>cd05043 PTK_Ryk Pseudokinase Domain of the Receptor related to tyrosine kinase. Protein Tyrosine Kinase (PTK) family; Receptor related to tyrosine kinase (Ryk); pseudokinase domain. The PTKc (catalytic domain) family to which this subfamily belongs, is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. Ryk is a receptor tyr kinase (RTK) containing an extracellular region with two leucine-rich motifs, a transmembrane segment, and an intracellular inactive pseudokinase domain. The extracellular region of Ryk shows homology to the N-terminal domain of Wnt inhibitory factor-1 (WIF) and serves as the ligand (Wnt) binding domain of Ryk. Ryk is expressed in many different tissues both during development and in adults, suggesting a widespread function. It ac

Probab=93.39  E-value=0.062  Score=32.13  Aligned_cols=30  Identities=23%  Similarity=0.335  Sum_probs=25.1

Q ss_pred             CCEEECCCCCCCEEECCCCCEEEECCCCCC
Q ss_conf             744402234642256279604873162135
Q gi|254780795|r  184 TGIIHADLFPDNVLFYNNKIMGLIDFYFSC  213 (316)
Q Consensus       184 ~g~IHgDl~~~NiL~~~~~i~giIDF~~~~  213 (316)
T Consensus       136 ~~ivHRDLK~~NiLl~~~~~vKi~DFGla~  165 (280)
T cd05043         136 RGVIHKDIAARNCVIDEELQVKITDNALSR  165 (280)
T ss_pred             CCEECCCCCCCCEEECCCCCEEEEECCCCE
T ss_conf             993545125031699899978993054664