HHsearch results for GI: 254780803 and protein with PDBid: 2jxp_A

>2jxp_A Putative lipoprotein B; uncharacterized lipoprotein B, structure, northeast structural genomics consortium, NESG, PSI-2; NMR {Nitrosomonas europaea atcc 19718}
Probab=98.33  E-value=7.1e-05  Score=48.09  Aligned_cols=135  Identities=8%  Similarity=0.014  Sum_probs=85.2

Q ss_pred             CCCEEEEECCCCCCCEEEEEEEEECC-CCHHHHHHHHHHHHHCC----CCCCCCCEEEEEEECCCEEE--CCCCCCCCCE
Q ss_conf             85143341577672022325784077-74144899999997314----77776716899971000000--0024676504
Q gi|254780803|r   22 CSVYPFYYLKNQDRTEYIHPIKVLVV-SKNNKNEIYRSINFLTS----TVRTKNLYQLEVNIDSFTDH--AISNAFFKNI   94 (165)
Q Consensus        22 CGf~PlY~~~~~~~~~~l~~I~i~~~-~~r~~~~i~n~L~~~~~----~~~~~~~y~l~i~~~~~~~~--~i~~~~~~~~   94 (165)
                      .||++= |... ..  .+..|.|..+ .......++..|.....    ...+...+.|.+........  .++.+|.+..
T Consensus         1 ~GF~LR-G~~~-~~--~~~~i~i~~~~~~~~~~~l~~~L~~~~~~~v~~~~~~A~~~L~I~~~~~~rr~~Sv~s~g~~~E   76 (155)
T 2jxp_A            1 MGFKLR-GQVS-EL--PFERVYITAPAGLTIGSDLERVISTHTRAKVVNKAEKSEAIIQIVHAIREKRILSLSESGRVRE   76 (155)
T ss_dssp             CCCCCC-CCSS-CC--SCCEEEEECSSCCHHHHHHHHHHHHHSSCEEESSGGGCSEEEEEEEEEEEEEECCEETTTEECE
T ss_pred             CCEEEC-CCCC-CC--CCCEEEEECCCCCHHHHHHHHHHHHCCCEEEECCCCCCCEEEEEEEEEEEEEEEEECCCCEEEE
T ss_conf             975035-8999-98--8656999768984899999999986598497437666768999975142179997747884444


Q ss_pred             EEEEEEEEEEEEECCCCCEEEEEEEEEEEEECCCCCHH-HHHHHHHHHHHHHHHHHHHHHHHHHHHH
Q ss_conf             89999999999980589587742579998606776157-7999999999999999999999999999
Q gi|254780803|r   95 GRITLKAKYYFKEISGKNILYENNTDVTSLFDFSDQQF-SQLRSHKSSEEKAIQELSENIYIDIISF  160 (165)
Q Consensus        95 ~~~~~~~~y~L~~~~~~~~i~~~~~~~~~~Y~~~~~~f-~~~~~e~~a~erl~~~lae~I~~~i~~~  160 (165)
                      |++.+++.|++.+..+...+...+++..-+|....+.. +...-|+-..+-+.+.+|.+|..+|.+.
T Consensus        77 yeL~~~v~~~v~~~~g~~l~~~~~i~~~R~y~~d~~~~la~~~Ee~~l~~eM~~~la~qIl~rL~~l  143 (155)
T 2jxp_A           77 FELVYRVAARLLDAHNAELASLQEIRLTRILPFLDAQELAKAAEEEMLYKDMQKDAVQQILRQVSAF  143 (155)
T ss_dssp             EEEEEEEEEEEEETTSCEEECCCEEEEEEEEECCSSCHHHHTTHHHHHHHHHHHHHHHHHHHHHHHH
T ss_pred             EEEEEEEEEEEECCCCCEECCCEEEEEEEEEECCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
T ss_conf             8999999999995999774276689999997349678751599999999999999999999999864