RPS-BLAST 2.2.22 [Sep-27-2009] Database: CddB 21,608 sequences; 5,994,473 total letters Searching..................................................done Query= gi|254780797|ref|YP_003065210.1| hypothetical protein CLIBASIA_03440 [Candidatus Liberibacter asiaticus str. psy62] (231 letters) >gnl|CDD|161970 TIGR00633, xth, exodeoxyribonuclease III (xth). This family is based on the phylogenomic analysis of JA Eisen (1999, Ph.D. Thesis, Stanford University). Length = 255 Score = 33.0 bits (76), Expect = 0.060 Identities = 12/50 (24%), Positives = 21/50 (42%), Gaps = 15/50 (30%) Query: 8 RIASWNINNLSEKSGVALFKNSVIREDNDYALLQKYAEQLDADIVCLQEI 57 +I SWN+N L + + + L++ D++CLQE Sbjct: 2 KIISWNVNGL----------RARLHKL-FLDWLKEE----QPDVLCLQET 36 >gnl|CDD|161757 TIGR00195, exoDNase_III, exodeoxyribonuclease III. The model brings in reverse transcriptases at scores below 50, model also contains eukaryotic apurinic/apyrimidinic endonucleases which group in the same family. Length = 254 Score = 28.9 bits (65), Expect = 1.3 Identities = 11/51 (21%), Positives = 22/51 (43%), Gaps = 16/51 (31%) Query: 7 IRIASWNINNLSEKSGVALFKNSVIREDNDYALLQKYAEQLDADIVCLQEI 57 ++I SWN+N L + + + + ++ D++CLQE Sbjct: 1 MKIISWNVNGL----------RARLHK------GLAWLKENQPDVLCLQET 35 >gnl|CDD|178689 PLN03144, PLN03144, Carbon catabolite repressor protein 4 homolog; Provisional. Length = 606 Score = 28.5 bits (64), Expect = 1.4 Identities = 8/12 (66%), Positives = 10/12 (83%) Query: 48 DADIVCLQEIGS 59 ADI+CLQE+ S Sbjct: 298 RADILCLQEVQS 309 >gnl|CDD|180068 PRK05421, PRK05421, hypothetical protein; Provisional. Length = 263 Score = 27.2 bits (61), Expect = 3.3 Identities = 15/74 (20%), Positives = 25/74 (33%), Gaps = 20/74 (27%) Query: 5 QRIRIASWNINNLSEKSGVALFKNSVIREDNDYALLQKYAEQL--DADIVCLQEIGSYEA 62 +R+R+ WNI +K A + L DAD+V LQE + Sbjct: 42 ERLRLLVWNI-----------YKQ-------QRAGWLSVLKNLGKDADLVLLQEAQTTPE 83 Query: 63 IKRVFPNDKWDILY 76 + + + Sbjct: 84 LVQFATANYLAADQ 97 >gnl|CDD|185163 PRK15251, PRK15251, cytolethal distending toxin subunit CdtB; Provisional. Length = 271 Score = 27.0 bits (60), Expect = 5.0 Identities = 8/15 (53%), Positives = 12/15 (80%) Query: 175 NNLNMPFIIAGDFNR 189 N ++ ++IAGDFNR Sbjct: 181 NMRHINWMIAGDFNR 195 >gnl|CDD|149470 pfam08416, PTB, Phosphotyrosine-binding domain. The phosphotyrosine-binding domain (PTB, also phosphotyrosine-interaction or PI domain) in the protein tensin tends to be found at the C-terminus. Tensin is a multi-domain protein that binds to actin filaments and functions as a focal-adhesion molecule (focal adhesions are regions of plasma membrane through which cells attach to the extracellular matrix). Human tensin has actin-binding sites, an SH2 (pfam00017) domain and a region similar to the tumour suppressor PTEN. The PTB domain interacts with the cytoplasmic tails of beta integrin by binding to an NPXY motif. Length = 131 Score = 26.5 bits (59), Expect = 6.4 Identities = 10/32 (31%), Positives = 17/32 (53%), Gaps = 1/32 (3%) Query: 112 LDSKAGKRRAVEILFEVDGRKIWLLDIHLKSF 143 LD++ G+ A ++L +V + I L D K Sbjct: 31 LDAQ-GRVWAQDMLLQVSAQGITLTDNERKEE 61 >gnl|CDD|140318 PTZ00297, PTZ00297, pantothenate kinase; Provisional. Length = 1452 Score = 26.4 bits (58), Expect = 7.3 Identities = 8/10 (80%), Positives = 10/10 (100%) Query: 179 MPFIIAGDFN 188 +PF+IAGDFN Sbjct: 196 IPFVIAGDFN 205 Database: CddB Posted date: Feb 4, 2011 9:54 PM Number of letters in database: 5,994,473 Number of sequences in database: 21,608 Lambda K H 0.321 0.136 0.408 Gapped Lambda K H 0.267 0.0745 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 21608 Number of Hits to DB: 3,776,841 Number of extensions: 236489 Number of successful extensions: 431 Number of sequences better than 10.0: 1 Number of HSP's gapped: 428 Number of HSP's successfully gapped: 15 Length of query: 231 Length of database: 5,994,473 Length adjustment: 90 Effective length of query: 141 Effective length of database: 4,049,753 Effective search space: 571015173 Effective search space used: 571015173 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 55 (24.9 bits)