>gnl|CDD|88614 cd05151, ChoK, Choline Kinase (ChoK). The ChoK subfamily is part of a larger superfamily that includes the catalytic domains of other kinases, such as the typical serine/threonine/tyrosine protein kinases (PKs), RIO kinases, actin-fragmin kinase (AFK), and phosphoinositide 3-kinase (PI3K). It is composed of bacterial and eukaryotic choline kinases, as well as eukaryotic ethanolamine kinase. ChoK catalyzes the transfer of the gamma-phosphoryl group from ATP (or CTP) to its substrate, choline, producing phosphorylcholine (PCho), a precursor to the biosynthesis of two major membrane phospholipids, phosphatidylcholine (PC), and sphingomyelin (SM). Although choline is the preferred substrate, ChoK also shows substantial activity towards ethanolamine and its N-methylated derivatives. Bacterial ChoK is also referred to as licA protein. ETNK catalyzes the transfer of the gamma-phosphoryl group from CTP to ethanolamine (Etn), the first step in the CDP-Etn pathway for the formation of the major phospholipid, phosphatidylethanolamine (PtdEtn). Unlike ChoK, ETNK shows specific activity for its substrate and displays negligible activity towards N-methylated derivatives of Etn. ChoK plays an important role in cell signaling pathways and the regulation of cell growth.. Length = 170

 Score = 39.1 bits (91), Expect = 0.002
 Identities = 15/46 (32%), Positives = 23/46 (50%), Gaps = 3/46 (6%)

Query: 188 HADLFPDNVLFYNNKIMGLIDF-YFSCNDFLMYDLSICINAWCFDE 232
           H DL P N L  + ++  LID+ Y   ND  ++DL+   +     E
Sbjct: 111 HNDLLPGNFLLDDGRLW-LIDWEYAGMNDP-LFDLANFFSEAKLSE 154