BLASTP 2.2.22 [Sep-27-2009] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= gi|254780798|ref|YP_003065211.1| possible lolA type protein [Candidatus Liberibacter asiaticus str. psy62] (204 letters) Database: las_proteome 1233 sequences; 328,796 total letters Searching...................................................done >gi|254780798|ref|YP_003065211.1| possible lolA type protein [Candidatus Liberibacter asiaticus str. psy62] Length = 204 Score = 415 bits (1067), Expect = e-118, Method: Compositional matrix adjust. Identities = 204/204 (100%), Positives = 204/204 (100%) Query: 1 MAFLLYKSVIGVVILFFYSAIFPFNAAYPITKDQSVKKAIEHFLSIQTMQGTFLQEDAGY 60 MAFLLYKSVIGVVILFFYSAIFPFNAAYPITKDQSVKKAIEHFLSIQTMQGTFLQEDAGY Sbjct: 1 MAFLLYKSVIGVVILFFYSAIFPFNAAYPITKDQSVKKAIEHFLSIQTMQGTFLQEDAGY 60 Query: 61 VMKGEFFMARPSKFYFKYSSPSSVSLISDGSNIAVYNAKLDTWSVYPLRYMAFSVIFSNN 120 VMKGEFFMARPSKFYFKYSSPSSVSLISDGSNIAVYNAKLDTWSVYPLRYMAFSVIFSNN Sbjct: 61 VMKGEFFMARPSKFYFKYSSPSSVSLISDGSNIAVYNAKLDTWSVYPLRYMAFSVIFSNN 120 Query: 121 QHVIQESIQRVESNNSFITIFFKDDFMGNMISVTFDRLSYRLLNWKIMDSSRRYSIIKIL 180 QHVIQESIQRVESNNSFITIFFKDDFMGNMISVTFDRLSYRLLNWKIMDSSRRYSIIKIL Sbjct: 121 QHVIQESIQRVESNNSFITIFFKDDFMGNMISVTFDRLSYRLLNWKIMDSSRRYSIIKIL 180 Query: 181 KYKENTVLDPKVFEIPYDKIHNIN 204 KYKENTVLDPKVFEIPYDKIHNIN Sbjct: 181 KYKENTVLDPKVFEIPYDKIHNIN 204 >gi|254781004|ref|YP_003065417.1| threonyl-tRNA synthetase [Candidatus Liberibacter asiaticus str. psy62] Length = 652 Score = 23.5 bits (49), Expect = 2.5, Method: Compositional matrix adjust. Identities = 10/43 (23%), Positives = 19/43 (44%) Query: 91 SNIAVYNAKLDTWSVYPLRYMAFSVIFSNNQHVIQESIQRVES 133 ++AV+N L ++ P+R F ++ N + RV Sbjct: 343 GHVAVFNHGLKSYRELPVRLAEFGSVYRNEPSGSLHGLMRVRG 385 Database: las_proteome Posted date: Jun 5, 2011 6:30 PM Number of letters in database: 328,796 Number of sequences in database: 1233 Lambda K H 0.325 0.138 0.401 Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 133,232 Number of Sequences: 1233 Number of extensions: 5423 Number of successful extensions: 22 Number of sequences better than 100.0: 5 Number of HSP's better than 100.0 without gapping: 4 Number of HSP's successfully gapped in prelim test: 1 Number of HSP's that attempted gapping in prelim test: 18 Number of HSP's gapped (non-prelim): 5 length of query: 204 length of database: 328,796 effective HSP length: 70 effective length of query: 134 effective length of database: 242,486 effective search space: 32493124 effective search space used: 32493124 T: 11 A: 40 X1: 15 ( 7.0 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.6 bits) S2: 36 (18.5 bits)