HHsearch alignment for GI: 254780795 and conserved domain: cd05097

>cd05097 PTKc_DDR_like Catalytic Domain of Discoidin Domain Receptor-like Protein Tyrosine Kinases. Protein Tyrosine Kinase (PTK) family; Discoidin domain receptor (DDR)-like proteins; catalytic (c) domain. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. DDR-like proteins are members of the DDR subfamily, which are receptor tyr kinases (RTKs) containing an extracellular discoidin homology domain, a transmembrane segment, an extended juxtamembrane region, and an intracellular catalytic domain. The binding of the ligand, collagen, to DDRs results in a slow but sustained receptor activation. DDRs regulate cell adhesion, proliferation, and extracellular matrix remodeling. They have been linked to a variety of human cancers including
Probab=94.63  E-value=0.37  Score=27.13  Aligned_cols=30  Identities=30%  Similarity=0.376  Sum_probs=25.4

Q ss_pred             CCEEECCCCCCCEEECCCCCEEEECCCCCC
Q ss_conf             744402234642256279604873162135
Q gi|254780795|r  184 TGIIHADLFPDNVLFYNNKIMGLIDFYFSC  213 (316)
Q Consensus       184 ~g~IHgDl~~~NiL~~~~~i~giIDF~~~~  213 (316)
T Consensus       148 ~~iiHrDLK~~NiLl~~~~~~Ki~DFGlar  177 (295)
T cd05097         148 LNFVHRDLATRNCLVGNHYTIKIADFGMSR  177 (295)
T ss_pred             CCEECCCCCCCEEEECCCCCEEEEECCCCC
T ss_conf             985526667040888899978996442552