HHsearch alignment of GI: 254780803 and MMDB domain: 2jxp_A_

>2jxp_A (A:) Putative lipoprotein B; uncharacterized lipoprotein B, structure, northeast structural genomics consortium, NESG, PSI-2; NMR {Nitrosomonas europaea atcc 19718}
Probab=99.04  E-value=2.8e-08  Score=69.86  Aligned_cols=136  Identities=9%  Similarity=-0.000  Sum_probs=98.9

Q ss_pred             CCCEEEEECCCCCCCEEEEEEEEECC-CCHHHHHHHHHHHHHCC----CCCCCCCEEEEEEECCCE-EE-CCCCCCCCCE
Q ss_conf             85143341577672022325784077-74144899999997314----777767168999710000-00-0024676504
Q gi|254780803|r   22 CSVYPFYYLKNQDRTEYIHPIKVLVV-SKNNKNEIYRSINFLTS----TVRTKNLYQLEVNIDSFT-DH-AISNAFFKNI   94 (165)
Q Consensus        22 CGf~PlY~~~~~~~~~~l~~I~i~~~-~~r~~~~i~n~L~~~~~----~~~~~~~y~l~i~~~~~~-~~-~i~~~~~~~~   94 (165)
                      |||++= |   ......+..|.|..+ +......+++.|.....    ..+....+.|.+...... .. .+..+|.+..
T Consensus         1 CGf~lr-G---~~~p~~~~~i~v~~~~~~~l~~~L~~~l~~~g~~~iv~~~~~ad~~L~i~~~~~~~~~~s~~~~~~~~e   76 (155)
T 2jxp_A            1 MGFKLR-G---QVSELPFERVYITAPAGLTIGSDLERVISTHTRAKVVNKAEKSEAIIQIVHAIREKRILSLSESGRVRE   76 (155)
T ss_dssp             CCCCCC-C---CSSCCSCCEEEEECSSCCHHHHHHHHHHHHHSSCEEESSGGGCSEEEEEEEEEEEEEECCEETTTEECE
T ss_pred             CCEEEC-C---CCCCCCCCEEEEECCCCCHHHHHHHHHHHHCCCEEEECCCCCCCEEEEEECCEEEEEEEEECCCCCEEE
T ss_conf             975026-8---999988656999868986799999999986598286417767734999920474689985427872578


Q ss_pred             EEEEEEEEEEEEECCCCCEEEEEEEEEEEEECCCCCHH-HHHHHHHHHHHHHHHHHHHHHHHHHHHHH
Q ss_conf             89999999999980589587742579998606776157-79999999999999999999999999997
Q gi|254780803|r   95 GRITLKAKYYFKEISGKNILYENNTDVTSLFDFSDQQF-SQLRSHKSSEEKAIQELSENIYIDIISFI  161 (165)
Q Consensus        95 ~~~~~~~~y~L~~~~~~~~i~~~~~~~~~~Y~~~~~~f-~~~~~e~~a~erl~~~lae~I~~~i~~~l  161 (165)
                      |+++++++|++.+.+++.++..+.++.+.+|....+.. +....+.-+.+.+.+.+|++|..+|.+--
T Consensus        77 y~L~~~v~~~~~~~~g~~l~~~~~~~~~r~y~~~~~~~~a~~~e~~~l~~~l~~~la~qi~~rl~al~  144 (155)
T 2jxp_A           77 FELVYRVAARLLDAHNAELASLQEIRLTRILPFLDAQELAKAAEEEMLYKDMQKDAVQQILRQVSAFT  144 (155)
T ss_dssp             EEEEEEEEEEEEETTSCEEECCCEEEEEEEEECCSSCHHHHTTHHHHHHHHHHHHHHHHHHHHHHHHT
T ss_pred             EEEEEEEEEEEECCCCCEECCCEEEEEEEEEEECHHHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHH
T ss_conf             99999999999979997752767899999975595676241999999999999999999999998640