BLAST/PSIBLAST alignment of GI: 254780793 and GI: 241202798 at iteration 1
>gi|241202798|ref|YP_002973894.1| integral membrane protein MviN [Rhizobium leguminosarum bv. trifolii WSM1325] Length = 526
>gi|240856688|gb|ACS54355.1| integral membrane protein MviN [Rhizobium leguminosarum bv. trifolii WSM1325] Length = 526
 Score =  429 bits (1104), Expect = e-118,   Method: Compositional matrix adjust.
 Identities = 223/519 (42%), Positives = 345/519 (66%), Gaps = 6/519 (1%)

Query: 1   MKIIRNFLTVCASTLGSRFLGFIRETLVAATLGVGKVTDVFYVAFYLTFIFRRLAAEGIF 60
           M +++ F TV  +TLGSR  GF RETL+AA LG G + DVFY AF    +FRRL AEG F
Sbjct: 1   MSLVKKFATVGGATLGSRIFGFARETLMAAALGTGPMADVFYAAFRFPNLFRRLFAEGAF 60

Query: 61  HNSFIPLFSQEKENNGSESAQRLSSEIFSILILSLVVLTVVVELILPLLIRFIIAPGFAD 120
           + +F+PLF++E E NG++ A+R S E+F +L   L+++T+V+EL +PLL+RF+IAPGFAD
Sbjct: 61  NAAFVPLFAKEIEANGTDGAKRFSEEVFGVLFSVLLLITIVMELAMPLLVRFVIAPGFAD 120

Query: 121 QSDKYFLTIQLSRVMFPSIIFISLASLVTGMLFALGRYFIASIAPIVINVFPIFALTYAL 180
             +K+ +TI+++ VMFP ++ +SL ++++GML +L  +F A+IAP+ +NV  I AL YAL
Sbjct: 121 DPEKFSITIRMAAVMFPYLMCMSLTAMMSGMLNSLHHFFAAAIAPVFLNVVMIGALFYAL 180

Query: 181 WHPSSPQETTYLLAWGVFLSNVVHFWIVYCCAKNDGVKLRFQYPRLTHNVKFFLKLTFPL 240
           +  + P  T + L+WGV  + V+   +VY      G+ + F++P++T NVK  L L  P 
Sbjct: 181 YTGADPLATAWYLSWGVLAAGVLQLAVVYVGVLAAGMSIGFRFPKMTPNVKRLLILAVPA 240

Query: 241 MVTGGIIQISNIVGRAIASRETGIISAIQYAERIYSLPVGVIGGAMMIVILPALSRSLRS 300
            VTGGI QI+ ++G+AIAS   G I+A+QYA+RIY LP+GV+G A+ +V+LP L+R+L+ 
Sbjct: 241 AVTGGITQINQLIGQAIASSRDGAIAALQYADRIYQLPLGVVGVAVGVVLLPELARALKG 300

Query: 301 KNKQKSFELQNQAIECISFFGIPSAVALFMLSKEIVQTLYERGAFSSQNTILVSSFLSIY 360
            N +++  LQN++IE + F  IP+A AL++LS EI++ LYERGAF  +NT +V S L+IY
Sbjct: 301 GNLREAGNLQNRSIEFVLFLTIPAAFALWILSDEIIRVLYERGAFHQENTAVVGSILAIY 360

Query: 361 SIGILANILSKSLSTAFYAQNDMKAPMKFTIVSIAINLTIAIGSFPFIGGYGIALAEVSS 420
            IG+ A +L K+L   FYA+ D K PM+F+ +++A N   A+  FP++G  GIA+AE ++
Sbjct: 361 GIGLPAFVLIKALQPGFYAREDTKTPMRFSAIAVATNCATALTLFPYMGAPGIAVAEATA 420

Query: 421 SWVNTICLAITLLKRKQINLPFKTIYRILSVSISAGLMGFFIILFRPYFN-QFSSATTFF 479
            W++T+ L  TLL+R  +   +    R   + ++A +MG  I+  + Y+    +S     
Sbjct: 421 GWISTVLLFATLLRRGHLTWEWALAKRTALLIVAAAVMGAAIVFLKQYWAPSLASGAPLL 480

Query: 480 DPFKNLVIMLSGAMLVYLFSIFLFLGKDFLSPLQQMIRK 518
                L ++++ AML+Y  + FL  G +       MIR+
Sbjct: 481 TKIGTLGLLIAIAMLIYFAAAFLVGGANL-----GMIRR 514