RPS-BLAST 2.2.22 [Sep-27-2009]

Database: mmdb70 
           33,805 sequences; 4,956,049 total letters

Searching..................................................done

Query= gi|254780800|ref|YP_003065213.1| hypothetical protein
CLIBASIA_03455 [Candidatus Liberibacter asiaticus str. psy62]
         (192 letters)



>1bia_A BIRA bifunctional protein; transcription regulation; 2.30A
           {Escherichia coli} (A:1-64)
          Length = 64

 Score = 28.1 bits (63), Expect = 0.76
 Identities = 7/35 (20%), Positives = 14/35 (40%)

Query: 100 KRQDRPNAILWLIRNYPRLKDAQISHLVGTTGSTI 134
           K    P  ++ L+ N       Q+   +G + + I
Sbjct: 2   KDNTVPLKLIALLANGEFHSGEQLGETLGMSRAAI 36


>2o8b_B DNA mismatch repair protein MSH6; DNA damage response,
          somatic hypermutation, protein-DNA complex, DNA
          mispair, cancer, ABC transporter ATPase; HET: DNA ADP;
          2.75A {Homo sapiens} PDB: 2o8c_B* 2o8d_B* 2o8e_B*
          2o8f_B* (B:625-671)
          Length = 47

 Score = 26.2 bits (58), Expect = 2.8
 Identities = 10/19 (52%), Positives = 13/19 (68%), Gaps = 1/19 (5%)

Query: 79 SKPKSYILESTKK-KKRYT 96
          + P+ Y L+STKK  KRY 
Sbjct: 27 NLPEEYELKSTKKGCKRYW 45


>3foa_A Tail sheath protein GP18; alpha-beta, viral structural
           protein, bacteriophage T4, viral protein; 3.50A
           {Enterobacteria phage T4} PDB: 3foh_A 3foi_A
           (A:1-91,A:347-510)
          Length = 255

 Score = 26.2 bits (57), Expect = 3.0
 Identities = 7/33 (21%), Positives = 11/33 (33%)

Query: 144 NTANLVPMDPVTLGLCAQIDLDREIEKCSKNTE 176
           +    VP+     GLCA+ D   +         
Sbjct: 208 DVNRWVPLAADIAGLCARTDNVSQTWMSPAGYN 240


>2b4v_A RNA editing complex protein MP57; tbret2, TBMP57, terminal
           uridylyl transferase, editosome, transferase/RNA binding
           protein complex; 1.80A {Trypanosoma brucei} (A:141-239)
          Length = 99

 Score = 26.1 bits (57), Expect = 3.2
 Identities = 10/24 (41%), Positives = 15/24 (62%), Gaps = 1/24 (4%)

Query: 92  KKRYTPVSKRQDR-PNAILWLIRN 114
           + RYTP+S+ +DR     L  +RN
Sbjct: 1   RARYTPLSEEEDRKARTALLDVRN 24


>3cwc_A Putative glycerate kinase 2; structural genomics, center
          for structural genomics of infectious diseases, csgid,
          IDP122, transferase; 2.23A {Salmonella typhimurium LT2}
          (A:48-280)
          Length = 233

 Score = 25.5 bits (56), Expect = 4.2
 Identities = 7/33 (21%), Positives = 15/33 (45%), Gaps = 1/33 (3%)

Query: 5  PLMPKASAVWLI-DNTSLSFDQIAEFCGLHLLE 36
          PL  + +A + +  +   +F + A   GL  + 
Sbjct: 24 PLGHRVNAFYGLSGDARSAFIEXAAASGLEQVP 56


>2fgy_A Carboxysome shell polypeptide; beta class of carbonic
          anhydrase, lyase; 2.20A {Halothiobacillus neapolitanus}
          (A:176-420)
          Length = 245

 Score = 25.5 bits (56), Expect = 4.3
 Identities = 9/32 (28%), Positives = 15/32 (46%), Gaps = 1/32 (3%)

Query: 23 FDQIAEFCGLHLLEVMAIADGESLQGIKGFNL 54
                 CG H +++   ADG  L+G+  + L
Sbjct: 9  AIGFFLDCGFHAVDISPCADGR-LKGLLPYIL 39


>1hqm_D DNA-directed RNA polymerase; transferase, transcription, 3D-
           structure; 3.30A {Thermus aquaticus} (D:135-193)
          Length = 59

 Score = 25.0 bits (54), Expect = 5.9
 Identities = 8/22 (36%), Positives = 10/22 (45%), Gaps = 7/22 (31%)

Query: 81  PKSYILESTKKKKRYTPVSKRQ 102
           PK  +L+         PV KRQ
Sbjct: 3   PKGAVLDGV-------PVEKRQ 17


>1z6r_A MLC protein; transcriptional repressor, ROK family protein,
           DNA binding protein, helix-turn-helix,
           phosphotransferase system, metalloprotein; 2.70A
           {Escherichia coli} (A:1-82,A:382-406)
          Length = 107

 Score = 25.2 bits (55), Expect = 6.1
 Identities = 8/47 (17%), Positives = 17/47 (36%)

Query: 91  KKKRYTPVSKRQDRPNAILWLIRNYPRLKDAQISHLVGTTGSTIEQI 137
           + +       +Q    A+  LI     +    +S L     ++I +I
Sbjct: 4   ENQPGHIDQIKQTNAGAVYRLIDQLGPVSRIDLSRLAQLAPASITKI 50


>1z05_A Transcriptional regulator, ROK family; structural genomics,
           PSI, protein structure initiative; 2.00A {Vibrio
           cholerae o1 biovar eltor str} (A:1-105,A:403-429)
          Length = 132

 Score = 24.5 bits (53), Expect = 8.9
 Identities = 5/34 (14%), Positives = 11/34 (32%)

Query: 107 AILWLIRNYPRLKDAQISHLVGTTGSTIEQIRNR 140
            +  LI     +    +S       ++I +I   
Sbjct: 43  RVYKLIDQKGPISRIDLSKESELAPASITKITRE 76


>2yzc_A Uricase; oxidoreductase, allantoate; HET: 1AL; 1.88A
           {Arthrobacter globiformis} (A:)
          Length = 302

 Score = 24.3 bits (53), Expect = 9.4
 Identities = 12/44 (27%), Positives = 17/44 (38%)

Query: 4   RPLMPKASAVWLIDNTSLSFDQIAEFCGLHLLEVMAIADGESLQ 47
           R L    SA W  +   + FD +       LL+  A     +LQ
Sbjct: 180 RILATDVSARWRYNTVEVDFDAVYASVRGLLLKAFAETHSLALQ 223


  Database: mmdb70
    Posted date:  Jun 20, 2010  3:12 AM
  Number of letters in database: 4,956,049
  Number of sequences in database:  33,805
  
Lambda     K      H
   0.316    0.132    0.383 

Gapped
Lambda     K      H
   0.267   0.0546    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 33805
Number of Hits to DB: 1,381,618
Number of extensions: 56180
Number of successful extensions: 178
Number of sequences better than 10.0: 1
Number of HSP's gapped: 177
Number of HSP's successfully gapped: 24
Length of query: 192
Length of database: 4,956,049
Length adjustment: 84
Effective length of query: 108
Effective length of database: 2,116,429
Effective search space: 228574332
Effective search space used: 228574332
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.6 bits)
S2: 52 (24.2 bits)