RPSBLAST alignment for GI: 254780793 and conserved domain: COG2244

>gnl|CDD|32425 COG2244, RfbX, Membrane protein involved in the export of O-antigen and teichoic acid [General function prediction only]. Length = 480
 Score = 44.3 bits (104), Expect = 7e-05
 Identities = 76/504 (15%), Positives = 185/504 (36%), Gaps = 30/504 (5%)

Query: 1   MKIIRNFLTVCASTLGSRFLGFIRETLVAATLGVGKVTDVFYVAFYLTFIFRRLAAEGIF 60
            K+I+  L +   TL S  LG I   L+A  LG        Y           + A+   
Sbjct: 6   KKLIKGALWLLLGTLISALLGLITIPLLARLLGPEGFG--LYALALAIIGLFSILADFGL 63

Query: 61  HNSFIPLFSQEKENNGSESAQRLSSEIFSILILSLVVLTVVVELILPLLIRFIIAPGFAD 120
             +     ++ +E         LS  +  +L L L++L +++  +L  +   +       
Sbjct: 64  PAAITREIAEYREKGEYLLLILLSVLLLLLLALILLLLLLLIAYLLAPIDPVLALL---- 119

Query: 121 QSDKYFLTIQLSRVMFPSIIFISLASLVTGMLFALGRYFIASIAPIVINVFPIFALTYAL 180
                       R++  +++ + L+S++ G+    GR+   +++ +              
Sbjct: 120 -----------LRILSLALLLLPLSSVLRGLFQGFGRFGPLALSIVSSIFLLAAVFALLF 168

Query: 181 WHPSSPQETTYLLAWGVFLSNVVHFWIVYCCAKNDGVKLRFQYPRLTHNVKFFLKLTFPL 240
                     + L  G  +S +V   ++    +      R         +K  L+   PL
Sbjct: 169 AALGL---AVWALVLGAVVSLLVLLILLGKKKRG---LKRPILRFSLALLKELLRFGLPL 222

Query: 241 MVTGGIIQISNIVGRAIASRETGIISAIQY-AERIYSLPVGVIGGAMMIVILPALSRSLR 299
           +++  +  +   +   +     G      Y A +     + ++  A+  V+ PALSR+  
Sbjct: 223 LLSSLLNFLFTNIDTLLLGLFLGPAQVGIYSAAQRLVSLLLIVASALNRVLFPALSRAYA 282

Query: 300 SKNKQKSFELQNQAIECISFFGIPSAVALFMLSKEIVQTLYERGAFSSQNTILVSSFLSI 359
             +++   +L  Q+++ +    IP+ + L +L+  I+  L+       +     +  L +
Sbjct: 283 EGDRKALKKLLRQSLKLLLLISIPALLGLLLLAPPIITLLF------GEKYASAAPILQL 336

Query: 360 YSIGILANILSKSLSTAFYAQNDMKAPMKFTIVSIAINLTIAIGSFPFIGGYGIALAEVS 419
            ++  L   L    S+   A    +  +  +++S  +NL + +   P  G  G A+A  S
Sbjct: 337 LALAGLFLSLVSLTSSLLQALGKQRLLLLISLISALLNLILNLLLIPRFGLIGAAIATAS 396

Query: 420 SSWVNTICLAITLLKRKQINLPFKTIYRILSVSISAGLMGFFIILFRPYFNQFSSATTFF 479
              +  +   I  L+  +    +  + ++ ++++    +   + L               
Sbjct: 397 VIALALLLFYILRLRLVRTKFSYFLLLKLAALALLLLAILGLLELLVALLLLLLVLLALG 456

Query: 480 DPFKNLVIMLSGAMLVYLFSIFLF 503
                L+++++  +++ L  + L 
Sbjct: 457 ILLFLLLLLIALVLILLLRLLLLK 480