>pfam07693 KAP_NTPase KAP family P-loop domain. The KAP (after Kidins220/ARMS and PifA) family of predicted NTPases are sporadically distributed across a wide phylogenetic range in bacteria and in animals. Many of the prokaryotic KAP NTPases are encoded in plasmids and tend to undergo disruption to form pseudogenes. A unique feature of all eukaryotic and certain bacterial KAP NTPases is the presence of two or four transmembrane helices inserted into the P-loop NTPase domain. These transmembrane helices anchor KAP NTPases in the membrane such that the P-loop domain is located on the intracellular side.

Probab=90.54 E-value=1.5 Score=23.82 Aligned_cols=54 Identities=19% Similarity=0.338 Sum_probs=42.4 Q ss_pred EEEEEHHHHHHHHHHCCCHHHHHHHHHHHHHHHCCEEEEEEECCCCCCCCCHHHHHCCCC Q ss_conf 687763446888873210058899999986641423799996577753554355411025 Q gi|254780799|r 591 YIVVVIDEMADLMMVARKDIESAVQRLAQMARASGIHVIMATQRPSVDVITGTIKANFPT 650 (806) Q Consensus 591 ~ivviiDElaDlmm~~~~~ve~~i~rlaq~ara~GiHli~aTqrPsvdvitg~ikan~p~ 650 (806) T Consensus 161 ~iVviIDDLDRc---~p~~~v~~Le~Ik~~~d~~n~vfVLa~D~---~~v~~al~~~~~~ 214 (301) T pfam07693 161 RIVVIIDDLDRC---EPEEAVELLEAVRLLFDFPNVVFILAYDE---EIIKKAIEHNYGG 214 (301) T ss_pred CEEEEECCCCCC---CHHHHHHHHHHHHHHHCCCCEEEEEECCH---HHHHHHHHHHCCC T ss_conf 789997365548---87899999999999726798189997589---9999999987387

HHsearch alignment for GI: 254780799 and conserved domain: pfam07693