BLAST/PSIBLAST alignment of GI: 254780793 and GI: 315122015 at iteration 1
>gi|315122015|ref|YP_004062504.1| integral membrane protein MviN [Candidatus Liberibacter solanacearum CLso-ZC1] Length = 519
>gi|313495417|gb|ADR52016.1| integral membrane protein MviN [Candidatus Liberibacter solanacearum CLso-ZC1] Length = 519
 Score =  600 bits (1546), Expect = e-169,   Method: Compositional matrix adjust.
 Identities = 317/519 (61%), Positives = 413/519 (79%), Gaps = 1/519 (0%)

Query: 1   MKIIRNFLTVCASTLGSRFLGFIRETLVAATLGVGKVTDVFYVAFYLTFIFRRLAAEGIF 60
           MKIIRNF TV  S LGSR LGFIRETL+A+TLG+G VTD F +AF L F+FRRL AEG F
Sbjct: 1   MKIIRNFFTVGTSILGSRILGFIRETLMASTLGIGAVTDAFVIAFSLPFLFRRLVAEGAF 60

Query: 61  HNSFIPLFSQEKENNGSESAQRLSSEIFSILILSLVVLTVVVELILPLLIRFIIAPGFAD 120
           HNSF+PLFS EKE NG+E AQRLSSEI+S+L+  +VVLT+VVEL LPLLI F+IAPGF+ 
Sbjct: 61  HNSFVPLFSHEKELNGTEGAQRLSSEIWSVLLTIVVVLTIVVELSLPLLIHFVIAPGFSY 120

Query: 121 QSDKYFLTIQLSRVMFPSIIFISLASLVTGMLFALGRYFIASIAPIVINVFPIFALTYAL 180
           QS +Y+LTIQLS+++FPSIIFI+L +L+TG L+ALG YF+ASI P+ +N+  I  LTYAL
Sbjct: 121 QSPEYYLTIQLSQIIFPSIIFIALTALITGALYALGHYFVASITPVFLNIPSIIVLTYAL 180

Query: 181 WHPSSPQETTYLLAWGVFLSNVVHFWIVYCCAKNDGVKLRFQYPRLTHNVKFFLKLTFPL 240
            + S PQ+T Y ++ G+ L++++  W  Y   +  G+K+RFQYPRLT NV+ FLKLTFPL
Sbjct: 181 LNNSKPQDTVYFISCGMTLASIIQLWATYYYIRRSGIKIRFQYPRLTDNVRKFLKLTFPL 240

Query: 241 MVTGGIIQISNIVGRAIASRETGIISAIQYAERIYSLPVGVIGGAMMIVILPALSRSLRS 300
           + TG IIQI++I+GRA+A++E G+ SA+QYA+R Y LP+ +IG AM +V+LP LSR+L+S
Sbjct: 241 IFTGTIIQINSIIGRALATKEFGLASALQYADRTYQLPIAIIGVAMGLVVLPELSRALKS 300

Query: 301 KNKQKSFELQNQAIECISFFGIPSAVALFMLSKEIVQTLYERGAFSSQNTILVSSFLSIY 360
           K+K  +F LQNQAIEC+ F  IP+ + L++LSKEI+QTLYERGAF+ +NTI VSS +SIY
Sbjct: 301 KDKSTTFTLQNQAIECVLFLSIPAFIILYILSKEIIQTLYERGAFTHENTIFVSSIISIY 360

Query: 361 SIGILANILSKSLSTAFYAQNDMKAPMKFTIVSIAINLTIAIGSFPFIGGYGIALAEVSS 420
           SIGI+A ILSK+L T FYA+ +MK PM FT++SIA++  I+I SFPFIGGYGIA AEV+S
Sbjct: 361 SIGIIAFILSKTLQTIFYARKNMKTPMHFTLISIAVSCVISIVSFPFIGGYGIACAEVAS 420

Query: 421 SWVNTICLAITLLKRKQINLPFKTIYRILSVSISAGLMGFFIILFRPY-FNQFSSATTFF 479
            WVN I L +TLL+RKQ+ LP +TIYRILS+ IS+GLMG FIIL +PY F+  +   TF 
Sbjct: 421 GWVNAILLTVTLLRRKQLFLPMETIYRILSIFISSGLMGAFIILSKPYFFSNIAIEQTFV 480

Query: 480 DPFKNLVIMLSGAMLVYLFSIFLFLGKDFLSPLQQMIRK 518
             F +L  +LS A+LVYL SI LF+GK ++S  ++M++K
Sbjct: 481 SQFTSLFAILSCAVLVYLSSIALFIGKKYVSSFKKMMKK 519