>cd00814 MetRS_core This is the catalytic core domain of methionine tRNA synthetase (MetRS). This class I enzyme aminoacylates the 2'-OH of the nucleotide at the 3' of the appropriate tRNA. MetRS, which consists of the core domain and a anti-codon binding domain functions as a monomer. However, in some species, the anti-codon binding domain is followed by an EMAP domain. In this case, MetRS functions as a homodimer. The core domain is based on the Rossman fold and is responsible for the ATP-dependent formation of the enzyme bound aminoacyl-adenylate. It contains the characteristic class I HIGH and KMSKS motifs, which are involved in ATP binding. As a result of a deletion event, MetRS has a significantly shorter core domain insertion that IleRS, ValRS, and LeuR. Consequently, the MetRS insertion lacks the editing function.

Probab=100.00 E-value=0 Score=351.01 Aligned_cols=132 Identities=24% Similarity=0.333 Sum_probs=125.6 Q ss_pred CEEEEECCCCCCCCCCCCHHHHHHHHHHHHHHHHHCCCCCCCCCCCCCCCHHHHHHHHHHCCCHHHHHHHHHHHHHHHHH Q ss_conf 38998077897898740047797789999997771898556768814020589999998099999999999999999999 Q gi|254780802|r 35 KYFVLEMFPYPSGNIHMGHLRNYVIGDVVARFMRASGYSVLHPMGWDAFGMPAENAAREHNVHPKMWTYQNIKVMRKQLQ 114 (869) Q Consensus 35 kf~i~~~pPy~nG~lHiGH~~~~t~~Dv~aRy~rm~G~~Vl~~~G~d~~GlPie~~~~e~~~~~~~~~~~~i~~~k~~~~ 114 (869) T Consensus 1 ~~~v~~~~Ptv~g~lHiGHar~~v~~Dil~R~lr~~G~~V~~vt~~Dd~~~kIi~kA~~~g~~~~el~~~y~~~~~~~~~ 80 (319) T cd00814 1 KVLITTALPYVNGVPHLGHLYGTVLADVFARYQRLRGYDVLFVTGTDEHGTKIEQKAEEEGVTPQELCDKYHEIFKELFK 80 (319) T ss_pred CEEEECCCCCCCCCCCCCCCHHHHHHHHHHHHHHHCCCCEEEECCCCCCCHHHHHHHHHCCCCHHHHHHHHHHHHHHHHH T ss_conf 98996899878898553306889999999999996599569968777870899999998399879999999999999999 Q ss_pred HCCCEEECCCCEECCCHHHHHHHHHHHHHHHHCCCEEECCEEEECCCCCCCCCC Q ss_conf 819176646982147735999999999999988963412213321477676778 Q gi|254780802|r 115 SIGLSIDWSKDFATCDVDYYHCQQLLFLDFMKHNVIVRKTAQVNWDPVEQTVLA 168 (869) Q Consensus 115 ~lG~~~DW~r~y~T~d~~y~~~v~w~f~~L~~kGliyrg~~pV~wcp~~~t~la 168 (869) T Consensus 81 ~L~I~--~d~~~r~~~~~~~~~v~~~i~~L~~~G~~y~~~~~~~y~~~~~~~~~ 132 (319) T cd00814 81 WLNIS--FDYFGRTTSPRHKEIVQEFFKKLYENGYIYEGEYEGLYCVSCERFLP 132 (319) T ss_pred HCCCC--CCCCCCCCCHHHHHHHHHHHHHHHHCCCEEEECCEEEECCCCCCCCC T ss_conf 84998--78676678806899999999999978988884102636588764564

HHsearch alignment for GI: 254780802 and conserved domain: cd00814