HHsearch alignment for GI: 254780795 and conserved domain: cd05087

>cd05087 PTKc_Aatyk1_Aatyk3 Catalytic Domain of the Protein Tyrosine Kinases, Apoptosis-associated tyrosine kinases 1 and 3. Protein Tyrosine Kinase (PTK) family; Apoptosis-associated tyrosine kinase 1 (Aatyk1) and Aatyk3; catalytic (c) domain. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. Aatyk1 and Aatyk3 are members of the Aatyk subfamily of proteins. Aatyk3 is a receptor kinase containing a transmembrane segment and a long C-terminal cytoplasmic tail with a catalytic domain. Aatyk1 has a similar domain arrangement but without the transmembrane segment and is thus, a cytoplasmic (or nonreceptor) kinase. The expression of Aatyk1 (also referred simply as Aatyk) is upregulated during growth arrest and apoptosis in myeloid cells
Probab=94.58  E-value=0.38  Score=27.04  Aligned_cols=30  Identities=23%  Similarity=0.326  Sum_probs=25.1

Q ss_pred             CCEEECCCCCCCEEECCCCCEEEECCCCCC
Q ss_conf             744402234642256279604873162135
Q gi|254780795|r  184 TGIIHADLFPDNVLFYNNKIMGLIDFYFSC  213 (316)
Q Consensus       184 ~g~IHgDl~~~NiL~~~~~i~giIDF~~~~  213 (316)
T Consensus       119 ~~iiHrDLK~~NiLl~~~~~vKl~DFGls~  148 (269)
T cd05087         119 HNYVHSDLALRNCLLTSDLTVKIGDYGLSH  148 (269)
T ss_pred             CCCCCCCCCCCCEEECCCCCEEEEECCCCC
T ss_conf             995646455030658689838995557875