RPS-BLAST 2.2.22 [Sep-27-2009]

Database: pdb70 
           24,244 sequences; 5,693,230 total letters

Searching..................................................done

Query= gi|254780800|ref|YP_003065213.1| hypothetical protein
CLIBASIA_03455 [Candidatus Liberibacter asiaticus str. psy62]
         (192 letters)



>2pff_B Fatty acid synthase subunit beta; fatty acid synthase,
           acyl-carrier-protein, beta-ketoacyl reductase,
           beta-ketoacyl synthase, dehydratase; 4.00A
           {Saccharomyces cerevisiae}
          Length = 2006

 Score = 42.6 bits (100), Expect = 5e-05
 Identities = 46/243 (18%), Positives = 84/243 (34%), Gaps = 95/243 (39%)

Query: 14  WLIDNTS-----------LSFD-----QIAEFC------GLH---LLEVMAIADGESLQG 48
           WL + ++           +S       Q+A +       G     L   +  A G S QG
Sbjct: 218 WLENPSNTPDKDYLLSIPISCPLIGVIQLAHYVVTAKLLGFTPGELRSYLKGATGHS-QG 276

Query: 49  IKGFNLISSGQLSAEEIALGEKD------KNYKLKISKPKSYIL-----ESTKKKKRYT- 96
           +          ++A  +A+ E D       + +  I+     +L        +     + 
Sbjct: 277 L----------VTA--VAIAETDSWESFFVSVRKAIT-----VLFFIGVRCYEAYPNTSL 319

Query: 97  PVSKRQD-------RPNAILWLIRNYPRLKDAQISHLVGTTGSTI---EQIRNRTHW--- 143
           P S  +D        P+ +L  I N  +    Q+   V  T S +   +Q+         
Sbjct: 320 PPSILEDSLENNEGVPSPML-SISNLTQ---EQVQDYVNKTNSHLPAGKQV----EISLV 371

Query: 144 NTA-NLV---PMDPVTL-GLCAQIDLDREIEKCSKNTEAK--YN--KAVDD-----ISTP 189
           N A NLV   P  P +L GL   +   R+ +  S   +++  ++  K         +++P
Sbjct: 372 NGAKNLVVSGP--PQSLYGLNLTL---RKAKAPSGLDQSRIPFSERKLKFSNRFLPVASP 426

Query: 190 FSS 192
           F S
Sbjct: 427 FHS 429


>3maj_A DNA processing chain A; MCSG, PSI-2, structural genomics, protein
           structure initiati midwest center for structural
           genomics; HET: DNA; 2.05A {Rhodopseudomonas palustris}
          Length = 382

 Score = 28.0 bits (62), Expect = 1.5
 Identities = 5/26 (19%), Positives = 10/26 (38%)

Query: 15  LIDNTSLSFDQIAEFCGLHLLEVMAI 40
           L+  + +  D +    G+    V  I
Sbjct: 336 LLGPSPVGIDDLIRLSGISPAVVRTI 361


>3k1f_M Transcription initiation factor IIB; RNA polymerase II, TFIIB,
          transcription factor, DNA-binding, DNA-directed RNA
          polymerase; 4.30A {Saccharomyces cerevisiae}
          Length = 197

 Score = 27.6 bits (61), Expect = 1.7
 Identities = 6/47 (12%), Positives = 16/47 (34%), Gaps = 8/47 (17%)

Query: 1  MCQRPLMPKASAVWLIDNTSLSFDQIAEFCGLHLLEVMAIAD---GE 44
          M  R  + K +     +   L+       C ++  ++  +     G+
Sbjct: 1  MMTRESIDKRAGRRGPN---LNIVLTCPECKVYPPKI--VERFSEGD 42


>3c37_A Peptidase, M48 family; X-RAY, Q74D82, GSR143A, structural
          genomics, PSI-2, protein structure initiative; 1.70A
          {Geobacter sulfurreducens pca}
          Length = 253

 Score = 27.6 bits (60), Expect = 2.0
 Identities = 12/26 (46%), Positives = 15/26 (57%), Gaps = 4/26 (15%)

Query: 45 SLQGIKGFNLISSGQLSAEEIALGEK 70
          S+  IKGFN+IS      +E  LG K
Sbjct: 4  SMTDIKGFNMIS----IEQEKELGNK 25


>1z05_A Transcriptional regulator, ROK family; structural genomics, PSI,
           protein structure initiative; 2.00A {Vibrio cholerae o1
           biovar eltor str} SCOP: a.4.5.63 c.55.1.10 c.55.1.10
          Length = 429

 Score = 26.0 bits (56), Expect = 5.8
 Identities = 5/31 (16%), Positives = 11/31 (35%)

Query: 107 AILWLIRNYPRLKDAQISHLVGTTGSTIEQI 137
            +  LI     +    +S       ++I +I
Sbjct: 43  RVYKLIDQKGPISRIDLSKESELAPASITKI 73


>1uf2_A Core protein P3; virus components, icosahedral virus; 3.50A {Rice
           dwarf virus} SCOP: e.28.1.2
          Length = 1019

 Score = 25.3 bits (55), Expect = 8.0
 Identities = 16/78 (20%), Positives = 35/78 (44%), Gaps = 8/78 (10%)

Query: 16  IDNTSLSFDQIAEFCGLHLLEVMAIADGESLQGIKGFNLISSGQLSAEEIALGEKDKNYK 75
           +DNTS +      F GL      +I+  E ++ + G ++ + G++ A ++ +  K   + 
Sbjct: 828 VDNTSYTDSLSDMFNGLR-----SISSSEFVRSVNGRSVFTEGRIDAIKVNMRAK---FD 879

Query: 76  LKISKPKSYILESTKKKK 93
           L+    +    +    KK
Sbjct: 880 LQFITEEGGYSKPPNVKK 897


>3fsy_A Tetrahydrodipicolinate N-succinyltransferase; beta helix, L beta H
           domain, acyltransferase; HET: SCA; 1.97A {Mycobacterium
           tuberculosis} PDB: 3fsx_A*
          Length = 332

 Score = 25.4 bits (55), Expect = 8.6
 Identities = 9/36 (25%), Positives = 13/36 (36%)

Query: 134 IEQIRNRTHWNTANLVPMDPVTLGLCAQIDLDREIE 169
            E I  RT   + + V  DP    L   +   R + 
Sbjct: 65  TETIAVRTVIGSLDDVAADPYDAYLRLHLLSHRLVA 100


>3hsi_A Phosphatidylserine synthase; CDP- diacylglycerol--serine
           O-phosphatidyltransferase, structural genomics, PSI-2;
           HET: MSE; 2.20A {Haemophilus influenzae}
          Length = 458

 Score = 25.1 bits (54), Expect = 9.4
 Identities = 11/50 (22%), Positives = 24/50 (48%)

Query: 70  KDKNYKLKISKPKSYILESTKKKKRYTPVSKRQDRPNAILWLIRNYPRLK 119
             +    ++ K ++ I + TK  K YT + +    P  +  L++ + R+K
Sbjct: 400 PQQQLLAQVEKEQNQIRQHTKVLKHYTELEELNQYPEPVQKLLKKFARIK 449


  Database: pdb70
    Posted date:  Jan 26, 2011 11:21 AM
  Number of letters in database: 5,693,230
  Number of sequences in database:  24,244
  
Lambda     K      H
   0.316    0.132    0.383 

Gapped
Lambda     K      H
   0.267   0.0576    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 24244
Number of Hits to DB: 1,586,990
Number of extensions: 67968
Number of successful extensions: 191
Number of sequences better than 10.0: 1
Number of HSP's gapped: 191
Number of HSP's successfully gapped: 13
Length of query: 192
Length of database: 5,693,230
Length adjustment: 87
Effective length of query: 105
Effective length of database: 3,584,002
Effective search space: 376320210
Effective search space used: 376320210
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.6 bits)
S2: 54 (24.9 bits)