Query         gi|254780800|ref|YP_003065213.1| hypothetical protein CLIBASIA_03455 [Candidatus Liberibacter asiaticus str. psy62]
Match_columns 192
No_of_seqs    115 out of 360
Neff          3.3 
Searched_HMMs 33803
Date          Wed Jun  1 13:30:01 2011
Command       /home/congqian_1/programs/hhpred/hhsearch -i 254780800.hhm -d /home/congqian_1/database/mmdb/mmdb70.hhm 

 No Hit                             Prob E-value P-value  Score    SS Cols Query HMM  Template HMM
  1 >1z6r_A MLC protein; transcrip  76.4     2.4 7.1E-05   23.7   3.1   45   95-139     8-52  (107)
  2 >1z05_A Transcriptional regula  73.4     3.3 9.9E-05   22.8   3.2   46   94-139    30-75  (132)
  3 >2rdp_A Putative transcription  72.1     3.4  0.0001   22.7   3.0   34  107-140    46-79  (127)
  4 >2eth_A Transcriptional regula  71.9     4.6 0.00014   21.9   3.6   48  106-153    47-97  (130)
  5 >3bpv_A Transcriptional regula  66.5     6.9 0.00021   20.9   3.6   33  107-139    33-65  (114)
  6 >3bj6_A Transcriptional regula  64.7     6.4 0.00019   21.1   3.1   33  107-139    44-76  (125)
  7 >2a61_A Transcriptional regula  61.2     9.6 0.00028   20.0   3.5   33  107-139     9-41  (66)
  8 >3hrs_A Metalloregulator SCAR;  60.2     4.5 0.00013   22.0   1.7   35  106-140     9-43  (138)
  9 >2nyx_A Probable transcription  59.2     6.8  0.0002   20.9   2.5   33  107-139     7-39  (64)
 10 >3bdd_A Regulatory protein MAR  58.9      11 0.00033   19.6   3.5   33  107-139     6-38  (73)
 11 >3e6m_A MARR family transcript  58.2       8 0.00024   20.5   2.7   47  106-152    56-105 (138)
 12 >2nnn_A Probable transcription  54.6      11 0.00033   19.6   2.9   34  107-140     8-41  (65)
 13 >3k0l_A Repressor protein; hel  54.4      10 0.00029   19.9   2.6   35  106-140    49-83  (131)
 14 >1z91_A Organic hydroperoxide   52.1      12 0.00035   19.5   2.7   34  106-139    10-43  (78)
 15 >2fa5_A Transcriptional regula  51.8      15 0.00044   18.9   3.2   33  107-139    53-85  (134)
 16 >1ku3_A Sigma factor SIGA; hel  51.7     6.7  0.0002   21.0   1.4   28  114-141    27-54  (73)
 17 >3fm5_A Transcriptional regula  50.5      18 0.00054   18.3   3.5   34  106-139    42-76  (124)
 18 >2fbh_A Transcriptional regula  49.8      22 0.00064   17.9   3.8   32  107-138     7-39  (67)
 19 >1lj9_A Transcriptional regula  49.3      14 0.00042   18.9   2.8   47  107-153     6-55  (87)
 20 >3cdh_A Transcriptional regula  49.0      17  0.0005   18.5   3.1   47  107-153    17-66  (103)
 21 >3eco_A MEPR; mutlidrug efflux  47.3      20 0.00059   18.1   3.3   36  105-140    33-70  (119)
 22 >2frh_A SARA, staphylococcal a  46.2      16 0.00048   18.6   2.7   47  106-152    40-91  (127)
 23 >2pex_A Transcriptional regula  46.1      22 0.00064   17.9   3.3   33  107-139     8-40  (71)
 24 >2qww_A Transcriptional regula  46.1      16 0.00047   18.7   2.6   35  106-140    44-78  (131)
 25 >1jgs_A Multiple antibiotic re  45.8      19 0.00057   18.2   3.0   54  106-159    37-93  (122)
 26 >1q44_A RARO47;, steroid sulph  45.4     7.7 0.00023   20.6   0.9   18   15-32    168-185 (263)
 27 >2k9s_A Arabinose operon regul  43.1      16 0.00046   18.7   2.2   27    9-35     12-38  (61)
 28 >2fxa_A Protease production re  41.7      23 0.00068   17.7   2.9   33  107-139     8-40  (81)
 29 >3g3z_A NMB1585, transcription  41.5      25 0.00073   17.5   3.0   52  107-158     6-60  (91)
 30 >3ech_A MEXR, multidrug resist  41.5      24 0.00072   17.6   3.0   33  107-139    41-73  (122)
 31 >3cjn_A Transcriptional regula  41.0      27  0.0008   17.3   3.1   34  106-139     8-41  (78)
 32 >3hsr_A HTH-type transcription  40.7      14 0.00041   19.0   1.6   48  106-153    39-89  (119)
 33 >2hr3_A Probable transcription  40.5      32 0.00094   16.9   3.8   33  107-139    10-43  (94)
 34 >1a31_A Protein (topoisomerase  40.5     8.6 0.00025   20.3   0.5   15    8-22     43-57  (269)
 35 >2qq9_A Diphtheria toxin repre  40.3      32 0.00094   16.8   3.4   35  106-140    13-47  (146)
 36 >1s3j_A YUSO protein; structur  39.9      26 0.00078   17.4   2.9   47  106-152    40-89  (122)
 37 >3cuo_A Uncharacterized HTH-ty  39.9      22 0.00066   17.8   2.6   31  106-136    18-48  (90)
 38 >2fbi_A Probable transcription  38.2      28 0.00083   17.2   2.9   46  107-152     6-54  (75)
 39 >3cta_A Riboflavin kinase; str  37.8      14 0.00042   19.0   1.3   34  107-140    17-50  (91)
 40 >3hyi_A Protein DUF199/WHIA; l  37.5      32 0.00096   16.8   3.1   31  106-136    45-75  (91)
 41 >1dw9_A Cyanate lyase; cyanate  37.5      14 0.00043   18.9   1.3   23   18-40     17-39  (69)
 42 >1or7_A Sigma-24, RNA polymera  34.6      36  0.0011   16.5   3.0   35  106-140    29-63  (78)
 43 >2zkz_A Transcriptional repres  33.8      37  0.0011   16.4   2.9   30  107-136    31-60  (99)
 44 >1we8_A Tudor and KH domain co  33.5      41  0.0012   16.2   3.4   64  117-180    20-89  (104)
 45 >1ku9_A Hypothetical protein M  33.2      37  0.0011   16.5   2.8   33  107-139    30-63  (88)
 46 >1bia_A BIRA bifunctional prot  32.3      33 0.00099   16.7   2.5   36  101-136     3-38  (64)
 47 >1ub9_A Hypothetical protein P  32.2      40  0.0012   16.3   2.8   32  107-138    20-51  (100)
 48 >1bl0_A Protein (multiple anti  32.2      29 0.00087   17.1   2.2   27    9-35     12-38  (76)
 49 >3deu_A Transcriptional regula  31.0      42  0.0013   16.1   2.8   33  107-139    57-90  (139)
 50 >3bja_A Transcriptional regula  30.6      24 0.00071   17.6   1.5   47  106-152    36-85  (118)
 51 >2bv6_A MGRA, HTH-type transcr  30.4      24  0.0007   17.6   1.4   33  107-139     9-41  (76)
 52 >1p4x_A Staphylococcal accesso  29.7      38  0.0011   16.4   2.4   54  107-160     7-65  (95)
 53 >2d1h_A ST1889, 109AA long hyp  29.3      48  0.0014   15.7   3.4   34  106-139    25-58  (109)
 54 >2b9s_A Topoisomerase I-like p  29.2      17 0.00052   18.4   0.6   15    8-22     43-57  (133)
 55 >2r09_A Cytohesin-3; autoinhib  28.0      51  0.0015   15.6   3.8   35  103-137     2-36  (47)
 56 >1zd1_A Sulfotransferase 4A1;   27.6      43  0.0013   16.1   2.4   65   14-78    155-232 (241)
 57 >1b4a_A Arginine repressor; he  25.5      56  0.0017   15.3   2.8   36  100-135     2-42  (68)
 58 >1fx7_A Iron-dependent repress  25.0      58  0.0017   15.3   3.3   34  107-140    14-47  (141)
 59 >1q1h_A TFE, transcription fac  24.8      58  0.0017   15.3   3.0   31  108-138    23-54  (110)
 60 >1hsj_A Fusion protein consist  24.3      59  0.0017   15.2   2.6   47  107-153     8-59  (87)
 61 >3e97_A Transcriptional regula  24.1      34   0.001   16.7   1.3   30   21-50     57-86  (112)
 62 >1rp3_A RNA polymerase sigma f  23.8      61  0.0018   15.1   3.5   34  107-140   104-137 (150)
 63 >2zq5_A Putative uncharacteriz  23.4      27 0.00078   17.3   0.7   16  124-139   231-246 (297)
 64 >1gt0_D Transcription factor S  22.2      36  0.0011   16.5   1.2   20  111-130    21-40  (80)
 65 >1ldj_A Cullin homolog 1, CUL-  21.5      35   0.001   16.6   0.9   35   17-51     11-45  (70)
 66 >2cu1_A Mitogen-activated prot  21.3      63  0.0019   15.0   2.2   24  154-177    54-77  (103)
 67 >2jrh_A Mitogen-activated prot  21.1      69   0.002   14.8   2.4   23  154-176    50-72  (94)
 68 >2npt_B Mitogen-activated prot  21.1      63  0.0019   15.0   2.2   23  154-176    66-88  (100)
 69 >3f27_D Transcription factor S  20.9      49  0.0014   15.7   1.6   20  111-130    25-44  (83)
 70 >2ia0_A Putative HTH-type tran  20.8      70  0.0021   14.8   3.7   32  106-137    20-51  (66)
 71 >2c60_A Human mitogen-activate  20.4      67   0.002   14.9   2.2   22  154-175    77-98  (111)

No 1  
>>1z6r_A MLC protein; transcriptional repressor, ROK family protein, DNA binding protein, helix-turn-helix, phosphotransferase system, metalloprotein; 2.70A {Escherichia coli} (A:1-82,A:382-406)
Probab=76.41  E-value=2.4  Score=23.68  Aligned_cols=45  Identities=18%  Similarity=0.178  Sum_probs=36.9

Q ss_pred             CCCHHHHCCCHHHHHHHHHHCCCCCHHHHHHHHCCCHHHHHHHHC
Q ss_conf             342033115717999999842455842434664387589999962
Q gi|254780800|r   95 YTPVSKRQDRPNAILWLIRNYPRLKDAQISHLVGTTGSTIEQIRN  139 (192)
Q Consensus        95 YTPlSkRqDkPdAI~WLiknhPeL~D~QI~KLiGTTK~TI~sIRd  139 (192)
                      .+|-.-|+.-=..|+.+++.++.++-++|++..|-+++||..|=+
T Consensus         8 ~~~~~ir~~N~~~IL~lL~~~g~~Sr~eLA~~lgLS~~TVs~iv~   52 (107)
T 1z6r_A            8 GHIDQIKQTNAGAVYRLIDQLGPVSRIDLSRLAQLAPASITKIVH   52 (107)
T ss_dssp             ----CHHHHHHHHHHHHHHSSCSCCHHHHHHHTTCCHHHHHHHHH
T ss_pred             CCHHHHHHHHHHHHHHHHHHCCCCCHHHHHHHHCCCHHHHHHHHH
T ss_conf             799999999999999999985991899999887959999999999


No 2  
>>1z05_A Transcriptional regulator, ROK family; structural genomics, PSI, protein structure initiative; 2.00A {Vibrio cholerae o1 biovar eltor str} (A:1-105,A:403-429)
Probab=73.38  E-value=3.3  Score=22.81  Aligned_cols=46  Identities=13%  Similarity=0.045  Sum_probs=37.3

Q ss_pred             CCCCHHHHCCCHHHHHHHHHHCCCCCHHHHHHHHCCCHHHHHHHHC
Q ss_conf             5342033115717999999842455842434664387589999962
Q gi|254780800|r   94 RYTPVSKRQDRPNAILWLIRNYPRLKDAQISHLVGTTGSTIEQIRN  139 (192)
Q Consensus        94 kYTPlSkRqDkPdAI~WLiknhPeL~D~QI~KLiGTTK~TI~sIRd  139 (192)
                      ..++-.-|+.-=..|+++|+.++.++-++|++.+|-+..||..+-+
T Consensus        30 ~~~~~~l~~~n~~~IL~lL~~~g~~T~~eLA~~lgLS~~TVs~~L~   75 (132)
T 1z05_A           30 PGHIDHIKQINAGRVYKLIDQKGPISRIDLSKESELAPASITKITR   75 (132)
T ss_dssp             ----CHHHHHHHHHHHHHHHHHCSBCHHHHHHHHTCCHHHHHHHHH
T ss_pred             CCCHHHHHHHHHHHHHHHHHHCCCCCHHHHHHHHCCCHHHHHHHHH
T ss_conf             9899999999999999999985991899999887969999999999


No 3  
>>2rdp_A Putative transcriptional regulator MARR; PFAM PF01047, winged-helix DNA binding motif, structural genomics, PSI-2; 2.30A {Geobacillus stearothermophilus} (A:1-127)
Probab=72.12  E-value=3.4  Score=22.72  Aligned_cols=34  Identities=18%  Similarity=0.102  Sum_probs=30.7

Q ss_pred             HHHHHHHHCCCCCHHHHHHHHCCCHHHHHHHHCC
Q ss_conf             9999998424558424346643875899999628
Q gi|254780800|r  107 AILWLIRNYPRLKDAQISHLVGTTGSTIEQIRNR  140 (192)
Q Consensus       107 AI~WLiknhPeL~D~QI~KLiGTTK~TI~sIRdR  140 (192)
                      .|+|.|.++|.++-++|++..|.|+++|..+=++
T Consensus        46 ~iL~~i~~~~~~t~~~la~~~~i~~~~vs~~i~~   79 (127)
T 2rdp_A           46 VALQWLLEEGDLTVGELSNKXYLACSTTTDLVDR   79 (127)
T ss_dssp             HHHHHHHHHCSBCHHHHHHHHTCCHHHHHHHHHH
T ss_pred             HHHHHHHHCCCCCHHHHHHHHCCCCCHHHHHHHH
T ss_conf             9999999779949999999878452448899998


No 4  
>>2eth_A Transcriptional regulator, putative, MAR family; TM0816, structural genomics, PSI, protein structure initiative; 2.30A {Thermotoga maritima} (A:1-130)
Probab=71.86  E-value=4.6  Score=21.94  Aligned_cols=48  Identities=15%  Similarity=0.222  Sum_probs=37.2

Q ss_pred             HHHHHHHHHCCCCCHHHHHHHHCCCHHHHHHHHC---CCCCCCCCCCCCCC
Q ss_conf             7999999842455842434664387589999962---88877012683773
Q gi|254780800|r  106 NAILWLIRNYPRLKDAQISHLVGTTGSTIEQIRN---RTHWNTANLVPMDP  153 (192)
Q Consensus       106 dAI~WLiknhPeL~D~QI~KLiGTTK~TI~sIRd---RtHWN~~Ni~P~DP  153 (192)
                      -.|++.|..+|+++-++|++..|.+++||..+=+   +..|=...-.|.|-
T Consensus        47 ~~iL~~l~~~~~~t~~eLa~~~~i~~~~vs~~i~~L~~~glv~r~~~~~D~   97 (130)
T 2eth_A           47 LYAFLYVALFGPKKXKEIAEFLSTTKSNVTNVVDSLEKRGLVVREXDPVDR   97 (130)
T ss_dssp             HHHHHHHHHHCCBCHHHHHHHTTSCHHHHHHHHHHHHHTTSEEEEECTTTS
T ss_pred             HHHHHHHHHCCCCCHHHHHHHHCCCHHHHHHHHHHHHHCCCEEEEEECCCC
T ss_conf             999999998599599999999896998999999999878884565203566


No 5  
>>3bpv_A Transcriptional regulator; MARR, DNA binding, transcription factor, winged helix motif, DNA-binding; 1.40A {Methanobacterium thermoautotrophicum} PDB: 3bpx_A* (A:1-114)
Probab=66.51  E-value=6.9  Score=20.87  Aligned_cols=33  Identities=21%  Similarity=0.290  Sum_probs=30.0

Q ss_pred             HHHHHHHHCCCCCHHHHHHHHCCCHHHHHHHHC
Q ss_conf             999999842455842434664387589999962
Q gi|254780800|r  107 AILWLIRNYPRLKDAQISHLVGTTGSTIEQIRN  139 (192)
Q Consensus       107 AI~WLiknhPeL~D~QI~KLiGTTK~TI~sIRd  139 (192)
                      .|++.|.++|+++-++|++..|.+++||..+=+
T Consensus        33 ~iL~~l~~~~~~t~~~la~~~~~~~~~vs~~i~   65 (114)
T 3bpv_A           33 ACLLRIHREPGIKQDELATFFHVDKGTIARTLR   65 (114)
T ss_dssp             HHHHHHHHSTTCBHHHHHHHHTCCHHHHHHHHH
T ss_pred             HHHHHHHHCCCCCHHHHHHHHCCCHHHHHHHHH
T ss_conf             999999858998999999998969889999999


No 6  
>>3bj6_A Transcriptional regulator, MARR family; helix-turn-helix, trasnscription regulator, structural genomics, PSI-2; 2.01A {Silicibacter pomeroyi dss-3} (A:1-125)
Probab=64.67  E-value=6.4  Score=21.10  Aligned_cols=33  Identities=21%  Similarity=0.156  Sum_probs=30.2

Q ss_pred             HHHHHHHHCCCCCHHHHHHHHCCCHHHHHHHHC
Q ss_conf             999999842455842434664387589999962
Q gi|254780800|r  107 AILWLIRNYPRLKDAQISHLVGTTGSTIEQIRN  139 (192)
Q Consensus       107 AI~WLiknhPeL~D~QI~KLiGTTK~TI~sIRd  139 (192)
                      .|++.|.++|.++-++|++.+|.+++||..+=+
T Consensus        44 ~iL~~l~~~~~~t~~~la~~~~~~~~~vs~~i~   76 (125)
T 3bj6_A           44 AILEGLSLTPGATAPQLGAALQXKRQYISRILQ   76 (125)
T ss_dssp             HHHHHHHHSTTEEHHHHHHHHTCCHHHHHHHHH
T ss_pred             HHHHHHHHCCCCCHHHHHHHHCCCHHHHHHHHH
T ss_conf             999999986998999999998865758999999


No 7  
>>2a61_A Transcriptional regulator TM0710; APC4350, MCSG, midwest center for structural genomics, PSI, protein structure initiative, MARR; 1.80A {Thermotoga maritima} (A:29-94)
Probab=61.19  E-value=9.6  Score=20.02  Aligned_cols=33  Identities=24%  Similarity=0.225  Sum_probs=29.4

Q ss_pred             HHHHHHHHCCCCCHHHHHHHHCCCHHHHHHHHC
Q ss_conf             999999842455842434664387589999962
Q gi|254780800|r  107 AILWLIRNYPRLKDAQISHLVGTTGSTIEQIRN  139 (192)
Q Consensus       107 AI~WLiknhPeL~D~QI~KLiGTTK~TI~sIRd  139 (192)
                      .|+..+.++|+++-++|++.+|-+++|+..+=+
T Consensus         9 ~vL~~l~~~~~~t~~~la~~~~~s~~~~s~~i~   41 (66)
T 2a61_A            9 DILQKIYFEGPKRPGELSVLLGVAKSTVTGLVK   41 (66)
T ss_dssp             HHHHHHHHHCCBCHHHHHHHHTCCHHHHHHHHH
T ss_pred             HHHHHHHHCCCCCHHHHHHHCCCCHHHHHHHHH
T ss_conf             999999876998999999882989889999999


No 8  
>>3hrs_A Metalloregulator SCAR; DTXR/MNTR family member, transcription; 2.70A {Streptococcus gordonii} PDB: 3hrt_A 3hru_A (A:1-138)
Probab=60.20  E-value=4.5  Score=22.02  Aligned_cols=35  Identities=9%  Similarity=0.251  Sum_probs=31.1

Q ss_pred             HHHHHHHHHCCCCCHHHHHHHHCCCHHHHHHHHCC
Q ss_conf             79999998424558424346643875899999628
Q gi|254780800|r  106 NAILWLIRNYPRLKDAQISHLVGTTGSTIEQIRNR  140 (192)
Q Consensus       106 dAI~WLiknhPeL~D~QI~KLiGTTK~TI~sIRdR  140 (192)
                      .+|++++..++.++-+.|++..|-+++||..+=+|
T Consensus         9 ~~I~~~~~~~~~~t~~~lA~~lgis~~tvt~~l~~   43 (138)
T 3hrs_A            9 KCLYELGTRHNKITNKEIAQLMQVSPPAVTEMMKK   43 (138)
T ss_dssp             HHHHHTTSSCSCCCHHHHHHHHTCCHHHHHHHHHH
T ss_pred             HHHHHHHHCCCCCCHHHHHHHHCCCHHHHHHHHHH
T ss_conf             99999983499875999999978992899999999


No 9  
>>2nyx_A Probable transcriptional regulatory protein, RV1404; alpha/beta, structural genomics, PSI-2, protein structure initiative; 2.30A {Mycobacterium tuberculosis H37RV} (A:43-106)
Probab=59.23  E-value=6.8  Score=20.91  Aligned_cols=33  Identities=18%  Similarity=0.246  Sum_probs=29.8

Q ss_pred             HHHHHHHHCCCCCHHHHHHHHCCCHHHHHHHHC
Q ss_conf             999999842455842434664387589999962
Q gi|254780800|r  107 AILWLIRNYPRLKDAQISHLVGTTGSTIEQIRN  139 (192)
Q Consensus       107 AI~WLiknhPeL~D~QI~KLiGTTK~TI~sIRd  139 (192)
                      .+++++..+|.++-++|++..|-+++|+..+=+
T Consensus         7 ~vL~~l~~~~~~t~~ela~~~~~~~~t~s~~i~   39 (64)
T 2nyx_A            7 RTLVILSNHGPINLATLATLLGVQPSATGRXVD   39 (64)
T ss_dssp             HHHHHHHHHCSEEHHHHHHHHTSCHHHHHHHHH
T ss_pred             HHHHHHHHCCCCCHHHHHHHHCCCHHHHHHHHH
T ss_conf             999999857997999999998887877799997


No 10 
>>3bdd_A Regulatory protein MARR; ZP_00875883.1, putative multiple antibiotic-resistance repressor (MARR), structural genomics; 2.20A {Streptococcus suis 89} (A:30-102)
Probab=58.94  E-value=11  Score=19.64  Aligned_cols=33  Identities=9%  Similarity=0.105  Sum_probs=29.1

Q ss_pred             HHHHHHHHCCCCCHHHHHHHHCCCHHHHHHHHC
Q ss_conf             999999842455842434664387589999962
Q gi|254780800|r  107 AILWLIRNYPRLKDAQISHLVGTTGSTIEQIRN  139 (192)
Q Consensus       107 AI~WLiknhPeL~D~QI~KLiGTTK~TI~sIRd  139 (192)
                      .|+..|.+||+++-++|+...|.+++|+..+=+
T Consensus         6 ~iL~~l~~~~~~~~~~la~~~~~~~stvs~~i~   38 (73)
T 3bdd_A            6 SILQTLLKDAPLHQLALQERLQIDRAAVTRHLK   38 (73)
T ss_dssp             HHHHHHHHHCSBCHHHHHHHHTCCHHHHHHHHH
T ss_pred             HHHHHHHHCCCCCHHHHHHHHCCCHHHHHHHHH
T ss_conf             999999986998999999998715758999999


No 11 
>>3e6m_A MARR family transcriptional regulator; APC88769, silicibacter pomeroyi DSS, structural genomics, PSI-2, protein structure initiative; 2.20A {Silicibacter pomeroyi} (A:1-138)
Probab=58.16  E-value=8  Score=20.48  Aligned_cols=47  Identities=17%  Similarity=0.154  Sum_probs=35.1

Q ss_pred             HHHHHHHHHCCCCCHHHHHHHHCCCHHHHHHHHCC---CCCCCCCCCCCC
Q ss_conf             79999998424558424346643875899999628---887701268377
Q gi|254780800|r  106 NAILWLIRNYPRLKDAQISHLVGTTGSTIEQIRNR---THWNTANLVPMD  152 (192)
Q Consensus       106 dAI~WLiknhPeL~D~QI~KLiGTTK~TI~sIRdR---tHWN~~Ni~P~D  152 (192)
                      -.|+|.|.++|.++-++|++..|-+++++..+=++   -.|=.---.|.|
T Consensus        56 ~~iL~~l~~~~~~t~~ela~~~~~~~~~~s~~v~~L~~~glv~r~~~~~D  105 (138)
T 3e6m_A           56 LRLLSSLSAYGELTVGQLATLGVXEQSTTSRTVDQLVDEGLAARSISDAD  105 (138)
T ss_dssp             HHHHHHHHHHSEEEHHHHHHHTTCCHHHHHHHHHHHHHTTSEEECC---C
T ss_pred             HHHHHHHHHCCCCCHHHHHHHHCCCHHHHHHHHHHHHCCCCEEEECCCCC
T ss_conf             99999998569969999999977479888299998741888775047899


No 12 
>>2nnn_A Probable transcriptional regulator; structural genomics, PSI-2, protein structure initiative, midwest center for structural genomics; 2.40A {Pseudomonas aeruginosa} (A:35-99)
Probab=54.60  E-value=11  Score=19.60  Aligned_cols=34  Identities=21%  Similarity=0.233  Sum_probs=29.8

Q ss_pred             HHHHHHHHCCCCCHHHHHHHHCCCHHHHHHHHCC
Q ss_conf             9999998424558424346643875899999628
Q gi|254780800|r  107 AILWLIRNYPRLKDAQISHLVGTTGSTIEQIRNR  140 (192)
Q Consensus       107 AI~WLiknhPeL~D~QI~KLiGTTK~TI~sIRdR  140 (192)
                      -+++.|.++|+++-.+|++..|-++++|..+=++
T Consensus         8 ~vL~~l~~~~~~t~~ela~~~~~~~~~vsr~i~~   41 (65)
T 2nnn_A            8 AALVRLGETGPCPQNQLGRLTAXDAATIKGVVER   41 (65)
T ss_dssp             HHHHHHHHHSSBCHHHHHHHTTCCHHHHHHHHHH
T ss_pred             HHHHHHHHCCCCCHHHHHHHHCCCCCCHHHHHHH
T ss_conf             9999999879939999999878785314289999


No 13 
>>3k0l_A Repressor protein; helix-turn-helix, structural genomics, PSI-2, protein structure initiative, midwest center for structural genomics, MCSG; 2.35A {Acinetobacter SP} (A:1-131)
Probab=54.42  E-value=10  Score=19.92  Aligned_cols=35  Identities=14%  Similarity=0.158  Sum_probs=30.9

Q ss_pred             HHHHHHHHHCCCCCHHHHHHHHCCCHHHHHHHHCC
Q ss_conf             79999998424558424346643875899999628
Q gi|254780800|r  106 NAILWLIRNYPRLKDAQISHLVGTTGSTIEQIRNR  140 (192)
Q Consensus       106 dAI~WLiknhPeL~D~QI~KLiGTTK~TI~sIRdR  140 (192)
                      -.|++.|.++|.++-++|++..+.++++|..+=++
T Consensus        49 ~~iL~~l~~~~~~t~~~La~~~~i~~~~vs~~v~~   83 (131)
T 3k0l_A           49 FTALSVLAAKPNLSNAKLAERSFIKPQSANKILQD   83 (131)
T ss_dssp             HHHHHHHHHCTTCCHHHHHHHHTSCGGGHHHHHHH
T ss_pred             HHHHHHHHHCCCCCHHHHHHHHCCCCCCHHHHHHH
T ss_conf             99999999679979999999858894648999999


No 14 
>>1z91_A Organic hydroperoxide resistance transcriptional regulator; OHRR, MARR family, bacterial transcription factor, DNA binding protein; 2.50A {Bacillus subtilis} (A:34-111)
Probab=52.06  E-value=12  Score=19.50  Aligned_cols=34  Identities=12%  Similarity=0.105  Sum_probs=30.2

Q ss_pred             HHHHHHHHHCCCCCHHHHHHHHCCCHHHHHHHHC
Q ss_conf             7999999842455842434664387589999962
Q gi|254780800|r  106 NAILWLIRNYPRLKDAQISHLVGTTGSTIEQIRN  139 (192)
Q Consensus       106 dAI~WLiknhPeL~D~QI~KLiGTTK~TI~sIRd  139 (192)
                      -.|++.|..+|.++-++|++..|.+++++..+=+
T Consensus        10 ~~iL~~l~~~~~~t~~~la~~~~~~~~~~s~~i~   43 (78)
T 1z91_A           10 YLALLLLWEHETLTVKKMGEQLYLDSGTLTPMLK   43 (78)
T ss_dssp             HHHHHHHHHHSEEEHHHHHHTTTCCHHHHHHHHH
T ss_pred             HHHHHHHHCCCCCCHHHHHHHHCCCHHHHHHHHH
T ss_conf             9999998858999999999997968766889999


No 15 
>>2fa5_A Transcriptional regulator MARR/EMRR family; multiple antibiotics resistance repressor, XCC structural genomics, X-RAY diffraction; 1.80A {Xanthomonas campestris} (A:1-134)
Probab=51.80  E-value=15  Score=18.88  Aligned_cols=33  Identities=9%  Similarity=0.233  Sum_probs=29.4

Q ss_pred             HHHHHHHHCCCCCHHHHHHHHCCCHHHHHHHHC
Q ss_conf             999999842455842434664387589999962
Q gi|254780800|r  107 AILWLIRNYPRLKDAQISHLVGTTGSTIEQIRN  139 (192)
Q Consensus       107 AI~WLiknhPeL~D~QI~KLiGTTK~TI~sIRd  139 (192)
                      .|++.|..+|.++-++|++.+|.++++|..+=+
T Consensus        53 ~iL~~l~~~~~~t~~~la~~~~~~~~~vsr~v~   85 (134)
T 2fa5_A           53 RVITILALYPGSSASEVSDRTAXDKVAVSRAVA   85 (134)
T ss_dssp             HHHHHHHHSTTCCHHHHHHHHTCCHHHHHHHHH
T ss_pred             HHHHHHHHCCCCCHHHHHHHHCCCHHHHHHHHH
T ss_conf             999999858997999999998848889999999


No 16 
>>1ku3_A Sigma factor SIGA; helix-turn-helix, transcription; 1.80A {Thermus aquaticus} (A:)
Probab=51.72  E-value=6.7  Score=20.96  Aligned_cols=28  Identities=21%  Similarity=0.277  Sum_probs=24.6

Q ss_pred             HCCCCCHHHHHHHHCCCHHHHHHHHCCC
Q ss_conf             4245584243466438758999996288
Q gi|254780800|r  114 NYPRLKDAQISHLVGTTGSTIEQIRNRT  141 (192)
Q Consensus       114 nhPeL~D~QI~KLiGTTK~TI~sIRdRt  141 (192)
                      ++.+++-.+|++..|.|..+|.+|..|.
T Consensus        27 ~~~~~t~~EIa~~lgiS~~~Vr~~~~ra   54 (73)
T 1ku3_A           27 DGREHTLEEVGAYFGVTRERIRQIENKA   54 (73)
T ss_dssp             TSSCCCHHHHHHHHTCCHHHHHHHHHHH
T ss_pred             CCCCCCHHHHHHHHCCCHHHHHHHHHHH
T ss_conf             9998789999999897999999999999


No 17 
>>3fm5_A Transcriptional regulator; MCSG, PF04017, PSI, MARR, structural genomics, protein structure initiative; HET: GOL; 2.00A {Rhodococcus jostii RHA1} (A:1-124)
Probab=50.48  E-value=18  Score=18.32  Aligned_cols=34  Identities=15%  Similarity=0.175  Sum_probs=27.8

Q ss_pred             HHHHHHHHHCC-CCCHHHHHHHHCCCHHHHHHHHC
Q ss_conf             79999998424-55842434664387589999962
Q gi|254780800|r  106 NAILWLIRNYP-RLKDAQISHLVGTTGSTIEQIRN  139 (192)
Q Consensus       106 dAI~WLiknhP-eL~D~QI~KLiGTTK~TI~sIRd  139 (192)
                      -.|++.|..++ .++-++|++.+|.+++||..+=+
T Consensus        42 ~~iL~~l~~~~~~~t~~ela~~~~~~~~~vs~~i~   76 (124)
T 3fm5_A           42 YSVLVLACEQAEGVNQRGVAATXGLDPSQIVGLVD   76 (124)
T ss_dssp             HHHHHHHHHSTTCCCSHHHHHHHTCCHHHHHHHHH
T ss_pred             HHHHHHHHHCCCCCCHHHHHHHHCCCHHHHHHHHH
T ss_conf             99999999859898999999997887777889999


No 18 
>>2fbh_A Transcriptional regulator PA3341; MARR, transcription regulator, APC5857, structural genomics, PSI, protein structure initiative; 1.80A {Pseudomonas aeruginosa} (A:35-101)
Probab=49.85  E-value=22  Score=17.86  Aligned_cols=32  Identities=16%  Similarity=0.309  Sum_probs=26.1

Q ss_pred             HHHHHHHHCCC-CCHHHHHHHHCCCHHHHHHHH
Q ss_conf             99999984245-584243466438758999996
Q gi|254780800|r  107 AILWLIRNYPR-LKDAQISHLVGTTGSTIEQIR  138 (192)
Q Consensus       107 AI~WLiknhPe-L~D~QI~KLiGTTK~TI~sIR  138 (192)
                      .|++.|.++|+ ++-++|++..|-++.||..+=
T Consensus         7 ~vL~~l~~~~~~~t~~~la~~~~~~~~tvs~~i   39 (67)
T 2fbh_A            7 LVLLHLARHRDSPTQRELAQSVGVEGPTLARLL   39 (67)
T ss_dssp             HHHHHHHHCSSCCBHHHHHHHHTCCHHHHHHHH
T ss_pred             HHHHHHHHCCCCCCHHHHHHHHCCCHHHHHHHH
T ss_conf             999999875999659999999897898899999


No 19 
>>1lj9_A Transcriptional regulator SLYA; HTH DNA binding protein, structural genomics, PSI, protein structure initiative; 1.60A {Enterococcus faecalis} (A:28-114)
Probab=49.30  E-value=14  Score=18.95  Aligned_cols=47  Identities=13%  Similarity=0.125  Sum_probs=34.4

Q ss_pred             HHHHHHHHCCCCCHHHHHHHHCCCHHHHHHHHCC---CCCCCCCCCCCCC
Q ss_conf             9999998424558424346643875899999628---8877012683773
Q gi|254780800|r  107 AILWLIRNYPRLKDAQISHLVGTTGSTIEQIRNR---THWNTANLVPMDP  153 (192)
Q Consensus       107 AI~WLiknhPeL~D~QI~KLiGTTK~TI~sIRdR---tHWN~~Ni~P~DP  153 (192)
                      .|+-.|.+||+++-++|++..|.+++||..+=++   .-|=.---.|.|.
T Consensus         6 ~iL~~l~~~~~~t~~~la~~l~~~~~~vs~~v~~L~~~g~i~~~~~~~D~   55 (87)
T 1lj9_A            6 LYLVRVCENPGIIQEKIAELIKVDRTTAARAIKRLEEQGFIYRQEDASNK   55 (87)
T ss_dssp             HHHHHHHHSTTEEHHHHHHHHTCCHHHHHHHHHHHHHTTSEEEEECSSCT
T ss_pred             HHHHHHHHCCCCCHHHHHHHHCCCHHHHHHHHHHHHHCCCEEECCCCCCC
T ss_conf             99999983899799999999897885899999999988996306799998


No 20 
>>3cdh_A Transcriptional regulator, MARR family; helix-turn-hleix, structural genomics, PSI-2, protein structure initiative; 2.69A {Silicibacter pomeroyi dss-3} (A:31-133)
Probab=49.03  E-value=17  Score=18.49  Aligned_cols=47  Identities=13%  Similarity=0.024  Sum_probs=34.9

Q ss_pred             HHHHHHHHCCCCCHHHHHHHHCCCHHHHHHHHC---CCCCCCCCCCCCCC
Q ss_conf             999999842455842434664387589999962---88877012683773
Q gi|254780800|r  107 AILWLIRNYPRLKDAQISHLVGTTGSTIEQIRN---RTHWNTANLVPMDP  153 (192)
Q Consensus       107 AI~WLiknhPeL~D~QI~KLiGTTK~TI~sIRd---RtHWN~~Ni~P~DP  153 (192)
                      .|++.|.++|.++-++|++..|-+|+++..+=+   +.-|=..--.|.|-
T Consensus        17 ~iL~~i~~~~~~t~~~la~~~~~~~~~vsr~i~~L~~~g~i~r~~~~~D~   66 (103)
T 3cdh_A           17 RVLACLVDNDAXXITRLAKLSLXEQSRXTRIVDQXDARGLVTRVADAKDK   66 (103)
T ss_dssp             HHHHHHSSCSCBCHHHHHHHTTCCHHHHHHHHHHHHHTTSEEECC-----
T ss_pred             HHHHHHHHCCCCCHHHHHHHHCCCCCCCCHHHHHHHHCCCEEEECCCCCC
T ss_conf             99999981889599999999688864365569998722243542367888


No 21 
>>3eco_A MEPR; mutlidrug efflux pump regulator winged helix-turn-helix motif, DNA-binding, transcription, transcription regulation; 2.40A {Staphylococcus aureus} (A:1-119)
Probab=47.31  E-value=20  Score=18.06  Aligned_cols=36  Identities=17%  Similarity=0.224  Sum_probs=29.6

Q ss_pred             HHHHHHHHHHCC--CCCHHHHHHHHCCCHHHHHHHHCC
Q ss_conf             179999998424--558424346643875899999628
Q gi|254780800|r  105 PNAILWLIRNYP--RLKDAQISHLVGTTGSTIEQIRNR  140 (192)
Q Consensus       105 PdAI~WLiknhP--eL~D~QI~KLiGTTK~TI~sIRdR  140 (192)
                      .-.+++++..|+  .++-++|++.+|.+++||..+=++
T Consensus        33 ~~~vL~~l~~~~~~~~t~~ela~~~~~~~~~vs~~v~~   70 (119)
T 3eco_A           33 QGHTLGYLYAHQQDGLTQNDIAKALQRTGPTVSNLLRN   70 (119)
T ss_dssp             HHHHHHHHHHSTTTCEEHHHHHHHHTCCHHHHHHHHHH
T ss_pred             HHHHHHHHHHCCCCCCCHHHHHHHHCCCHHHHHHHHHH
T ss_conf             99999999955999979999999989688899999999


No 22 
>>2frh_A SARA, staphylococcal accessory regulator A; winged-helix protein, divalent metal binding, transcription; 2.50A {Staphylococcus aureus} (A:)
Probab=46.22  E-value=16  Score=18.62  Aligned_cols=47  Identities=11%  Similarity=0.004  Sum_probs=35.3

Q ss_pred             HHHHHHHHHCCC--CCHHHHHHHHCCCHHHHHHHHCC---CCCCCCCCCCCC
Q ss_conf             799999984245--58424346643875899999628---887701268377
Q gi|254780800|r  106 NAILWLIRNYPR--LKDAQISHLVGTTGSTIEQIRNR---THWNTANLVPMD  152 (192)
Q Consensus       106 dAI~WLiknhPe--L~D~QI~KLiGTTK~TI~sIRdR---tHWN~~Ni~P~D  152 (192)
                      -.|++.|.++|+  ++-++|++..|-++++|..+=++   -.|=.-.-.|.|
T Consensus        40 ~~iL~~l~~~~~~~~t~~ela~~l~i~~~~vs~~v~~L~~~g~v~r~~~~~D   91 (127)
T 2frh_A           40 FAVLTYISENKEKEYYLKDIINHLNYKQPQVVKAVKILSQEDYFDKKRNEHD   91 (127)
T ss_dssp             HHHHHHHHHTCCSEEEHHHHHHHSSSHHHHHHHHHHHHHHTTSSCCBCCSSS
T ss_pred             HHHHHHHHHCCCCCCCHHHHHHHHCCCHHHHHHHHHHHHHCCHHEEEECCCC
T ss_conf             9999999846899918999999979898689999999970203134421246


No 23 
>>2pex_A Transcriptional regulator OHRR; transcription regulator; 1.90A {Xanthomonas campestris} PDB: 2pfb_A (A:44-114)
Probab=46.08  E-value=22  Score=17.85  Aligned_cols=33  Identities=6%  Similarity=0.108  Sum_probs=29.2

Q ss_pred             HHHHHHHHCCCCCHHHHHHHHCCCHHHHHHHHC
Q ss_conf             999999842455842434664387589999962
Q gi|254780800|r  107 AILWLIRNYPRLKDAQISHLVGTTGSTIEQIRN  139 (192)
Q Consensus       107 AI~WLiknhPeL~D~QI~KLiGTTK~TI~sIRd  139 (192)
                      .|++.+..+|.++-+.|++..|.+++|+..+=+
T Consensus         8 ~iL~~i~~~~~~t~~~la~~~~i~~~~~s~~i~   40 (71)
T 2pex_A            8 LVMLVLWETDERSVSEIGERLYLDSATLTPLLK   40 (71)
T ss_dssp             HHHHHHHHSCSEEHHHHHHHHTCCHHHHHHHHH
T ss_pred             HHHHHHHCCCCCCHHHHHHHHCCCHHHHHHHHH
T ss_conf             999999847998999999997968878999999


No 24 
>>2qww_A Transcriptional regulator, MARR family; YP_013417.1, multiple antibiotic-resistance repressor (MARR), structural genomics; HET: MSE; 2.07A {Listeria monocytogenes str} (A:1-131)
Probab=46.05  E-value=16  Score=18.66  Aligned_cols=35  Identities=20%  Similarity=0.184  Sum_probs=30.9

Q ss_pred             HHHHHHHHHCCCCCHHHHHHHHCCCHHHHHHHHCC
Q ss_conf             79999998424558424346643875899999628
Q gi|254780800|r  106 NAILWLIRNYPRLKDAQISHLVGTTGSTIEQIRNR  140 (192)
Q Consensus       106 dAI~WLiknhPeL~D~QI~KLiGTTK~TI~sIRdR  140 (192)
                      -.|++.|.++|.++-++|++-.|.+++||..+=++
T Consensus        44 ~~iL~~i~~~~~~t~~~la~~l~~~~s~vs~~i~~   78 (131)
T 2qww_A           44 LAXINVIYSTPGISVADLTKRLIITGSSAAANVDG   78 (131)
T ss_dssp             HHHHHHHHHSTTEEHHHHHHHHTCCHHHHHHHHHH
T ss_pred             HHHHHHHHHCCCCCHHHHHHHHCCCCCCCCHHHHH
T ss_conf             99999999879989999999978644666266579


No 25 
>>1jgs_A Multiple antibiotic resistance protein MARR; transcription regulation, DNA-binding, repressor; HET: SAL; 2.30A {Escherichia coli} (A:1-122)
Probab=45.80  E-value=19  Score=18.17  Aligned_cols=54  Identities=13%  Similarity=0.175  Sum_probs=38.2

Q ss_pred             HHHHHHHHHCCCCCHHHHHHHHCCCHHHHHHHHCC---CCCCCCCCCCCCCHHHCCC
Q ss_conf             79999998424558424346643875899999628---8877012683773322564
Q gi|254780800|r  106 NAILWLIRNYPRLKDAQISHLVGTTGSTIEQIRNR---THWNTANLVPMDPVTLGLC  159 (192)
Q Consensus       106 dAI~WLiknhPeL~D~QI~KLiGTTK~TI~sIRdR---tHWN~~Ni~P~DPV~LGLC  159 (192)
                      -.|++.|..+|.++-++|++..|-++++|..+=++   ..|=.-.-.|.|-=...+.
T Consensus        37 ~~iL~~l~~~~~~t~~~la~~l~i~~~~vs~~i~~L~~~g~i~r~~~~~D~R~~~i~   93 (122)
T 1jgs_A           37 FKVLCSIRCAACITPVELKKVLSVDLGALTRMLDRLVCKGWVERLPNPNDKRGVLVK   93 (122)
T ss_dssp             HHHHHHHHHHSSBCHHHHHHHHTCCHHHHHHHHHHHHHTTSEEEEECTTCSSCEEEE
T ss_pred             HHHHHHHHHCCCCCHHHHHHHHCCCHHHHHHHHHHHHHCCCEEEEECCCCCCEEEEE
T ss_conf             999999987799899999999897886899999999868987984468888756888


No 26 
>>1q44_A RARO47;, steroid sulphotransferase; APO, structural genomics, protein structure initiative, center for eukaryotic structural genomics, CESG; 1.90A {Arabidopsis thaliana} (A:64-326)
Probab=45.43  E-value=7.7  Score=20.58  Aligned_cols=18  Identities=33%  Similarity=0.457  Sum_probs=10.3

Q ss_pred             HHHHCCCCHHHHHHHHCC
Q ss_conf             242043479999967087
Q gi|254780800|r   15 LIDNTSLSFDQIAEFCGL   32 (192)
Q Consensus        15 LvdNT~LtF~QIa~FC~l   32 (192)
                      ||+|..=++.+|++|||+
T Consensus       168 l~~dp~~~l~~i~~FLgl  185 (263)
T 1q44_A          168 LKKQTEVEMKRIAEFLEC  185 (263)
T ss_dssp             HHHTHHHHHHHHHHHHCS
T ss_pred             HHHHHHHHHHHHHHHHCC
T ss_conf             986189899999998687


No 27 
>>2k9s_A Arabinose operon regulatory protein; activator, arabinose catabolism, carbohydrate metabolism, cytoplasm, DNA-binding, repressor, transcription; NMR {Escherichia coli} (A:47-107)
Probab=43.14  E-value=16  Score=18.73  Aligned_cols=27  Identities=15%  Similarity=0.218  Sum_probs=22.8

Q ss_pred             HHHHHHHHHHCCCCHHHHHHHHCCCHH
Q ss_conf             345430242043479999967087120
Q gi|254780800|r    9 KASAVWLIDNTSLSFDQIAEFCGLHLL   35 (192)
Q Consensus         9 kATAvWLvdNT~LtF~QIa~FC~lH~L   35 (192)
                      ..-|.+|+.+|.++..+||+-||..-.
T Consensus        12 l~~a~~~L~~~~~~i~~ia~~~Gf~~~   38 (61)
T 2k9s_A           12 ISQAKLLLSTTRMPIATVGRNVGFDDQ   38 (61)
T ss_dssp             HHHHHHHHHHCCCCHHHHHHHTTCCCH
T ss_pred             HHHHHHHHHCCCCCHHHHHHHHCCCCH
T ss_conf             999999886557519999999689989


No 28 
>>2fxa_A Protease production regulatory protein HPR; protease porduction, regulation, structural genomics, PSI, protein structure initiative; HET: PGE P6G 1PE; 2.40A {Bacillus subtilis} (A:45-125)
Probab=41.65  E-value=23  Score=17.71  Aligned_cols=33  Identities=18%  Similarity=0.185  Sum_probs=29.4

Q ss_pred             HHHHHHHHCCCCCHHHHHHHHCCCHHHHHHHHC
Q ss_conf             999999842455842434664387589999962
Q gi|254780800|r  107 AILWLIRNYPRLKDAQISHLVGTTGSTIEQIRN  139 (192)
Q Consensus       107 AI~WLiknhPeL~D~QI~KLiGTTK~TI~sIRd  139 (192)
                      .|++.|..++.++-++|++-.|-++.||..+=+
T Consensus         8 ~iL~~l~~~~~~t~~~la~~l~~~~~~vs~~i~   40 (81)
T 2fxa_A            8 HILWIAYQLNGASISEIAKFGVXHVSTAFNFSK   40 (81)
T ss_dssp             HHHHHHHHHTSEEHHHHHHHTTCCHHHHHHHHH
T ss_pred             HHHHHHHHCCCCCHHHHHHHHCCCCCCHHHHHH
T ss_conf             999999976995899999998457553779999


No 29 
>>3g3z_A NMB1585, transcriptional regulator, MARR family; transcription factor, structural genomics, oxford protein production facility; 2.10A {Neisseria meningitidis serogroup B} (A:30-120)
Probab=41.54  E-value=25  Score=17.52  Aligned_cols=52  Identities=12%  Similarity=-0.006  Sum_probs=35.9

Q ss_pred             HHHHHHHHCCCCCHHHHHHHHCCCHHHHHHHHCC---CCCCCCCCCCCCCHHHCC
Q ss_conf             9999998424558424346643875899999628---887701268377332256
Q gi|254780800|r  107 AILWLIRNYPRLKDAQISHLVGTTGSTIEQIRNR---THWNTANLVPMDPVTLGL  158 (192)
Q Consensus       107 AI~WLiknhPeL~D~QI~KLiGTTK~TI~sIRdR---tHWN~~Ni~P~DPV~LGL  158 (192)
                      -|++.|-.+|.++-++|++.+|.+++|+..+=++   .-|=..--.|.|.-...+
T Consensus         6 ~iL~~l~~~~~~t~~eia~~l~~~~~~vs~~i~~L~~~g~i~~~~~~~D~R~~~i   60 (91)
T 3g3z_A            6 AVLYTLATEGSRTQKHIGEKWSLPKQTVSGVCKTLAGQGLIEWQEGEQDRRKRLL   60 (91)
T ss_dssp             HHHHHHHHHCSBCHHHHHHHHTCCHHHHHHHHHHHHHTTSEEECCCSSCGGGSCE
T ss_pred             HHHHHHHHCCCCCHHHHHHHHCCCHHHHHHHHHHHHHCCCHHEEECCCCCCHHHH
T ss_conf             9999999869949999999989789899999999983100200026655640321


No 30 
>>3ech_A MEXR, multidrug resistance operon repressor; winged helix, helix-turn-helix, protein-peptide complex; 1.80A {Pseudomonas aeruginosa} PDB: 1lnw_A (A:1-122)
Probab=41.53  E-value=24  Score=17.55  Aligned_cols=33  Identities=15%  Similarity=0.111  Sum_probs=29.2

Q ss_pred             HHHHHHHHCCCCCHHHHHHHHCCCHHHHHHHHC
Q ss_conf             999999842455842434664387589999962
Q gi|254780800|r  107 AILWLIRNYPRLKDAQISHLVGTTGSTIEQIRN  139 (192)
Q Consensus       107 AI~WLiknhPeL~D~QI~KLiGTTK~TI~sIRd  139 (192)
                      .|+-.|.++|+++-++|++..|.++.||..+=+
T Consensus        41 ~iL~~l~~~~~~t~~~la~~~~~~~~~vs~~i~   73 (122)
T 3ech_A           41 HVLKLIDEQRGLNLQDLGRQMCRDKALITRKIR   73 (122)
T ss_dssp             HHHHHHHHTTTCCHHHHHHHHC---CHHHHHHH
T ss_pred             HHHHHHHHCCCCCHHHHHHHHCCCHHHHHHHHH
T ss_conf             999999987998999999997935726999999


No 31 
>>3cjn_A Transcriptional regulator, MARR family; structural genomics, PSI-2, protein structure initiative; 1.95A {Silicibacter pomeroyi dss-3} (A:48-125)
Probab=41.01  E-value=27  Score=17.29  Aligned_cols=34  Identities=12%  Similarity=0.076  Sum_probs=29.5

Q ss_pred             HHHHHHHHHCCCCCHHHHHHHHCCCHHHHHHHHC
Q ss_conf             7999999842455842434664387589999962
Q gi|254780800|r  106 NAILWLIRNYPRLKDAQISHLVGTTGSTIEQIRN  139 (192)
Q Consensus       106 dAI~WLiknhPeL~D~QI~KLiGTTK~TI~sIRd  139 (192)
                      -.|+..+..+++++-++|++.+|-++.||..+=+
T Consensus         8 ~~iL~~l~~~g~~t~~ela~~~~~~~~~vs~~i~   41 (78)
T 3cjn_A            8 XRALAILSAKDGLPIGTLGIFAVVEQSTLSRALD   41 (78)
T ss_dssp             HHHHHHHHHSCSEEHHHHHHHHTCCHHHHHHHHH
T ss_pred             HHHHHHHHHCCCCCHHHHHHHHCCCCCCCHHHHH
T ss_conf             9999999847998999999997888332458899


No 32 
>>3hsr_A HTH-type transcriptional regulator SARZ; helix-turn-helix, cysteine disulfide, MARR-family transcriptional regulator, DNA-binding; 1.90A {Staphylococcus aureus subsp} PDB: 3hse_A 3hrm_A (A:1-119)
Probab=40.74  E-value=14  Score=19.01  Aligned_cols=48  Identities=15%  Similarity=0.149  Sum_probs=36.0

Q ss_pred             HHHHHHHHHCCCCCHHHHHHHHCCCHHHHHHHHC---CCCCCCCCCCCCCC
Q ss_conf             7999999842455842434664387589999962---88877012683773
Q gi|254780800|r  106 NAILWLIRNYPRLKDAQISHLVGTTGSTIEQIRN---RTHWNTANLVPMDP  153 (192)
Q Consensus       106 dAI~WLiknhPeL~D~QI~KLiGTTK~TI~sIRd---RtHWN~~Ni~P~DP  153 (192)
                      -.|+++|..+|.++-++|++..|.++++|..+=+   +.-|=.-.-.|.|-
T Consensus        39 ~~iL~~l~~~~~~t~~~la~~~~i~~~~vs~~i~~L~~~gli~r~~~~~D~   89 (119)
T 3hsr_A           39 YIVLMAIENDEKLNIKKLGERVFLDSGTLTPLLKKLEKKDYVVRTREEKDE   89 (119)
T ss_dssp             HHHHHHSCTTCEEEHHHHHHHHTCCHHHHHHHHHHHHHTTSEEEEC-----
T ss_pred             HHHHHHHHHCCCCCHHHHHHHHCCCHHHHHHHHHHHHHCCCEEEEECCCCC
T ss_conf             999999987799899999999896886899999999817956985437898


No 33 
>>2hr3_A Probable transcriptional regulator; MCSG, structural genomics, PSI-2, protein structure initiative; 2.40A {Pseudomonas aeruginosa} (A:30-123)
Probab=40.53  E-value=32  Score=16.86  Aligned_cols=33  Identities=9%  Similarity=0.131  Sum_probs=27.3

Q ss_pred             HHHHHHHHCCC-CCHHHHHHHHCCCHHHHHHHHC
Q ss_conf             99999984245-5842434664387589999962
Q gi|254780800|r  107 AILWLIRNYPR-LKDAQISHLVGTTGSTIEQIRN  139 (192)
Q Consensus       107 AI~WLiknhPe-L~D~QI~KLiGTTK~TI~sIRd  139 (192)
                      .++..+.++|+ ++-++|++..|.+++|+..+=+
T Consensus        10 ~vL~~l~~~~~~~t~~~La~~~~~~~~~vs~~i~   43 (94)
T 2hr3_A           10 VVLGAIDRLGGDVTPSELAAAERXRSSNLAALLR   43 (94)
T ss_dssp             HHHHHHHHTTSCBCHHHHHHHTTCCHHHHHHHHH
T ss_pred             HHHHHHHHCCCCCCHHHHHHHHCCCHHHHHHHHH
T ss_conf             9999999769998999999997979889999999


No 34 
>>1a31_A Protein (topoisomerase I); topoisomerase I/DNA, topoisomerase I; HET: DNA 5IU PTR; 2.10A {Homo sapiens} (A:258-323,A:389-591)
Probab=40.50  E-value=8.6  Score=20.31  Aligned_cols=15  Identities=33%  Similarity=0.607  Sum_probs=12.9

Q ss_pred             CHHHHHHHHHHCCCC
Q ss_conf             134543024204347
Q gi|254780800|r    8 PKASAVWLIDNTSLS   22 (192)
Q Consensus         8 PkATAvWLvdNT~Lt   22 (192)
                      -.|||+||||..+|-
T Consensus        43 ~~~~~~~~~~~~~~~   57 (269)
T 1a31_A           43 QRAVALYFIDKLALR   57 (269)
T ss_dssp             HHHHHHHHHHHHCCC
T ss_pred             HHHHHHHHHHHHCCC
T ss_conf             999999999986223


No 35 
>>2qq9_A Diphtheria toxin repressor; regulator, DTXR, helix-turn-helix, metal ION, activation, DNA-binding, ferrous iron, cytoplasm; 1.71A {Corynebacterium diphtheriae} PDB: 2tdx_A 1ddn_A 1g3t_A 1g3s_A 1g3w_A 2qqa_A 2qqb_A 2dtr_A 1bi0_A 1bi2_A 1bi3_A 1dpr_A 1bi1_A 1fwz_A 1g3y_A 1c0w_A* 3glx_A 1p92_A 1xcv_A 1f5t_A ... (A:1-146)
Probab=40.26  E-value=32  Score=16.84  Aligned_cols=35  Identities=23%  Similarity=0.188  Sum_probs=29.2

Q ss_pred             HHHHHHHHHCCCCCHHHHHHHHCCCHHHHHHHHCC
Q ss_conf             79999998424558424346643875899999628
Q gi|254780800|r  106 NAILWLIRNYPRLKDAQISHLVGTTGSTIEQIRNR  140 (192)
Q Consensus       106 dAI~WLiknhPeL~D~QI~KLiGTTK~TI~sIRdR  140 (192)
                      .+|+.+.+.+..++-++|++..|.+++||..+=+|
T Consensus        13 ~~i~~l~~~~~~v~~~elA~~l~vs~~svt~~i~r   47 (146)
T 2qq9_A           13 RTIYELEEEGVTPLRARIAERLEQSGPTVSQTVAR   47 (146)
T ss_dssp             HHHHHHHHHTCCCBHHHHHHHHTCCHHHHHHHHHH
T ss_pred             HHHHHHHHCCCCCCHHHHHHHHCCCHHHHHHHHHH
T ss_conf             99999986599761999999978992799999999


No 36 
>>1s3j_A YUSO protein; structural genomics, MARR transcriptional regulator family, PSI, protein structure initiative; HET: MSE; 2.25A {Bacillus subtilis} (A:1-122)
Probab=39.94  E-value=26  Score=17.35  Aligned_cols=47  Identities=15%  Similarity=0.106  Sum_probs=34.4

Q ss_pred             HHHHHHHHHCCCCCHHHHHHHHCCCHHHHHHHHCC---CCCCCCCCCCCC
Q ss_conf             79999998424558424346643875899999628---887701268377
Q gi|254780800|r  106 NAILWLIRNYPRLKDAQISHLVGTTGSTIEQIRNR---THWNTANLVPMD  152 (192)
Q Consensus       106 dAI~WLiknhPeL~D~QI~KLiGTTK~TI~sIRdR---tHWN~~Ni~P~D  152 (192)
                      -.|++.+.++|.++-++|++.+|.+++++..+=++   -.|=.-.-.|.|
T Consensus        40 ~~iL~~i~~~~~~t~~ela~~~~i~~~~vsr~v~~L~~~g~v~r~~~~~D   89 (122)
T 1s3j_A           40 LFVLASLKKHGSLKVSEIAERXEVKPSAVTLXADRLEQKNLIARTHNTKD   89 (122)
T ss_dssp             HHHHHHHHHHSEEEHHHHHHHHTSCHHHHHHHHHHHHHTTSEEEEECSSC
T ss_pred             HHHHHHHHHCCCCCHHHHHHHHCCCHHHHHHHHHHHHHHHHHHHCCCCCC
T ss_conf             99999999869979999999989699899999999986242552023367


No 37 
>>3cuo_A Uncharacterized HTH-type transcriptional regulator YGAV; DNA-binding transcriptional regulator, structural genomics, PSI, MCSG; 2.00A {Escherichia coli K12} (A:10-99)
Probab=39.88  E-value=22  Score=17.77  Aligned_cols=31  Identities=19%  Similarity=0.368  Sum_probs=28.4

Q ss_pred             HHHHHHHHHCCCCCHHHHHHHHCCCHHHHHH
Q ss_conf             7999999842455842434664387589999
Q gi|254780800|r  106 NAILWLIRNYPRLKDAQISHLVGTTGSTIEQ  136 (192)
Q Consensus       106 dAI~WLiknhPeL~D~QI~KLiGTTK~TI~s  136 (192)
                      -.|++++..++.++-++|++.+|.+.+||..
T Consensus        18 ~~Il~~L~~~~~~~~~ela~~l~is~~tvs~   48 (90)
T 3cuo_A           18 LLILCMLSGSPGTSAGELTRITGLSASATSQ   48 (90)
T ss_dssp             HHHHHHHTTCCSEEHHHHHHHHCCCHHHHHH
T ss_pred             HHHHHHHHCCCCCCHHHHHHHHCCCHHHHHH
T ss_conf             9999999769994199999998929878999


No 38 
>>2fbi_A Probable transcriptional regulator; MARR, APC5816, structural genomics, PSI, protein structure initiative; 2.10A {Pseudomonas aeruginosa} (A:35-109)
Probab=38.23  E-value=28  Score=17.18  Aligned_cols=46  Identities=11%  Similarity=0.170  Sum_probs=33.9

Q ss_pred             HHHHHHHHCCCCCHHHHHHHHCCCHHHHHHHHC---CCCCCCCCCCCCC
Q ss_conf             999999842455842434664387589999962---8887701268377
Q gi|254780800|r  107 AILWLIRNYPRLKDAQISHLVGTTGSTIEQIRN---RTHWNTANLVPMD  152 (192)
Q Consensus       107 AI~WLiknhPeL~D~QI~KLiGTTK~TI~sIRd---RtHWN~~Ni~P~D  152 (192)
                      .|+..+..+|.++-.+|++..|-++++|..+=+   +..|=.-.-.|.|
T Consensus         6 ~iL~~l~~~~~~t~~~l~~~~~~~~~~vs~~i~~L~~~g~i~r~~~~~d   54 (75)
T 2fbi_A            6 RVIRILRQQGEMESYQLANQACILRPSMTGVLARLERDGIVRRWKAPKD   54 (75)
T ss_dssp             HHHHHHHHHCSEEHHHHHHHTTCCHHHHHHHHHHHHHTTSEEEEEETTE
T ss_pred             HHHHHHHHCCCCCHHHHHHHHCCCHHHHHHHHHHHHHCCCEEEEECCCC
T ss_conf             9999999869989999999988678889999999997898798531566


No 39 
>>3cta_A Riboflavin kinase; structural genomics, transferase, PSI-2, protein structure initiative; 2.20A {Thermoplasma acidophilum dsm 1728} (A:1-91)
Probab=37.77  E-value=14  Score=18.97  Aligned_cols=34  Identities=12%  Similarity=0.125  Sum_probs=29.1

Q ss_pred             HHHHHHHHCCCCCHHHHHHHHCCCHHHHHHHHCC
Q ss_conf             9999998424558424346643875899999628
Q gi|254780800|r  107 AILWLIRNYPRLKDAQISHLVGTTGSTIEQIRNR  140 (192)
Q Consensus       107 AI~WLiknhPeL~D~QI~KLiGTTK~TI~sIRdR  140 (192)
                      .|++.|.++|.++-++|++..|-+|+||..+=++
T Consensus        17 ~iL~~i~~~~~~t~~ela~~l~i~~~~vs~~i~~   50 (91)
T 3cta_A           17 KEAAEASNRAYLTSSKLADMLGISQQSASRIIID   50 (91)
T ss_dssp             HHHTTTSSEEECCHHHHHHHHTSCHHHHHHHHHH
T ss_pred             HHHHHHCCCCCCCHHHHHHHHCCCHHHHHHHHHH
T ss_conf             9856404799838999999988788799999999


No 40 
>>3hyi_A Protein DUF199/WHIA; laglidadg, homing endonuclease, helix-turn-helix, HTH, transcription regulator; 2.34A {Thermotoga maritima} PDB: 3hyj_A (A:205-295)
Probab=37.52  E-value=32  Score=16.80  Aligned_cols=31  Identities=13%  Similarity=0.064  Sum_probs=27.5

Q ss_pred             HHHHHHHHHCCCCCHHHHHHHHCCCHHHHHH
Q ss_conf             7999999842455842434664387589999
Q gi|254780800|r  106 NAILWLIRNYPRLKDAQISHLVGTTGSTIEQ  136 (192)
Q Consensus       106 dAI~WLiknhPeL~D~QI~KLiGTTK~TI~s  136 (192)
                      --++-|-..||++|=..++.+..-||++|.-
T Consensus        45 ~~~a~lRl~nPe~SL~EL~~l~~iSKSgvnh   75 (91)
T 3hyi_A           45 RRVALVRLRNKELSLRELGKKLNLTKSQIYS   75 (91)
T ss_dssp             HHHHHHHHHCTTSCHHHHHHTTTCCHHHHHH
T ss_pred             HHHHHHHHHCCCCCHHHHHHCCCCCHHHHHH
T ss_conf             9999999868777899994464878999989


No 41 
>>1dw9_A Cyanate lyase; cyanate degradation, structural genomics, PSI, protein structure initiative, midwest center for structural genomics, MCSG; HET: SO4; 1.65A {Escherichia coli} (A:8-76)
Probab=37.50  E-value=14  Score=18.93  Aligned_cols=23  Identities=39%  Similarity=0.374  Sum_probs=18.1

Q ss_pred             HCCCCHHHHHHHHCCCHHHEEEE
Q ss_conf             04347999996708712051111
Q gi|254780800|r   18 NTSLSFDQIAEFCGLHLLEVMAI   40 (192)
Q Consensus        18 NT~LtF~QIa~FC~lH~LEVq~I   40 (192)
                      ...|||++||+-+|+.+.=|-+.
T Consensus        17 ~kgltw~~iA~~iG~s~v~~aaa   39 (69)
T 1dw9_A           17 KKDLSFAEIADGTGLAEAFVTAA   39 (69)
T ss_dssp             HTTCCHHHHHTTSSSCHHHHHHH
T ss_pred             HCCCCHHHHHHHHCCCHHHHHHH
T ss_conf             83999999999969999999999


No 42 
>>1or7_A Sigma-24, RNA polymerase sigma-E factor; regulation, DNA-binding, transmembrane, transcription; 2.00A {Escherichia coli} (A:117-194)
Probab=34.56  E-value=36  Score=16.50  Aligned_cols=35  Identities=14%  Similarity=0.124  Sum_probs=28.8

Q ss_pred             HHHHHHHHHCCCCCHHHHHHHHCCCHHHHHHHHCC
Q ss_conf             79999998424558424346643875899999628
Q gi|254780800|r  106 NAILWLIRNYPRLKDAQISHLVGTTGSTIEQIRNR  140 (192)
Q Consensus       106 dAI~WLiknhPeL~D~QI~KLiGTTK~TI~sIRdR  140 (192)
                      .--.+.++++-+++..+|+...|.+.+||.+.-.|
T Consensus        29 ~r~i~~l~~~~~~s~~eIA~~lgis~~tv~~~l~r   63 (78)
T 1or7_A           29 LRMAITLRELDGLSYEEIAAIMDCPVGTVRSRIFR   63 (78)
T ss_dssp             HHHHHHHHHTTCCCHHHHHHHTTSCHHHHHHHHHH
T ss_pred             HHHHHHHHHHCCCCHHHHHHHHCCCHHHHHHHHHH
T ss_conf             99999999980979999999989499999999999


No 43 
>>2zkz_A Transcriptional repressor PAGR; protein-DNA, HTH motif, dimer, DNA-binding, plasmid, transcription regulation; 2.00A {Bacillus anthracis} (A:)
Probab=33.78  E-value=37  Score=16.42  Aligned_cols=30  Identities=23%  Similarity=0.202  Sum_probs=27.9

Q ss_pred             HHHHHHHHCCCCCHHHHHHHHCCCHHHHHH
Q ss_conf             999999842455842434664387589999
Q gi|254780800|r  107 AILWLIRNYPRLKDAQISHLVGTTGSTIEQ  136 (192)
Q Consensus       107 AI~WLiknhPeL~D~QI~KLiGTTK~TI~s  136 (192)
                      .|++++..+++++-++|++.+|.+.+||..
T Consensus        31 ~IL~~L~~~~~~~v~ela~~l~~s~stvS~   60 (99)
T 2zkz_A           31 KIVNELYKHKALNVTQIIQILKLPQSTVSQ   60 (99)
T ss_dssp             HHHHHHHHHSCEEHHHHHHHHTCCHHHHHH
T ss_pred             HHHHHHHCCCCCCHHHHHHHHCCCHHHHHH
T ss_conf             999999728994699999998869889999


No 44 
>>1we8_A Tudor and KH domain containing protein; structural genomics, riken structural genomics/proteomics initiative, RSGI, RNA binding protein; NMR {Mus musculus} (A:)
Probab=33.54  E-value=41  Score=16.18  Aligned_cols=64  Identities=9%  Similarity=0.126  Sum_probs=44.8

Q ss_pred             CCCHHHHHHHHCCCHHHHHHHHCCCCCCCCCCCCCCCHH-----HCCC-CHHHHHHHHHHHHHHHHHHHH
Q ss_conf             558424346643875899999628887701268377332-----2564-899999999997301212455
Q gi|254780800|r  117 RLKDAQISHLVGTTGSTIEQIRNRTHWNTANLVPMDPVT-----LGLC-AQIDLDREIEKCSKNTEAKYN  180 (192)
Q Consensus       117 eL~D~QI~KLiGTTK~TI~sIRdRtHWN~~Ni~P~DPV~-----LGLC-sQ~dLd~av~KA~~~~~~~~~  180 (192)
                      +++..++.+|||---.+|..||+.|.=++.-....++..     +-+. ++..+++|+..-.........
T Consensus        20 ~vp~~~v~~iIGk~G~~ik~I~~~tga~I~i~~~~~~~~~~~~~v~i~G~~~~v~~A~~~I~~~i~~~~~   89 (104)
T 1we8_A           20 SVPQRSVGRIIGRGGETIRSICKASGAKITCDKESEGTLLLSRLIKISGTQKEVAAAKHLILEKVSEDEE   89 (104)
T ss_dssp             EEETTTHHHHHTTTSHHHHHHHHHHCCEEEECCSSCCSSSSEEEEEEEEEHHHHHHHHHHHHHHHHHHHH
T ss_pred             EECHHHHHHEECCCCCCHHHHHHHCCCEEEECCCCCCCCCCCEEEEEEECHHHHHHHHHHHHHHHHCCHH
T ss_conf             9897876043692998811989865988997888888888833899994999999999999999827287


No 45 
>>1ku9_A Hypothetical protein MJ223; putative transcription factor, homodimeric winged-helix fold, structural genomics, PSI; 2.80A {Methanocaldococcus jannaschii} (A:1-88)
Probab=33.18  E-value=37  Score=16.45  Aligned_cols=33  Identities=9%  Similarity=0.085  Sum_probs=26.9

Q ss_pred             HHHHHHHHCCC-CCHHHHHHHHCCCHHHHHHHHC
Q ss_conf             99999984245-5842434664387589999962
Q gi|254780800|r  107 AILWLIRNYPR-LKDAQISHLVGTTGSTIEQIRN  139 (192)
Q Consensus       107 AI~WLiknhPe-L~D~QI~KLiGTTK~TI~sIRd  139 (192)
                      .|+-.+..+|. ++-++|++..|.+|+++..+=+
T Consensus        30 ~vL~~l~~~~g~~t~~~La~~~~~~~~~vs~~i~   63 (88)
T 1ku9_A           30 AVYAILYLSDKPLTISDIXEELKISKGNVSXSLK   63 (88)
T ss_dssp             HHHHHHHHCSSCEEHHHHHHHHTCCHHHHHHHHH
T ss_pred             HHHHHHHHCCCCCCHHHHHHHHCCCHHHHHHHHH
T ss_conf             9999999769896999999784866514999999


No 46 
>>1bia_A BIRA bifunctional protein; transcription regulation; 2.30A {Escherichia coli} (A:1-64)
Probab=32.26  E-value=33  Score=16.72  Aligned_cols=36  Identities=17%  Similarity=0.248  Sum_probs=31.6

Q ss_pred             HCCCHHHHHHHHHHCCCCCHHHHHHHHCCCHHHHHH
Q ss_conf             115717999999842455842434664387589999
Q gi|254780800|r  101 RQDRPNAILWLIRNYPRLKDAQISHLVGTTGSTIEQ  136 (192)
Q Consensus       101 RqDkPdAI~WLiknhPeL~D~QI~KLiGTTK~TI~s  136 (192)
                      ..+|-..|+=+++.++.++-.+++...|.+..||-.
T Consensus         3 ~~eR~~~Il~~L~~~~~is~~ela~~l~vS~~Ti~r   38 (64)
T 1bia_A            3 DNTVPLKLIALLANGEFHSGEQLGETLGMSRAAINK   38 (64)
T ss_dssp             CCHHHHHHHHHHTTSSCBCHHHHHHHHTSCHHHHHH
T ss_pred             CCCCHHHHHHHHHCCCCCCHHHHHHHHCCCHHHHHH
T ss_conf             764089999998569946899999997989999999


No 47 
>>1ub9_A Hypothetical protein PH1061; helix-turn-helix motif, winged helix motif, structural genomics, transcription; 2.05A {Pyrococcus horikoshii OT3} (A:)
Probab=32.23  E-value=40  Score=16.26  Aligned_cols=32  Identities=13%  Similarity=0.156  Sum_probs=28.2

Q ss_pred             HHHHHHHHCCCCCHHHHHHHHCCCHHHHHHHH
Q ss_conf             99999984245584243466438758999996
Q gi|254780800|r  107 AILWLIRNYPRLKDAQISHLVGTTGSTIEQIR  138 (192)
Q Consensus       107 AI~WLiknhPeL~D~QI~KLiGTTK~TI~sIR  138 (192)
                      .|+-.+..+|+++-++|++.+|.+++|+..+=
T Consensus        20 ~il~~l~~~~~~t~~eLa~~~~i~~~~~s~~l   51 (100)
T 1ub9_A           20 GIMIFLLPRRKAPFSQIQKVLDLTPGNLDSHI   51 (100)
T ss_dssp             HHHHHHHHHSEEEHHHHHHHTTCCHHHHHHHH
T ss_pred             HHHHHHCCCCCCCHHHHHHHHHHCCCCCHHHH
T ss_conf             99999726789619999998852687441999


No 48 
>>1bl0_A Protein (multiple antibiotic resistance protein), DNA (5'- D(*CP*CP*GP*AP*TP*GP*CP*CP*AP*CP*GP*TP*TP*TP*TP*GP*CP*TP*AP *AP*AP*TP* CP*C)-3')...; transcriptional activator; HET: DNA; 2.30A {Escherichia coli} (A:54-129)
Probab=32.22  E-value=29  Score=17.05  Aligned_cols=27  Identities=11%  Similarity=0.049  Sum_probs=23.1

Q ss_pred             HHHHHHHHHHCCCCHHHHHHHHCCCHH
Q ss_conf             345430242043479999967087120
Q gi|254780800|r    9 KASAVWLIDNTSLSFDQIAEFCGLHLL   35 (192)
Q Consensus         9 kATAvWLvdNT~LtF~QIa~FC~lH~L   35 (192)
                      ...|.+|+.+|.++...||.-||....
T Consensus        12 l~~a~~lL~~~~~~i~eIA~~~Gf~~~   38 (76)
T 1bl0_A           12 MTEIAQKLKESNEPILYLAERYGFESQ   38 (76)
T ss_dssp             HHHHHHHHHHCCCCHHHHHHHTTCSCH
T ss_pred             HHHHHHHHHHCCCCHHHHHHCCCCCCH
T ss_conf             999998863037888787233699989


No 49 
>>3deu_A Transcriptional regulator SLYA; MARR, WING-helix, transcription regulator, activator, DNA-binding, repressor; HET: SAL; 2.30A {Salmonella typhimurium} (A:1-139)
Probab=31.05  E-value=42  Score=16.08  Aligned_cols=33  Identities=15%  Similarity=0.291  Sum_probs=26.7

Q ss_pred             HHHHHHHHCC-CCCHHHHHHHHCCCHHHHHHHHC
Q ss_conf             9999998424-55842434664387589999962
Q gi|254780800|r  107 AILWLIRNYP-RLKDAQISHLVGTTGSTIEQIRN  139 (192)
Q Consensus       107 AI~WLiknhP-eL~D~QI~KLiGTTK~TI~sIRd  139 (192)
                      .|++.|..++ .++-++|++..|.+++||..+=+
T Consensus        57 ~iL~~l~~~~~~~t~~~La~~~~i~~~~vs~~i~   90 (139)
T 3deu_A           57 VTLHNIHQLPPDQSQIQLAKAIGIEQPSLVRTLD   90 (139)
T ss_dssp             HHHHHHHHSCSSEEHHHHHHHHTSCHHHHHHHHH
T ss_pred             HHHHHHHHCCCCCCHHHHHHHHCCCHHHHHHHHH
T ss_conf             9999999769899999999998969989999999


No 50 
>>3bja_A Transcriptional regulator, MARR family, putative; NP_978771.1, putative MARR-like transcription regulator, structural genomics; 2.38A {Bacillus cereus atcc 10987} (A:1-118)
Probab=30.63  E-value=24  Score=17.58  Aligned_cols=47  Identities=11%  Similarity=0.182  Sum_probs=36.0

Q ss_pred             HHHHHHHHHCCCCCHHHHHHHHCCCHHHHHHHHC---CCCCCCCCCCCCC
Q ss_conf             7999999842455842434664387589999962---8887701268377
Q gi|254780800|r  106 NAILWLIRNYPRLKDAQISHLVGTTGSTIEQIRN---RTHWNTANLVPMD  152 (192)
Q Consensus       106 dAI~WLiknhPeL~D~QI~KLiGTTK~TI~sIRd---RtHWN~~Ni~P~D  152 (192)
                      -.|++.|..||.++-++|++.+|-+++||..+=+   +..|=...-.|.|
T Consensus        36 ~~iL~~l~~~~~~t~~ela~~l~i~~~tvs~~i~~L~~~gli~r~~~~~D   85 (118)
T 3bja_A           36 FGVIQVLAKSGKVSXSKLIENXGCVPSNXTTXIQRXKRDGYVXTEKNPND   85 (118)
T ss_dssp             HHHHHHHHHSCSEEHHHHHHHCSSCCTTHHHHHHHHHHTTSEEEEECSSC
T ss_pred             HHHHHHHHHCCCCCHHHHHHHHCCCCCHHHHHHHHHHHHHCEEEEECCCC
T ss_conf             99999999869989999999868574618799999843115487645888


No 51 
>>2bv6_A MGRA, HTH-type transcriptional regulator MGRA; multidrug resistance regulator, virulence determinant, transcriptional factors; 2.8A {Staphylococcus aureus} (A:33-108)
Probab=30.41  E-value=24  Score=17.64  Aligned_cols=33  Identities=6%  Similarity=0.129  Sum_probs=28.2

Q ss_pred             HHHHHHHHCCCCCHHHHHHHHCCCHHHHHHHHC
Q ss_conf             999999842455842434664387589999962
Q gi|254780800|r  107 AILWLIRNYPRLKDAQISHLVGTTGSTIEQIRN  139 (192)
Q Consensus       107 AI~WLiknhPeL~D~QI~KLiGTTK~TI~sIRd  139 (192)
                      .++..|..++.++-++|++..+.+++++..+=+
T Consensus         9 ~iL~~l~~~~~~t~~~la~~~~~~~~~~s~~i~   41 (76)
T 2bv6_A            9 LVLTILWDESPVNVKKVVTELALDTGTVSPLLK   41 (76)
T ss_dssp             HHHHHHHHSSEEEHHHHHHHTTCCTTTHHHHHH
T ss_pred             HHHHHHHCCCCCCHHHHHHHHCCCHHHHHHHHH
T ss_conf             999999807994999999997988737999999


No 52 
>>1p4x_A Staphylococcal accessory regulator A homologue; winged-helix protein, transcription; 2.20A {Staphylococcus aureus} (A:156-250)
Probab=29.68  E-value=38  Score=16.38  Aligned_cols=54  Identities=9%  Similarity=0.035  Sum_probs=37.5

Q ss_pred             HHHHHHHHCCC--CCHHHHHHHHCCCHHHHHHHHC---CCCCCCCCCCCCCCHHHCCCC
Q ss_conf             99999984245--5842434664387589999962---888770126837733225648
Q gi|254780800|r  107 AILWLIRNYPR--LKDAQISHLVGTTGSTIEQIRN---RTHWNTANLVPMDPVTLGLCA  160 (192)
Q Consensus       107 AI~WLiknhPe--L~D~QI~KLiGTTK~TI~sIRd---RtHWN~~Ni~P~DPV~LGLCs  160 (192)
                      .|++.|..+|+  ++-++|++..|.+++++..+=+   +.-|=.---.|.|--..-++-
T Consensus         7 ~iL~~l~~~~~~~~t~~~la~~l~~~~~~~s~~i~~L~~~G~I~r~~~~~D~R~~~i~l   65 (95)
T 1p4x_A            7 TILAIITSQNKNIVLLKDLIETIHHKYPQTVRALNNLKKQGYLIKERSTEDERKILIHM   65 (95)
T ss_dssp             HHHHHHHTTTTCCEEHHHHHHHSSSCHHHHHHHHHHHHHHTSSEEEECSSSTTCEEEEC
T ss_pred             HHHHHHHHCCCCCCCHHHHHHHHCCCHHHHHHHHHHHHHCCCEEEECCCCCCCEEEEEE
T ss_conf             99999985999967699999997888515999999999889989727998887059898


No 53 
>>2d1h_A ST1889, 109AA long hypothetical transcriptional regulator; helix-turn-helix, intermolecular and intramolecular S-S bonds; 2.05A {Sulfolobus tokodaii str} (A:)
Probab=29.30  E-value=48  Score=15.74  Aligned_cols=34  Identities=9%  Similarity=0.179  Sum_probs=29.0

Q ss_pred             HHHHHHHHHCCCCCHHHHHHHHCCCHHHHHHHHC
Q ss_conf             7999999842455842434664387589999962
Q gi|254780800|r  106 NAILWLIRNYPRLKDAQISHLVGTTGSTIEQIRN  139 (192)
Q Consensus       106 dAI~WLiknhPeL~D~QI~KLiGTTK~TI~sIRd  139 (192)
                      ..|..++.+.+.++-.+|++..|.+++||..+=+
T Consensus        25 ~vll~~l~~~~~~t~~eLa~~l~i~~~tvs~~l~   58 (109)
T 2d1h_A           25 AVLLKXVEIEKPITSEELADIFKLSKTTVENSLK   58 (109)
T ss_dssp             HHHHHHHHHCSCEEHHHHHHHHTCCHHHHHHHHH
T ss_pred             HHHHHHHHCCCCCCHHHHHHHHCCCCCHHHHHHH
T ss_conf             9999999849698999999997887234999999


No 54 
>>2b9s_A Topoisomerase I-like protein; vanadate complex, isomerase/DNA complex; HET: DNA; 2.27A {Leishmania donovani} (A:234-297,A:364-432)
Probab=29.21  E-value=17  Score=18.44  Aligned_cols=15  Identities=33%  Similarity=0.592  Sum_probs=12.2

Q ss_pred             CHHHHHHHHHHCCCC
Q ss_conf             134543024204347
Q gi|254780800|r    8 PKASAVWLIDNTSLS   22 (192)
Q Consensus         8 PkATAvWLvdNT~Lt   22 (192)
                      ..|||+||||..+|-
T Consensus        43 Q~AvA~YlIDklALR   57 (133)
T 2b9s_A           43 QRAVAMYFIDRLALR   57 (133)
T ss_dssp             HHHHHHHHHHHHCCC
T ss_pred             HHHHHHHHHHHHCEE
T ss_conf             999999999974750


No 55 
>>2r09_A Cytohesin-3; autoinhibition, GRP1, PIP3, ARF, 3-phosphoinositide, pleckstrin homology domain, coiled coil, guanine-nucleotide releasing factor; HET: 4IP PGE PE5; 1.90A {Mus musculus} (A:43-89)
Probab=28.01  E-value=51  Score=15.60  Aligned_cols=35  Identities=11%  Similarity=0.200  Sum_probs=21.9

Q ss_pred             CCHHHHHHHHHHCCCCCHHHHHHHHCCCHHHHHHH
Q ss_conf             57179999998424558424346643875899999
Q gi|254780800|r  103 DRPNAILWLIRNYPRLKDAQISHLVGTTGSTIEQI  137 (192)
Q Consensus       103 DkPdAI~WLiknhPeL~D~QI~KLiGTTK~TI~sI  137 (192)
                      +-|.+||-++++.|-|.-.+|...+|.-++--.+|
T Consensus         2 ~~p~~iA~FL~~~~~LdK~~IGeyLg~~~~~n~~V   36 (47)
T 2r09_A            2 SSPEDVAQFLYKGEGLNKTVIGDYLGERDDFNIKV   36 (47)
T ss_dssp             CSHHHHHHHHHHCTTCCHHHHHHHHHCCSHHHHHH
T ss_pred             CCHHHHHHHHHHCCCCCHHHHHHHHCCCCHHHHHH
T ss_conf             99999999997688989999999968994468999


No 56 
>>1zd1_A Sulfotransferase 4A1; SGC, SULT4A1, structural genomics, structural genomics consortium; 2.24A {Homo sapiens} (A:44-284)
Probab=27.56  E-value=43  Score=16.06  Aligned_cols=65  Identities=11%  Similarity=-0.016  Sum_probs=33.8

Q ss_pred             HHHHHCCCCHHHHHHHHCCCHHH--EEEECC---HHHHCCCCC-CCCCCC-------CCCCHHHHHHHHHCCCCCEEC
Q ss_conf             02420434799999670871205--111124---146389611-474012-------784899999976164877040
Q gi|254780800|r   14 WLIDNTSLSFDQIAEFCGLHLLE--VMAIAD---GESLQGIKG-FNLISS-------GQLSAEEIALGEKDKNYKLKI   78 (192)
Q Consensus        14 WLvdNT~LtF~QIa~FC~lH~LE--Vq~IAD---Geva~gi~g-~dPi~~-------gqLt~eEI~~ce~d~~~~L~l   78 (192)
                      .|++|..-++.+|++|+|+..-+  +..+.+   .+...+... ..++..       ..||.+++++++..-...|+.
T Consensus       155 dL~~~p~~~l~~i~~Flg~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~rk~~~~~wk~~l~~~~~~~~~~~~~~~l~~  232 (241)
T 1zd1_A          155 DMHRDLVTMVEQLARFLGVSCDKAQLEALTEHCHQLVDQCCNAEALPVGRGRVGLWKDIFTVSMNEKFDLVYKQKMGK  232 (241)
T ss_dssp             HHHHCHHHHHHHHHHHTTCCCCHHHHHHHHHHHHHHHHTTBCTTSSBSSTTCTTGGGGTCCHHHHHHHHHHHHHHHTT
T ss_pred             HHHCCHHHHHHHHHHHHCCCCCHHHHHHHHHHHHHHHHHHCCCCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHHHCC
T ss_conf             333144999999999818999989999999860377766404457866389879744428899999999999999658


No 57 
>>1b4a_A Arginine repressor; helix turn helix; 2.50A {Bacillus stearothermophilus} (A:1-68)
Probab=25.50  E-value=56  Score=15.33  Aligned_cols=36  Identities=14%  Similarity=0.123  Sum_probs=31.1

Q ss_pred             HHCCCHHHHHHHHHHCCCCCHHHHHHHH-----CCCHHHHH
Q ss_conf             3115717999999842455842434664-----38758999
Q gi|254780800|r  100 KRQDRPNAILWLIRNYPRLKDAQISHLV-----GTTGSTIE  135 (192)
Q Consensus       100 kRqDkPdAI~WLiknhPeL~D~QI~KLi-----GTTK~TI~  135 (192)
                      +.++|-.+|.=||++|+..+-.+++.+.     ..|-.||.
T Consensus         2 ~k~~R~~~I~~ll~~~~~~tq~eL~~~L~~~G~~vSqaTis   42 (68)
T 1b4a_A            2 NKGQRHIKIREIIMSNDIETQDELVDRLREAGFNVTQATVS   42 (68)
T ss_dssp             --CHHHHHHHHHHHHSCCCSHHHHHHHHHHTTCCCCHHHHH
T ss_pred             CHHHHHHHHHHHHHHCCCCCHHHHHHHHHHCCCCCCHHHHH
T ss_conf             87999999999998589778999999999859752389999


No 58 
>>1fx7_A Iron-dependent repressor IDER; DTXR, iron-dependent regulator, signaling protein; 2.00A {Mycobacterium tuberculosis} (A:1-141)
Probab=25.00  E-value=58  Score=15.27  Aligned_cols=34  Identities=24%  Similarity=0.202  Sum_probs=25.4

Q ss_pred             HHHHHHHHCCCCCHHHHHHHHCCCHHHHHHHHCC
Q ss_conf             9999998424558424346643875899999628
Q gi|254780800|r  107 AILWLIRNYPRLKDAQISHLVGTTGSTIEQIRNR  140 (192)
Q Consensus       107 AI~WLiknhPeL~D~QI~KLiGTTK~TI~sIRdR  140 (192)
                      +|+-+...++.++-++|++-.|-+++||..+-+|
T Consensus        14 ~I~~l~~~~~~v~~~eLA~~l~vs~~tvt~~l~k   47 (141)
T 1fx7_A           14 TIYDLEEEGVTPLRARIAERLDQSGPTVSQTVSR   47 (141)
T ss_dssp             HHHHHHHHTSCCCHHHHHHHHTCCHHHHHHHHHH
T ss_pred             HHHHHHHCCCCCCHHHHHHHHCCCCHHHHHHHHH
T ss_conf             9999984499751999999978991689999999


No 59 
>>1q1h_A TFE, transcription factor E, TFE; TFIIE, transcription initiation, preinitiation complex, RNA polymerase II, transcription bubble; 2.90A {Sulfolobus solfataricus} (A:)
Probab=24.84  E-value=58  Score=15.25  Aligned_cols=31  Identities=13%  Similarity=0.252  Sum_probs=25.1

Q ss_pred             HHH-HHHHCCCCCHHHHHHHHCCCHHHHHHHH
Q ss_conf             999-9984245584243466438758999996
Q gi|254780800|r  108 ILW-LIRNYPRLKDAQISHLVGTTGSTIEQIR  138 (192)
Q Consensus       108 I~W-LiknhPeL~D~QI~KLiGTTK~TI~sIR  138 (192)
                      |.= |+++|.+++|-+|++++|-..+.|-.|-
T Consensus        23 I~~~L~~~~~~l~e~~la~~~~i~~k~vR~iL   54 (110)
T 1q1h_A           23 VLRILLDKGTEMTDEEIANQLNIKVNDVRKKL   54 (110)
T ss_dssp             HHHHHHHHCSCBCHHHHHHTTTSCHHHHHHHH
T ss_pred             HHHHHHHCCCCCCHHHHHHHHCCCHHHHHHHH
T ss_conf             99999986988789999989599999999999


No 60 
>>1hsj_A Fusion protein consisting of staphylococcus accessary regulator protein R and maltose...; novel fold for DNA binding; HET: GLC; 2.30A {Escherichia coli} (A:401-487)
Probab=24.26  E-value=59  Score=15.22  Aligned_cols=47  Identities=11%  Similarity=0.001  Sum_probs=33.0

Q ss_pred             HHHHHHHHCC--CCCHHHHHHHHCCCHHHHHHHHCC---CCCCCCCCCCCCC
Q ss_conf             9999998424--558424346643875899999628---8877012683773
Q gi|254780800|r  107 AILWLIRNYP--RLKDAQISHLVGTTGSTIEQIRNR---THWNTANLVPMDP  153 (192)
Q Consensus       107 AI~WLiknhP--eL~D~QI~KLiGTTK~TI~sIRdR---tHWN~~Ni~P~DP  153 (192)
                      .|+.++.+||  .++-++|++.+|.+++|+..+=++   .-|=.--..|.|.
T Consensus         8 ~iL~~l~~~~~~~~t~~~l~~~l~~~~~~vs~~i~~L~~~g~i~r~~~~~D~   59 (87)
T 1hsj_A            8 YILNHILRSESNEISSKEIAKCSEFKPYYLTKALQKLKDLKLLSKKRSLQDE   59 (87)
T ss_dssp             HHHHHHHTCSCSEEEHHHHHHSSCCCHHHHHHHHHHHHTTTTSCCEECCSSS
T ss_pred             HHHHHHHHHCCCCCCHHHHHHHCCCCCCCHHHHHHHHHHCCCCCCCCCCCCC
T ss_conf             9999999861578649999864167811204889887751210111357651


No 61 
>>3e97_A Transcriptional regulator, CRP/FNR family; YP_604437.1, structural genomics, joint center for structural genomics, JCSG; HET: MSE; 1.86A {Deinococcus geothermalis dsm 11300} (A:120-231)
Probab=24.14  E-value=34  Score=16.67  Aligned_cols=30  Identities=13%  Similarity=0.000  Sum_probs=13.8

Q ss_pred             CCHHHHHHHHCCCHHHEEEECCHHHHCCCC
Q ss_conf             479999967087120511112414638961
Q gi|254780800|r   21 LSFDQIAEFCGLHLLEVMAIADGESLQGIK   50 (192)
Q Consensus        21 LtF~QIa~FC~lH~LEVq~IADGeva~gi~   50 (192)
                      +|.++||++||++.-.|.-+-..=...|+.
T Consensus        57 lt~~~lA~~~g~sr~tvsr~l~~L~~~G~I   86 (112)
T 3e97_A           57 LGTQDIXARTSSSRETVSRVLKRLEAHNIL   86 (112)
T ss_dssp             CCHHHHHHHHTCCHHHHHHHHHHHHHTTSE
T ss_pred             CCHHHHHHHHCCCHHHHHHHHHHHHHCCCE
T ss_conf             579999999699999999999999978989


No 62 
>>1rp3_A RNA polymerase sigma factor sigma-28 (FLIA); transcription; 2.30A {Aquifex aeolicus} (A:90-239)
Probab=23.76  E-value=61  Score=15.12  Aligned_cols=34  Identities=15%  Similarity=0.348  Sum_probs=28.9

Q ss_pred             HHHHHHHHCCCCCHHHHHHHHCCCHHHHHHHHCC
Q ss_conf             9999998424558424346643875899999628
Q gi|254780800|r  107 AILWLIRNYPRLKDAQISHLVGTTGSTIEQIRNR  140 (192)
Q Consensus       107 AI~WLiknhPeL~D~QI~KLiGTTK~TI~sIRdR  140 (192)
                      .-...++++-+++-.+|+...|.+.+||.+...|
T Consensus       104 r~vi~l~~~~g~s~~EIA~~lgis~~tV~~~l~r  137 (150)
T 1rp3_A          104 KLVIQLIFYEELPAKEVAKILETSVSRVSQLKAK  137 (150)
T ss_dssp             HHHHHHHHTSCCCHHHHHHHTTSCHHHHHHHHHH
T ss_pred             HHHHHHHHCCCCCHHHHHHHHCCCHHHHHHHHHH
T ss_conf             9999999269999999999989599999999999


No 63 
>>2zq5_A Putative uncharacterized protein; sulfotransferase fold; 2.00A {Mycobacterium tuberculosis} (A:88-384)
Probab=23.45  E-value=27  Score=17.33  Aligned_cols=16  Identities=19%  Similarity=0.270  Sum_probs=7.9

Q ss_pred             HHHHCCCHHHHHHHHC
Q ss_conf             4664387589999962
Q gi|254780800|r  124 SHLVGTTGSTIEQIRN  139 (192)
Q Consensus       124 ~KLiGTTK~TI~sIRd  139 (192)
                      -.|+..+..|+..|-+
T Consensus       231 EdL~~~p~~~~~~I~~  246 (297)
T 2zq5_A          231 HDLIADPLGTVADIYR  246 (297)
T ss_dssp             HHHHHCHHHHHHHHHH
T ss_pred             HHHHHCHHHHHHHHHH
T ss_conf             9988699999999999


No 64 
>>1gt0_D Transcription factor SOX-2; POU factors, SOX proteins; 2.6A {Mus musculus} (D:)
Probab=22.24  E-value=36  Score=16.48  Aligned_cols=20  Identities=20%  Similarity=0.587  Sum_probs=16.9

Q ss_pred             HHHHCCCCCHHHHHHHHCCC
Q ss_conf             99842455842434664387
Q gi|254780800|r  111 LIRNYPRLKDAQISHLVGTT  130 (192)
Q Consensus       111 LiknhPeL~D~QI~KLiGTT  130 (192)
                      +..-||+++-.+|+|+||..
T Consensus        21 i~~~~p~~~~~eisk~ig~~   40 (80)
T 1gt0_D           21 MAQENPKMHNSEISKRLGAE   40 (80)
T ss_dssp             HHTTSTTSCHHHHHHHHHHH
T ss_pred             HHHHCCCCCHHHHHHHHHHH
T ss_conf             99897999999999999999


No 65 
>>1ldj_A Cullin homolog 1, CUL-1; cullin, ROC1, HRT1, zinc ring finger, ligase, ubiquitin, ubiquitination, SCF; 3.00A {Homo sapiens} (A:590-659)
Probab=21.47  E-value=35  Score=16.62  Aligned_cols=35  Identities=3%  Similarity=-0.024  Sum_probs=23.8

Q ss_pred             HHCCCCHHHHHHHHCCCHHHEEEECCHHHHCCCCC
Q ss_conf             20434799999670871205111124146389611
Q gi|254780800|r   17 DNTSLSFDQIAEFCGLHLLEVMAIADGESLQGIKG   51 (192)
Q Consensus        17 dNT~LtF~QIa~FC~lH~LEVq~IADGeva~gi~g   51 (192)
                      +..+|||++|.+-+||..-|++..---=+...|..
T Consensus        11 ~~~~lT~~eI~~~t~l~~~~L~~~L~sL~~~kil~   45 (70)
T 1ldj_A           11 TEDAYTVQQLTDSTQIKMDILAQVLQILLKSKLLV   45 (70)
T ss_dssp             SSSEEEHHHHHHHTCCCHHHHHHHHHHHHHTTTEE
T ss_pred             CCCCCCHHHHHHHHCCCHHHHHHHHHHHHHCCEEE
T ss_conf             88887899999777909999999999997589677


No 66 
>>2cu1_A Mitogen-activated protein kinase kinase kinase 2; PB1 domain, MAPK/ERK kinase kinase 2, MEK kinase 2, MEKK 2, signaling protein; NMR {Homo sapiens} (A:)
Probab=21.28  E-value=63  Score=15.03  Aligned_cols=24  Identities=25%  Similarity=0.396  Sum_probs=17.8

Q ss_pred             HHHCCCCHHHHHHHHHHHHHHHHH
Q ss_conf             322564899999999997301212
Q gi|254780800|r  154 VTLGLCAQIDLDREIEKCSKNTEA  177 (192)
Q Consensus       154 V~LGLCsQ~dLd~av~KA~~~~~~  177 (192)
                      +..-|-+|.|||+||+--.++...
T Consensus        54 L~IPl~~Q~DLDkAielLDrS~~m   77 (103)
T 2cu1_A           54 LVIPLTTQDDLDKAVELLDRSIHM   77 (103)
T ss_dssp             SCEECCSHHHHHHHHHHHHHCSSC
T ss_pred             EEEECCCHHHHHHHHHHHCCCCCC
T ss_conf             788625677889999987059664


No 67 
>>2jrh_A Mitogen-activated protein kinase kinase kinase 3; kinase signaling domain, transferase; NMR {Homo sapiens} PDB: 2pph_A (A:)
Probab=21.08  E-value=69  Score=14.79  Aligned_cols=23  Identities=26%  Similarity=0.385  Sum_probs=17.5

Q ss_pred             HHHCCCCHHHHHHHHHHHHHHHH
Q ss_conf             32256489999999999730121
Q gi|254780800|r  154 VTLGLCAQIDLDREIEKCSKNTE  176 (192)
Q Consensus       154 V~LGLCsQ~dLd~av~KA~~~~~  176 (192)
                      +..-|-+|.|||+||+--.++..
T Consensus        50 L~IPl~~Q~DLDkAiellDrs~~   72 (94)
T 2jrh_A           50 LSILLKNQDDLDKAIDILDRSSS   72 (94)
T ss_dssp             CEEECCSHHHHHHHHHHHHHSTT
T ss_pred             EEEECCCHHHHHHHHHHHCCCCC
T ss_conf             78852567788999998716955


No 68 
>>2npt_B Mitogen-activated protein kinase kinase kinase 2; MAP2K5, MEK5, MKK5, PRKMK5, MAP kinase kinase 5, PHOX, PHOX-domain, MAP3K2; 1.75A {Homo sapiens} (B:)
Probab=21.07  E-value=63  Score=15.01  Aligned_cols=23  Identities=26%  Similarity=0.423  Sum_probs=17.2

Q ss_pred             HHHCCCCHHHHHHHHHHHHHHHH
Q ss_conf             32256489999999999730121
Q gi|254780800|r  154 VTLGLCAQIDLDREIEKCSKNTE  176 (192)
Q Consensus       154 V~LGLCsQ~dLd~av~KA~~~~~  176 (192)
                      ...-|-+|.|||+||+--.++..
T Consensus        66 L~IPl~~Q~DLDkAiellDrs~~   88 (100)
T 2npt_B           66 LVIPLTTQDDLDKAVELLDRSIH   88 (100)
T ss_dssp             EEEECCCHHHHHHHHHHHHHCSS
T ss_pred             EEEECCCHHHHHHHHHHHCCCCC
T ss_conf             78862567778999998705966


No 69 
>>3f27_D Transcription factor SOX-17; protein-DNA complex, HMG domain, endodermal, activator, alternative splicing, DNA-binding, nucleus; HET: DNA; 2.75A {Mus musculus} PDB: 2yul_A (D:)
Probab=20.93  E-value=49  Score=15.72  Aligned_cols=20  Identities=30%  Similarity=0.677  Sum_probs=17.0

Q ss_pred             HHHHCCCCCHHHHHHHHCCC
Q ss_conf             99842455842434664387
Q gi|254780800|r  111 LIRNYPRLKDAQISHLVGTT  130 (192)
Q Consensus       111 LiknhPeL~D~QI~KLiGTT  130 (192)
                      +...||.++..+|++++|.-
T Consensus        25 i~~~~P~~~~~eisk~~g~~   44 (83)
T 3f27_D           25 LAQQNPDLHNAELSKMLGKS   44 (83)
T ss_dssp             HHHHCSSSCHHHHHHHHHHH
T ss_pred             HHHHHCCCCHHHHHHHHHHH
T ss_conf             99884469999999999999


No 70 
>>2ia0_A Putative HTH-type transcriptional regulator PF0864; ASNC, PSI, structural genomics, southeast collaboratory for structural genomics; 2.37A {Pyrococcus furiosus} (A:1-66)
Probab=20.76  E-value=70  Score=14.75  Aligned_cols=32  Identities=28%  Similarity=0.314  Sum_probs=28.4

Q ss_pred             HHHHHHHHHCCCCCHHHHHHHHCCCHHHHHHH
Q ss_conf             79999998424558424346643875899999
Q gi|254780800|r  106 NAILWLIRNYPRLKDAQISHLVGTTGSTIEQI  137 (192)
Q Consensus       106 dAI~WLiknhPeL~D~QI~KLiGTTK~TI~sI  137 (192)
                      -.|+.++...|.++-.+|++-+|.+..||..-
T Consensus        20 ~~IL~~L~~~~r~s~~ela~~lgls~~tv~~r   51 (66)
T 2ia0_A           20 RNILRLLKKDARLTISELSEQLKKPESTIHFR   51 (66)
T ss_dssp             HHHHHHHHHCTTCCHHHHHHHHTSCHHHHHHH
T ss_pred             HHHHHHHHHCCCCCHHHHHHHHCCCHHHHHHH
T ss_conf             99999999848999999999989099999999


No 71 
>>2c60_A Human mitogen-activated protein kinase kinase kinase 3 isoform 2; MAP3K3, MAP/ERK kinase kinase 3, MAPKKK3, MEKK3, serine threonine phosphorylation; HET: MSE; 1.25A {Homo sapiens} (A:)
Probab=20.43  E-value=67  Score=14.86  Aligned_cols=22  Identities=27%  Similarity=0.400  Sum_probs=17.0

Q ss_pred             HHHCCCCHHHHHHHHHHHHHHH
Q ss_conf             3225648999999999973012
Q gi|254780800|r  154 VTLGLCAQIDLDREIEKCSKNT  175 (192)
Q Consensus       154 V~LGLCsQ~dLd~av~KA~~~~  175 (192)
                      +..-|-+|.|||+||+--.++.
T Consensus        77 L~IPl~~Q~DLDkAiellDrs~   98 (111)
T 2c60_A           77 LSILLKNQDDLDKAIDILDRSS   98 (111)
T ss_dssp             CEEECCSHHHHHHHHHHHHHCS
T ss_pred             EEEECCCHHHHHHHHHHHCCCC
T ss_conf             7885256778899999870696


Done!