKEIVQTLYERGAFSSQNTILVSSFLSIYSIGILANILSKSLSTAFYAQND  382 (518)
Q Consensus       303 ~~~~~~~~~~~~~~~~~i~~p~~~~l~~~~~~ii~llf~~g~F~~~~~~~~~~~L~~~~~~~~~~~~~~i~~~~~~a~g~  382 (518)
                      +++.++...+++.....++++..+.+. ..+++..++ +   .+++....+...+.+..+++++..+.......+++.||
T Consensus        84 ~~~~~~~~~~~l~~~~~~~i~~~~~~~-~~~~i~~~~-~---~~~~~~~~a~~Y~~~~~~~~~~~~~~~~~~~~l~~~g~  158 (460)
T 3mkt_A           84 QHKIPFEVHQGLILALLVSVPIIAVLF-QTQFIIRFM-D---VEEAMATKTVGYMHAVIFAVPAYLLFQALRSFTDGMSL  158 (460)
T ss_dssp             TTTHHHHHHHHHHHHHHHHHHHHHHHH-HHHTTCSSC-S---STTHHHHHHHHHHTTGGGHHHHHHHHHHHTTTTCTTSC
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHH-HHHHHHHHH-C---CCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCC
T ss_conf             899999999999999999998889986-699999996-2---53999999876403010013126788998765204545


Q ss_pred             HHHHHHHHHHHHHHHHHHHHHHCC------CCCCCHHHHHHHHHHHHHHHHHHHHHHHHC----------CCCCCHHHHH
Q ss_conf             013467778886899999875202------112004999999999999999999999711----------5788988999
Q gi|254780793|r  383 MKAPMKFTIVSIAINLTIAIGSFP------FIGGYGIALAEVSSSWVNTICLAITLLKRK----------QINLPFKTIY  446 (518)
Q Consensus       383 ~~~~~~~~~~~~~vni~l~~~li~------~~G~~G~a~at~i~~~~~~~~~~~~l~k~~----------~~~~~~~~~~  446 (518)
                      +|.+++.++.+.++|+.+|+.++.      ..|..|.++|+.++.+...........++.          ..+..++..+
T Consensus       159 ~~~~~~~~i~~~i~ni~l~~~li~g~~~~~~~~~~G~a~a~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  238 (460)
T 3mkt_A          159 TKPAMVIGFIGLLLNIPLNWIFVYGKFGAPELGGVGCGVATAIVYWIMLLLLLFYIVTSKRLAHVKVFETFHKPQPKELI  238 (460)
T ss_dssp             CTTTHHHHHHHHHHHHHHHHHHHSCCTTCCCCHHHHHHHHHHHHHHHHHHHHHHHHHTCSSCCCCCCSCCCCSSTTSSTT
T ss_pred             CCHHHHHHHHCCCCEEECCCCEEECCCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCHHHHHHHCCCHHHHHHH
T ss_conf             53157643211332122144101146556651078999998888999854467775530011111210210221456654


Q ss_pred             HHHHHHHHHHHHHHHHHHHHHHHH
Q ss_conf             999999999999999999999865
Q gi|254780793|r  447 RILSVSISAGLMGFFIILFRPYFN  470 (518)
Q Consensus       447 ~~~~~~~~~~im~~~~~~~~~~~~  470 (518)
                      +..+..++..+.............
T Consensus       239 ~~~~~~~p~~~~~~~~~~~~~~~~  262 (460)
T 3mkt_A          239 RLFRLGFPVAAALFFEVTLFAVVA  262 (460)
T ss_dssp             TSHHHHHHHHHHHHHHHHHHHHHH
T ss_pred             HCCCCCCCHHHHHHHHHHHHHHHH
T ss_conf             213357827889999999999999