>cd05099 PTKc_FGFR4 Catalytic Domain of the Protein Tyrosine Kinase, Fibroblast Growth Factor Receptor 4. Protein Tyrosine Kinase (PTK) family; Fibroblast Growth Factor Receptor 4 (FGFR4); catalytic (c) domain. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. FGFR4 is part of the FGFR subfamily, which are receptor tyr kinases (RTKs) containing an extracellular ligand-binding region with three immunoglobulin-like domains, a transmembrane segment, and an intracellular catalytic domain. The binding of FGFRs to their ligands, the FGFs, results in receptor dimerization and activation, and intracellular signaling. The binding of FGFs to FGFRs is promiscuous, in that a receptor may be activated by several ligands and a ligand may bind to

Probab=94.47  E-value=0.4  Score=26.88  Aligned_cols=30  Identities=33%  Similarity=0.486  Sum_probs=25.3

Q ss_pred             CCEEECCCCCCCEEECCCCCEEEECCCCCC
Q ss_conf             744402234642256279604873162135
Q gi|254780795|r  184 TGIIHADLFPDNVLFYNNKIMGLIDFYFSC  213 (316)
Q Consensus       184 ~g~IHgDl~~~NiL~~~~~i~giIDF~~~~  213 (316)
T Consensus       153 ~~iiHRDLK~~NILl~~~~~~Ki~DFGlar  182 (314)
T cd05099         153 RRCIHRDLAARNVLVTEDNVMKIADFGLAR  182 (314)
T ss_pred             CCCCCCCCCHHHEEECCCCCEEEEECCCCC
T ss_conf             899688767221628799958980242445