>TIGR00547 lolA outer membrane lipoprotein carrier protein LolA; InterPro: IPR004564 This protein, LolA, is known so far only in the gamma subdivision of the Proteobacteria. In Escherichia coli, lipoproteins are anchored to the periplasmic side of either the inner or outer membrane through N-terminal lipids, depending on the lipoprotein-sorting signal present at position 2 . Five Lol proteins are involved in the sorting and outer membrane localization of lipoproteins. LolCDE, an ATP binding cassette (ABC) transporter, in the inner membrane releases outer membrane-directed lipoproteins from the inner membrane in an ATP-dependent manner, leading to the formation of a water-soluble complex between the lipoprotein and the molecular chaperone, LolA. The LolA-lipoprotein complex crosses the periplasm and then interacts with outer membrane receptor LolB, which is essential for the anchoring of lipoproteins to the outer membrane. E. coli lipoproteins are anchored to the inner or outer membrane depending on the residue at position 2. Aspartate at this position makes lipoproteins specific to the inner membrane, whereas other residues cause the release of lipoproteins from the inner membrane.; GO: 0015031 protein transport, 0030288 outer membrane-bounded periplasmic space.

Probab=99.40 E-value=7.4e-13 Score=91.42 Aligned_cols=167 Identities=14% Similarity=0.240 Sum_probs=133.0 Q ss_pred CCCCHHHHHHHHHHHCCCEEEEEEEEEEC---C---CEEEEEEEEECCCEEEEEECCCCEEEEEEECEEEEEEECCCCCC Q ss_conf 43101799999986126706999999618---9---55999999966986999971664157775120599971333432 Q gi|254780798|r 30 ITKDQSVKKAIEHFLSIQTMQGTFLQEDA---G---YVMKGEFFMARPSKFYFKYSSPSSVSLISDGSNIAVYNAKLDTW 103 (204) Q Consensus 30 ~~~~~~~~~i~~~l~~~~t~~a~F~Q~~~---~---~~~~G~~~~kkP~k~rw~y~~P~~~~iv~~g~~l~~~d~~~~q~ 103 (204) T Consensus 19 ~~~~d~~~~~~~~~~~~~~~~~~~~~~~~~g~g~~~~~g~g~~~~~~p~~~~~~~~~p~~~~~~~dg~~~w~~~p~~~~~ 98 (204) T TIGR00547 19 LAWADAASDLKSRLDKVDSLHAEFTQKVTDGSGKNVQEGSGDLWVKRPNLFNWETKTPDETILVSDGKTLWFYDPFVEQA 98 (204) T ss_pred HHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCCCCCCCCCCEEEECCCCEEECCCCCCCEEEEECCCEEEEECHHHHHH T ss_conf 44432245677666554332122221001566531003566225425640110026863103320673446323135556 Q ss_pred CCHHHH----HHHHHHHCCHHHHHHHHCCCCCCCCCCEEEEECCCCCCCCEEEEEEECCCCEEEEEEEEECCCCEEEEEE Q ss_conf 101111----1123321000121222101132235727997204666663479999369842999999967998799999 Q gi|254780798|r 104 SVYPLR----YMAFSVIFSNNQHVIQESIQRVESNNSFITIFFKDDFMGNMISVTFDRLSYRLLNWKIMDSSRRYSIIKI 179 (204) Q Consensus 104 ~~~~~~----~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~i~l~f~~~~~~l~~~~i~D~~G~~t~i~f 179 (204) T Consensus 99 ~~~w~~~~~~~~p~~-~~~~~~~~~w~~~~~~~~~d~~~~~p~~~~~~~~~~~~~~~~~g-~~~~~~~~~~d~~~~~~~~ 176 (204) T TIGR00547 99 TATWLKDATGNTPFV-LLARNDKSDWHQYNVKQNGDDFVLKPKLSNGNLKQFDINVGADG-TLHNFSATEKDGQTNLYVL 176 (204) T ss_pred HHHHHHHCCCCCCEE-EEECCCCCCCEEEEECCCCCCEEEECCCCCCCCEEEEEECCCCC-CEECCCCCCCCCCCHHEEE T ss_conf 666654203776358-98517743310121012676046620345564113554116764-1000001123453001000 Q ss_pred EEEECCCCCCHHHCCCCCCC Q ss_conf 74322886896551268531 Q gi|254780798|r 180 LKYKENTVLDPKVFEIPYDK 199 (204) Q Consensus 180 ~ni~~N~~i~~~~F~f~~~~ 199 (204) T Consensus 177 ~~~-~~~~~~~~~~~~~p~~ 195 (204) T TIGR00547 177 KNI-TNGALDDALFTFKPPK 195 (204) T ss_pred CCC-CCCCCHHHHHEECCCC T ss_conf 001-2210000110005755

HHsearch alignment for GI: 254780798 and conserved domain: TIGR00547