RPS-BLAST 2.2.22 [Sep-27-2009] Database: CddB 21,608 sequences; 5,994,473 total letters Searching..................................................done Query= gi|254780800|ref|YP_003065213.1| hypothetical protein CLIBASIA_03455 [Candidatus Liberibacter asiaticus str. psy62] (192 letters) >gnl|CDD|148070 pfam06242, DUF1013, Protein of unknown function (DUF1013). Family of uncharacterized proteins found in Proteobacteria. Length = 141 Score = 232 bits (594), Expect = 4e-62 Identities = 88/140 (62%), Positives = 108/140 (77%) Query: 35 LEVMAIADGESLQGIKGFNLISSGQLSAEEIALGEKDKNYKLKISKPKSYILESTKKKKR 94 LEV IADGE QGIKG + I++GQL+ EEI EKD NY+LK+SK K + +K R Sbjct: 1 LEVQGIADGEVAQGIKGLDPIANGQLTREEIERCEKDPNYRLKLSKSKVIVPRRKRKGPR 60 Query: 95 YTPVSKRQDRPNAILWLIRNYPRLKDAQISHLVGTTGSTIEQIRNRTHWNTANLVPMDPV 154 YTPVSKRQDRP+AI WL+RN+P L DAQIS L+GTT +TIE IR+R+HWN+AN+ P DPV Sbjct: 61 YTPVSKRQDRPDAIAWLLRNHPELSDAQISKLIGTTKTTIEAIRDRSHWNSANIKPRDPV 120 Query: 155 TLGLCAQIDLDREIEKCSKN 174 TLGLC+QIDLD +EK +K Sbjct: 121 TLGLCSQIDLDAAVEKAAKR 140 Score = 26.8 bits (60), Expect = 3.9 Identities = 9/33 (27%), Positives = 17/33 (51%), Gaps = 4/33 (12%) Query: 146 ANLVPMDPVTLGLCAQIDLDREIEKCSKNTEAK 178 + +DP+ G Q+ + EIE+C K+ + Sbjct: 13 QGIKGLDPIANG---QLTRE-EIERCEKDPNYR 41 >gnl|CDD|181228 PRK08097, ligB, NAD-dependent DNA ligase LigB; Reviewed. Length = 562 Score = 28.7 bits (65), Expect = 1.1 Identities = 13/30 (43%), Positives = 16/30 (53%), Gaps = 2/30 (6%) Query: 25 QIAEFCGLHLLEVMAIADGESLQGIKGFNL 54 Q+ F L EV A+AD + QGI GF Sbjct: 535 QLIAF--LQHPEVKALADWLAAQGITGFEP 562 >gnl|CDD|165997 PLN02356, PLN02356, phosphateglycerate kinase. Length = 423 Score = 28.4 bits (63), Expect = 1.4 Identities = 17/52 (32%), Positives = 31/52 (59%), Gaps = 4/52 (7%) Query: 83 SYILESTKKKKRYTPVSKRQDRPNAILWLIRNYPRLKDAQISHLVGTTGSTI 134 S++L +++K+K P+SK++ R N ++ I N P ++ I+ L TG I Sbjct: 23 SFLLCNSRKRKTKKPLSKKKPR-NGLIDAIGNTPLIR---INSLSEATGCEI 70 >gnl|CDD|183432 PRK12316, PRK12316, peptide synthase; Provisional. Length = 5163 Score = 26.8 bits (59), Expect = 4.0 Identities = 11/27 (40%), Positives = 15/27 (55%), Gaps = 4/27 (14%) Query: 135 EQIRNRTHWNTANLV----PMDPVTLG 157 + I R HWN + L+ P+DP LG Sbjct: 1113 QAIPQRQHWNQSLLLQARQPLDPDRLG 1139 >gnl|CDD|148871 pfam07506, RepB, RepB plasmid partitioning protein. This family includes proteins with sequence similarity to the RepB partitioning protein of the large Ti (tumour-inducing) plasmids of Agrobacterium tumefaciens. Length = 185 Score = 26.3 bits (58), Expect = 4.6 Identities = 7/64 (10%), Positives = 13/64 (20%), Gaps = 3/64 (4%) Query: 55 ISSGQLSAEEIALGEKDKNYKLKISKPKSYILESTKKKKRYTPVSKRQDRPNAILWLIRN 114 +S + E L + + + +L RN Sbjct: 121 VSGKSAARPEGKWARLQTAVLAIYEDEGRQTLHLKAAE---GYLDRLLFNTRFGRYLARN 177 Query: 115 YPRL 118 L Sbjct: 178 LDEL 181 >gnl|CDD|179998 PRK05294, carB, carbamoyl phosphate synthase large subunit; Reviewed. Length = 1066 Score = 26.6 bits (60), Expect = 4.8 Identities = 7/21 (33%), Positives = 13/21 (61%) Query: 120 DAQISHLVGTTGSTIEQIRNR 140 DA+I+ L+G T + ++R Sbjct: 495 DARIAKLLGVTEDEVRKLRKA 515 >gnl|CDD|184272 PRK13719, PRK13719, conjugal transfer transcriptional regulator TraJ; Provisional. Length = 217 Score = 26.2 bits (58), Expect = 5.4 Identities = 7/20 (35%), Positives = 8/20 (40%) Query: 150 PMDPVTLGLCAQIDLDREIE 169 PMD QIDL + Sbjct: 3 PMDRRERATIRQIDLPESLT 22 >gnl|CDD|183386 PRK11930, PRK11930, putative bifunctional UDP-N-acetylmuramoyl-tripeptide:D-alanyl-D-alanine ligase/alanine racemase; Provisional. Length = 822 Score = 26.1 bits (58), Expect = 5.5 Identities = 7/25 (28%), Positives = 10/25 (40%) Query: 115 YPRLKDAQISHLVGTTGSTIEQIRN 139 Q V T +TI QI++ Sbjct: 684 SASGAGQQALRNVSTLKTTILQIKH 708 >gnl|CDD|181818 PRK09393, ftrA, transcriptional activator FtrA; Provisional. Length = 322 Score = 26.1 bits (58), Expect = 5.6 Identities = 10/24 (41%), Positives = 16/24 (66%) Query: 15 LIDNTSLSFDQIAEFCGLHLLEVM 38 L+++++LS DQIAE G E + Sbjct: 278 LLESSALSIDQIAERAGFGSEESL 301 >gnl|CDD|114630 pfam05918, API5, Apoptosis inhibitory protein 5 (API5). This family consists of apoptosis inhibitory protein 5 (API5) sequences from several organisms. Apoptosis or programmed cell death is a physiological form of cell death that occurs in embryonic development and organ formation. It is characterized by biochemical and morphological changes such as DNA fragmentation and cell volume shrinkage. API5 is an anti apoptosis gene located in human chromosome 11, whose expression prevents the programmed cell death that occurs upon the deprivation of growth factors. Length = 543 Score = 25.8 bits (56), Expect = 7.6 Identities = 13/58 (22%), Positives = 25/58 (43%), Gaps = 1/58 (1%) Query: 100 KRQDRPNAILWLIRNYPRLKDAQISHLVGTTGSTIEQIRNRT-HWNTANLVPMDPVTL 156 +R A++ LIR + + + T +T EQIR + + ++P+ L Sbjct: 112 ERDAVHKALMSLIRQDTKASITALFQHISATLTTDEQIREKVLKFIRDKVLPLKGELL 169 >gnl|CDD|132372 TIGR03329, Phn_aa_oxid, putative aminophosphonate oxidoreductase. This clade of sequences are members of the pfam01266 family of FAD-dependent oxidoreductases. Characterized proteins within this family include glycerol-3-phosphate dehydrogenase (1.1.99.5), sarcosine oxidase beta subunit (1.5.3.1) and a number of deaminating amino acid oxidases (1.4.-.-). These genes have been consistently observed in a genomic context including genes for the import and catabolism of 2-aminoethylphosphonate (AEP). If the substrate of this oxidoreductase is AEP itself, then it is probably acting in the manner of a deaminating oxidase, resulting in the same product (phosphonoacetaldehyde) as the transaminase PhnW (TIGR02326), but releasing ammonia instead of coupling to pyruvate:alanine. Alternatively, it is reasonable to suppose that the various ABC cassette transporters which are also associated with these loci allow the import of phosphonates closely related to AEP which may not be substrates for PhnW. Length = 460 Score = 25.5 bits (56), Expect = 8.7 Identities = 9/28 (32%), Positives = 14/28 (50%) Query: 6 LMPKASAVWLIDNTSLSFDQIAEFCGLH 33 L +A A L+ + + +IA FC H Sbjct: 85 LFGEAEAARLVKASEQAVLEIAAFCEQH 112 Database: CddB Posted date: Feb 4, 2011 9:54 PM Number of letters in database: 5,994,473 Number of sequences in database: 21,608 Lambda K H 0.316 0.132 0.383 Gapped Lambda K H 0.267 0.0819 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 21608 Number of Hits to DB: 3,054,160 Number of extensions: 179998 Number of successful extensions: 337 Number of sequences better than 10.0: 1 Number of HSP's gapped: 337 Number of HSP's successfully gapped: 22 Length of query: 192 Length of database: 5,994,473 Length adjustment: 88 Effective length of query: 104 Effective length of database: 4,092,969 Effective search space: 425668776 Effective search space used: 425668776 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 54 (24.4 bits)