>cd00674 LysRS_core_class_I This is the catalytic core domain of lysyl tRNA synthetase (LysRS). This class I enzyme is a monomer, which aminoacylates the 2'-OH of the nucleotide at the 3' of the appropriate tRNA. The core domain is based on the Rossman fold and is responsible for the ATP-dependent formation of the enzyme bound aminoacyl-adenylate. It contains the characteristic class I HIGH and KMSKS motifs, which are involved in ATP binding. The class I LysRS is found only in archaea and some bacteria and has evolved separately from class II LysRS, as the two do not share structural or sequence similarity.

Probab=98.31 E-value=3.3e-07 Score=67.39 Aligned_cols=50 Identities=40% Similarity=0.642 Sum_probs=42.0 Q ss_pred CCCCEEEEECCCCCCCCCCCCHHHHHHHHHHHHHHHHHCCCCCCCCCCCCC Q ss_conf 888389980778978987400477977899999977718985567688140 Q gi|254780802|r 32 NKKKYFVLEMFPYPSGNIHMGHLRNYVIGDVVARFMRASGYSVLHPMGWDA 82 (869) Q Consensus 32 ~~~kf~i~~~pPy~nG~lHiGH~~~~t~~Dv~aRy~rm~G~~Vl~~~G~d~ 82 (869) T Consensus 17 ~k~~~v~~tG-~~PSG~~HIGn~rEv~~~~~V~ral~~~g~~~~~i~~~DD 66 (354) T cd00674 17 GKEKYVVASG-ISPSGLIHIGNFREVVTADAVRRALRDLGFEVRLIYSWDD 66 (354) T ss_pred CCCCEEEECC-CCCCCCCCCCCCCHHHHHHHHHHHHHHCCCCEEEEEEEEC T ss_conf 8985899478-7999886320550178899999999975996799998405

HHsearch alignment for GI: 254780802 and conserved domain: cd00674