>cd05167 PI4Kc_III_alpha Phosphoinositide 4-kinase (PI4K), Type III, alpha isoform, catalytic domain; The PI4K catalytic domain family is part of a larger superfamily that includes the catalytic domains of other kinases such as the typical serine/threonine/tyrosine protein kinases (PKs), aminoglycoside phosphotransferase, choline kinase, and RIO kinases. PI4Ks catalyze the transfer of the gamma-phosphoryl group from ATP to the 4-hydroxyl of the inositol ring of D-myo-phosphatidylinositol (PtdIns) to generate PtdIns(4)P, the major precursor in the synthesis of other phosphoinositides including PtdIns(4,5)P2, PtdIns(3,4)P2, and PtdIns(3,4,5)P3. Two isoforms of type III PI4K, alpha and beta, exist in most eukaryotes. PI4KIIIalpha is a 220 kDa protein found in the plasma membrane and the endoplasmic reticulum (ER). The role of PI4KIIIalpha in the ER remains unclear. In the plasma membrane, it provides PtdIns(4)P, which is then converted by PI5Ks to PtdIns(4,5)P2, an important signaling mole

Probab=90.93 E-value=1.2 Score=23.69 Aligned_cols=74 Identities=14% Similarity=0.165 Sum_probs=38.4 Q ss_pred EECCCCCCCEEECC-CCCEEEECCCCCCC-CH---HHCCHH-----HHHHHHHHCCCCCCCHH---HHH-HHHHHHHHCC Q ss_conf 40223464225627-96048731621356-80---001989-----99986431168887878---899-9998876418 Q gi|254780795|r 187 IHADLFPDNVLFYN-NKIMGLIDFYFSCN-DF---LMYDLS-----ICINAWCFDENNTYNPS---RGF-SILNGYNKVR 252 (316) Q Consensus 187 IHgDl~~~NiL~~~-~~i~giIDF~~~~~-~~---~i~DLA-----i~i~~~c~~~~~~~d~~---~~~-~~l~gY~~vr 252 (316) T Consensus 163 gIgDRHndNIml~~~Ghlf-HIDFGfil~~~pg~~~k~E~aPFkLt~emv~v-m--GG~~~s~~f~~F~~lc~~af~~lR 238 (311) T cd05167 163 QIKDRHNGNIMIDDDGHII-HIDFGFIFEISPGGNLKFESAPFKLTKEMVQI-M--GGSMEATPFKWFVELCVRAFLAVR 238 (311) T ss_pred CCCCCCCCCEEECCCCCEE-EEEHHHHHCCCCCCCCCCCCCCEECCHHHHHH-H--CCCCCCHHHHHHHHHHHHHHHHHH T ss_conf 1566578844598999799-97405540567788888688984337999998-6--899776789999999999999999 Q ss_pred CCCHHHHHHHHH Q ss_conf 899899999999 Q gi|254780795|r 253 KISENELQSLPT 264 (316) Q Consensus 253 pLs~~E~~~l~~ 264 (316) T Consensus 239 k~~~~ii~L~~l 250 (311) T cd05167 239 PYMDEIVSLVEL 250 (311) T ss_pred HHHHHHHHHHHH T ss_conf 989999999999

HHsearch alignment for GI: 254780795 and conserved domain: cd05167