>cd00814 MetRS_core This is the catalytic core domain of methionine tRNA synthetase (MetRS). This class I enzyme aminoacylates the 2'-OH of the nucleotide at the 3' of the appropriate tRNA. MetRS, which consists of the core domain and a anti-codon binding domain functions as a monomer. However, in some species, the anti-codon binding domain is followed by an EMAP domain. In this case, MetRS functions as a homodimer. The core domain is based on the Rossman fold and is responsible for the ATP-dependent formation of the enzyme bound aminoacyl-adenylate. It contains the characteristic class I HIGH and KMSKS motifs, which are involved in ATP binding. As a result of a deletion event, MetRS has a significantly shorter core domain insertion that IleRS, ValRS, and LeuR. Consequently, the MetRS insertion lacks the editing function.

Probab=96.50 E-value=0.039 Score=34.43 Aligned_cols=86 Identities=17% Similarity=0.292 Sum_probs=51.1 Q ss_pred CEEEEEECCC--CCCCHHHHHHHHH--HHHHHHHHCCCCEEEEEEEH--HH-------HCCCCCHHHHH-HHHHHHHHHH Q ss_conf 8789601589--6781055798899--99999850599589997311--57-------30789858999-9999999999 Q gi|254780794|r 6 NLFVSGVQPT--GVLHLGNYLGMIR--NVIRRQETCNHLGMYFIADL--HA-------ITNNIVQENLR-YQSRLFVASF 71 (355) Q Consensus 6 ~~vltG~~Pt--G~~HLG~y~g~i~--~~i~lq~~~~~~~~~~IAD~--ha-------lt~~~~~~~~~-~~~~~~~~~~ 71 (355) T Consensus 1 ~~~v~~~~Ptv~g~lHiGHar~~v~~Dil~R~lr~~G~~V~~-vt~~Dd~~~kIi~kA~~~g~~~~el~~~y~~~~~~~~ 79 (319) T cd00814 1 KVLITTALPYVNGVPHLGHLYGTVLADVFARYQRLRGYDVLF-VTGTDEHGTKIEQKAEEEGVTPQELCDKYHEIFKELF 79 (319) T ss_pred CEEEECCCCCCCCCCCCCCCHHHHHHHHHHHHHHHCCCCEEE-ECCCCCCCHHHHHHHHHCCCCHHHHHHHHHHHHHHHH T ss_conf 989968998788985533068899999999999965995699-6877787089999999839987999999999999999 Q ss_pred HHCCCCCCCCEEEECCCHHHHHHH Q ss_conf 962868111236524740788999 Q gi|254780794|r 72 LAAGVDPSRNIIFKQSDVGYHADL 95 (355) Q Consensus 72 lA~Gldp~k~~if~QS~v~e~~eL 95 (355) T Consensus 80 ~~L~I~~d~---~~r~~~~~~~~~ 100 (319) T cd00814 80 KWLNISFDY---FGRTTSPRHKEI 100 (319) T ss_pred HHCCCCCCC---CCCCCCHHHHHH T ss_conf 984998786---766788068999

HHsearch alignment for GI: 254780794 and conserved domain: cd00814