HHsearch alignment for GI: 254780801 and conserved domain: pfam01168

>pfam01168 Ala_racemase_N Alanine racemase, N-terminal domain.
Probab=99.98  E-value=2.9e-31  Score=231.66  Aligned_cols=204  Identities=26%  Similarity=0.324  Sum_probs=175.6

Q ss_pred             HHHHHHHHHHHHHHHCCCCHHHCEEEEECCC----CCHHHHHHHHHCCCCCCCCCCCHHHHHHHHCCCCCCCCCEEEECC
Q ss_conf             9999999999999981989644189987189----999999999972981000121000111100000125873023024
Q gi|254780801|r    6 KLQVFKQKIENSAILAKRPKDSVSLVAVSKM----VDSKKIRVALSCGQVIFAENKLQEAKKKWIPLRKEWDVQLRFIGS   81 (222)
Q Consensus         6 nl~~i~~~I~~a~~~~gR~~~~v~LiaVtK~----~~~e~I~~~~~~G~~~fGENrvQE~~~K~~~l~~~~~i~wHfIG~   81 (222)
T Consensus         2 dl~~l~~Ni~~i~~~~~~---~~~l~aVvK~nayG~g~~~i~~~~~~g~~~f~v~~~~Ea~~lr~~~---~~~~Il~l~~   75 (216)
T pfam01168         2 DLDALRHNIRALRERAGR---PVKLMAVVKANAYGHGAVRVARALAAGADGFGVATLQEALELREAG---ITAPILVLGF   75 (216)
T ss_pred             CHHHHHHHHHHHHHHCCC---CCEEEEEECCCCCCCCHHHHHHHHHHCCCCEEEEEHHHHHHHHHHC---CCCCEEEECC
T ss_conf             779999999999985699---9989999777777866999999998089855980099999999818---9870777368


Q ss_pred             CCCCHHHHHCCCCHHCCCCCCCCHHHHHHHHHHHHCCCEEEEEEEECCCCCCCCCCCCCHHHHHHHHHHCCCCCCHHHHE
Q ss_conf             43200132011100001222220013443333331143036889700466563465700012223443104311001110
Q gi|254780801|r   82 LQSNKVSEIVSLFDVIETVSREKTASLLSLEMIKQSRFLPVYIQVNTGYEIQKSGIMPNQTKDFVILCRQKYQLNVEGLM  161 (222)
Q Consensus        82 LQsNKvk~i~~~~~~Ihsvds~~~a~~L~~~~~~~~~~~~vliQVN~~~e~~K~G~~p~el~~l~~~i~~~~~L~i~GLM  161 (222)
T Consensus        76 ~~~~~~~~~~~~-~~~~~v~s~~~l~~l~~~~~~~~~~~~v~l~vdtG--m~R~G~~~~~~~~~~~~i~-~~~l~~~Gi~  151 (216)
T pfam01168        76 FPPEELALAAEY-DLIPTVDSLEQAEALSAAAAKLGRPLRVHLKVDTG--MGRLGFTPEELPALAEALA-LPGLRLEGLM  151 (216)
T ss_pred             CCHHHHHHHHHC-CCEEEECCHHHHHHHHHHHHHCCCCEEEEEEEEEC--CCCCCCCHHHHHHHHHHHH-CCCCCEEEEE
T ss_conf             996999999985-97899788999999999999859980899999747--8768879999999999985-5999678999


Q ss_pred             ECCCCCCCC----HHHHHHHHHHHHHCC--CCEECCCCCHHHHHHH-HHCCCEEEECHHHCCCCC
Q ss_conf             115433452----058999999988758--9472247773489999-808988997113238999
Q gi|254780801|r  162 CIPPAMGNP----KPHFYLLSEIARECK--LTKLSMGMTRDFELAI-ASGATSVRIGSGIFGERP  219 (222)
Q Consensus       162 ti~p~~~d~----~~~F~~l~~l~~~~~--~~~LSmGMS~D~~~Ai-~~Gst~vRiGs~iFG~R~  219 (222)
T Consensus       152 tH~~~~d~~~~~~~~q~~~f~~~~~~l~~~~~~~s~~nS~~~~~~~~~~~~~~vR~G~~lyG~~p  216 (216)
T pfam01168       152 THFACADEPDATNRAQLARFRELADALEAAGPVLSLGNSAALLLAPLHEGFDMVRPGIALYGARP  216 (216)
T ss_pred             EECCCCCCCCHHHHHHHHHHHHHHHHHHCCCCEEEHHCCHHHHHHHHHCCCCEEEECHHHCCCCC
T ss_conf             50588789758999999999999998656899985116188985375648997830721118798