BLASTP 2.2.22 [Sep-27-2009] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= gi|254780801|ref|YP_003065214.1| hypothetical protein CLIBASIA_03460 [Candidatus Liberibacter asiaticus str. psy62] (222 letters) Database: las_proteome 1233 sequences; 328,796 total letters Searching...................................................done >gi|254780801|ref|YP_003065214.1| hypothetical protein CLIBASIA_03460 [Candidatus Liberibacter asiaticus str. psy62] Length = 222 Score = 454 bits (1169), Expect = e-130, Method: Compositional matrix adjust. Identities = 222/222 (100%), Positives = 222/222 (100%) Query: 1 MSLGNKLQVFKQKIENSAILAKRPKDSVSLVAVSKMVDSKKIRVALSCGQVIFAENKLQE 60 MSLGNKLQVFKQKIENSAILAKRPKDSVSLVAVSKMVDSKKIRVALSCGQVIFAENKLQE Sbjct: 1 MSLGNKLQVFKQKIENSAILAKRPKDSVSLVAVSKMVDSKKIRVALSCGQVIFAENKLQE 60 Query: 61 AKKKWIPLRKEWDVQLRFIGSLQSNKVSEIVSLFDVIETVSREKTASLLSLEMIKQSRFL 120 AKKKWIPLRKEWDVQLRFIGSLQSNKVSEIVSLFDVIETVSREKTASLLSLEMIKQSRFL Sbjct: 61 AKKKWIPLRKEWDVQLRFIGSLQSNKVSEIVSLFDVIETVSREKTASLLSLEMIKQSRFL 120 Query: 121 PVYIQVNTGYEIQKSGIMPNQTKDFVILCRQKYQLNVEGLMCIPPAMGNPKPHFYLLSEI 180 PVYIQVNTGYEIQKSGIMPNQTKDFVILCRQKYQLNVEGLMCIPPAMGNPKPHFYLLSEI Sbjct: 121 PVYIQVNTGYEIQKSGIMPNQTKDFVILCRQKYQLNVEGLMCIPPAMGNPKPHFYLLSEI 180 Query: 181 ARECKLTKLSMGMTRDFELAIASGATSVRIGSGIFGERPCQT 222 ARECKLTKLSMGMTRDFELAIASGATSVRIGSGIFGERPCQT Sbjct: 181 ARECKLTKLSMGMTRDFELAIASGATSVRIGSGIFGERPCQT 222 >gi|254780752|ref|YP_003065165.1| penicillin binding peptidoglycan synthetase protein [Candidatus Liberibacter asiaticus str. psy62] Length = 817 Score = 24.3 bits (51), Expect = 1.8, Method: Compositional matrix adjust. Identities = 16/56 (28%), Positives = 25/56 (44%), Gaps = 11/56 (19%) Query: 43 RVALSCGQVIFAENKLQEAKKKWIPLRKEWDVQLRFIGSLQSNKVSEIVSLFDVIE 98 R AL G + + +N K I L+K+W N ++ I +L+DV E Sbjct: 310 RKALQNGLINYDQNDGFRGPIKRIDLKKDW-----------GNTLASIPTLYDVPE 354 >gi|254781193|ref|YP_003065606.1| putative DNA polymerase from bacteriophage origin [Candidatus Liberibacter asiaticus str. psy62] Length = 675 Score = 23.9 bits (50), Expect = 2.2, Method: Compositional matrix adjust. Identities = 14/34 (41%), Positives = 19/34 (55%), Gaps = 1/34 (2%) Query: 3 LGNKL-QVFKQKIENSAILAKRPKDSVSLVAVSK 35 L N+L Q F+Q IEN + R + V LV + K Sbjct: 520 LWNELHQAFEQTIENGKAIIARKRRDVPLVYMKK 553 >gi|254780576|ref|YP_003064989.1| ABC transporter related protein [Candidatus Liberibacter asiaticus str. psy62] Length = 597 Score = 23.9 bits (50), Expect = 2.3, Method: Compositional matrix adjust. Identities = 23/101 (22%), Positives = 45/101 (44%), Gaps = 21/101 (20%) Query: 58 LQEAKKKWIPL--RKEWDVQLRFIGSLQSNKVSEIVSLF----------DVIETVSREKT 105 L+ KK W + WD+++R IG++ S S+ V L +IE + KT Sbjct: 9 LRTLKKLWPYMWPANRWDLKVRIIGAMFSVIASKFVILGIPFLLKWVTESLIEQSTASKT 68 Query: 106 ASLLSLEMIKQSRFLPVYIQVNTGYEIQKSGIMPNQTKDFV 146 S L++ ++ I + + ++ ++ N +DF+ Sbjct: 69 TSYLTIGIV---------ILITSYGTMRVVNLISNHIRDFL 100 >gi|254781040|ref|YP_003065453.1| hypothetical protein CLIBASIA_04710 [Candidatus Liberibacter asiaticus str. psy62] Length = 143 Score = 23.9 bits (50), Expect = 2.6, Method: Compositional matrix adjust. Identities = 11/24 (45%), Positives = 14/24 (58%) Query: 83 QSNKVSEIVSLFDVIETVSREKTA 106 SNK EIV +F+VI + TA Sbjct: 53 HSNKGREIVGIFEVITCTYPDPTA 76 >gi|254780151|ref|YP_003064564.1| tRNA-specific 2-thiouridylase MnmA [Candidatus Liberibacter asiaticus str. psy62] Length = 408 Score = 23.5 bits (49), Expect = 2.9, Method: Compositional matrix adjust. Identities = 14/31 (45%), Positives = 17/31 (54%) Query: 16 NSAILAKRPKDSVSLVAVSKMVDSKKIRVAL 46 NS L K PKD +VA+S VDS + L Sbjct: 10 NSLDLDKNPKDMRVVVAMSGGVDSSVVAALL 40 >gi|254780191|ref|YP_003064604.1| alanyl-tRNA synthetase [Candidatus Liberibacter asiaticus str. psy62] Length = 898 Score = 23.1 bits (48), Expect = 4.2, Method: Compositional matrix adjust. Identities = 14/35 (40%), Positives = 20/35 (57%), Gaps = 2/35 (5%) Query: 146 VILCRQKYQLNVEGLMCIPPAMGNPKPHFYLLSEI 180 +I ++K QLNVE L C A N H ++SE+ Sbjct: 772 LIHAKRKLQLNVEDLSCHKIADVNFMSH--IISEV 804 >gi|254780276|ref|YP_003064689.1| dihydrodipicolinate synthase [Candidatus Liberibacter asiaticus str. psy62] Length = 292 Score = 22.7 bits (47), Expect = 5.5, Method: Compositional matrix adjust. Identities = 9/37 (24%), Positives = 18/37 (48%) Query: 135 SGIMPNQTKDFVILCRQKYQLNVEGLMCIPPAMGNPK 171 +GI N T++ V L + + + + L+ + P P Sbjct: 75 AGIGSNNTRESVELAQYAHSIGADALLVVIPYYNKPN 111 >gi|254780285|ref|YP_003064698.1| arginyl-tRNA synthetase [Candidatus Liberibacter asiaticus str. psy62] Length = 586 Score = 22.3 bits (46), Expect = 7.5, Method: Compositional matrix adjust. Identities = 7/23 (30%), Positives = 15/23 (65%) Query: 53 FAENKLQEAKKKWIPLRKEWDVQ 75 ++ L ++KW+P+ K++ VQ Sbjct: 217 YSSELLNFPEEKWLPIVKDYSVQ 239 >gi|254780634|ref|YP_003065047.1| NOL1/NOP2/SUN family signature protein [Candidatus Liberibacter asiaticus str. psy62] Length = 429 Score = 21.9 bits (45), Expect = 9.4, Method: Compositional matrix adjust. Identities = 9/22 (40%), Positives = 12/22 (54%) Query: 70 KEWDVQLRFIGSLQSNKVSEIV 91 K+W + RF GS +S IV Sbjct: 29 KDWGMSHRFAGSSDRASISNIV 50 Database: las_proteome Posted date: Jun 5, 2011 6:30 PM Number of letters in database: 328,796 Number of sequences in database: 1233 Lambda K H 0.320 0.134 0.378 Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 123,684 Number of Sequences: 1233 Number of extensions: 4448 Number of successful extensions: 25 Number of sequences better than 100.0: 13 Number of HSP's better than 100.0 without gapping: 9 Number of HSP's successfully gapped in prelim test: 4 Number of HSP's that attempted gapping in prelim test: 16 Number of HSP's gapped (non-prelim): 13 length of query: 222 length of database: 328,796 effective HSP length: 71 effective length of query: 151 effective length of database: 241,253 effective search space: 36429203 effective search space used: 36429203 T: 11 A: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 36 (18.5 bits)