HHsearch alignment for GI: 254780795 and conserved domain: cd07857

>cd07857 STKc_MPK1 The catalytic domain of the Serine/Threonine Kinase, Fungal Mitogen-Activated Protein Kinase MPK1 subfamily. Serine/Threonine Kinases (STKs), Fungal Mitogen-Activated Protein Kinase (MAPK) MPK1 subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The MPK1 subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. This subfamily is composed of the MAPKs MPK1 from Saccharomyces cerevisiae, Pmk1 from Schizosaccharomyces pombe, and similar proteins. MAPKs are important mediators of cellular responses to extracellular signals. MPK1 (also called Slt2) and Pmk1 (also called Spm1) are stress-activated MAPKs that regulate the cell wall integrity (CWI) pathway, and are therefore important in the maintainance of cell shape
Probab=95.34  E-value=0.032  Score=33.95  Aligned_cols=29  Identities=28%  Similarity=0.558  Sum_probs=24.8

Q ss_pred             CCEEECCCCCCCEEECCC-CCEEEECCCCCC
Q ss_conf             744402234642256279-604873162135
Q gi|254780795|r  184 TGIIHADLFPDNVLFYNN-KIMGLIDFYFSC  213 (316)
Q Consensus       184 ~g~IHgDl~~~NiL~~~~-~i~giIDF~~~~  213 (316)
T Consensus       124 ~~IiHRDlKPeNILl~~~~~vK-l~DFGla~  153 (332)
T cd07857         124 ANVLHRDLKPGNLLVNADCELK-ICDFGLAR  153 (332)
T ss_pred             CCCEECCCCHHHEEECCCCCEE-EEECCCCC
T ss_conf             9842125778996887899877-60425111