HHsearch results for GI: 254780803 and protein with PDBid: 2r76_A

>2r76_A RARE lipoprotein B; alpha-beta protein, structural genomics, PSI-2, protein structure initiative; 2.60A {Shewanella oneidensis mr-1}
Probab=98.16  E-value=0.00038  Score=43.62  Aligned_cols=134  Identities=7%  Similarity=-0.040  Sum_probs=84.4

Q ss_pred             CCCEEEEECCCCCCCEEEEEEEEEC--CCCHHHHHHHHHHHHHCC--CCCCCCCEEEEEEECCCEEE--CCCCCCCCCEE
Q ss_conf             8514334157767202232578407--774144899999997314--77776716899971000000--00246765048
Q gi|254780803|r   22 CSVYPFYYLKNQDRTEYIHPIKVLV--VSKNNKNEIYRSINFLTS--TVRTKNLYQLEVNIDSFTDH--AISNAFFKNIG   95 (165)
Q Consensus        22 CGf~PlY~~~~~~~~~~l~~I~i~~--~~~r~~~~i~n~L~~~~~--~~~~~~~y~l~i~~~~~~~~--~i~~~~~~~~~   95 (165)
                      .||+.= |.  .++...+..|.+..  +.....+.++..|....-  .+.++..+.|.+........  .++.+|.+..|
T Consensus         1 ~GFhLR-G~--~~lp~~~~~i~l~~~~~~~~l~~~l~~~L~~~~v~l~~~~~a~~~L~I~~~~~~rr~~Sv~~~grv~Ey   77 (152)
T 2r76_A            1 MGFKLQ-RS--YQIPEQLNQLSLSSSDEYKELTRLVRERLRLNNVKIVDAANDVPVLRLITDSLERSTLSLYPTGNVAEY   77 (152)
T ss_dssp             ------------------CEEEEEESCTTSHHHHHHHHHHHHTTCEECSSCSSSCEEEEEEEEEEEEEEEECTTSSEEEE
T ss_pred             CCEEEC-CC--CCCCCCCCEEEEEECCCCCHHHHHHHHHHHHCCCEECCCCCCCEEEEECCCEEEEEEEEECCCCCHHHE
T ss_conf             974048-99--989977458999937999779999999999859764578777569997243456899987478714003


Q ss_pred             EEEEEEEEEEEECCCCCEEEEEEEEEEEEECCCCCHH-HHHHHHHHHHHHHHHHHHHHHHHHHHHH
Q ss_conf             9999999999980589587742579998606776157-7999999999999999999999999999
Q gi|254780803|r   96 RITLKAKYYFKEISGKNILYENNTDVTSLFDFSDQQF-SQLRSHKSSEEKAIQELSENIYIDIISF  160 (165)
Q Consensus        96 ~~~~~~~y~L~~~~~~~~i~~~~~~~~~~Y~~~~~~f-~~~~~e~~a~erl~~~lae~I~~~i~~~  160 (165)
                      ++.++++|++.+.. +.. ...+++...+|...++.. +...-|+-..+-+.+.+|.+|..+|...
T Consensus        78 eL~~~v~~~v~~~~-~~~-~~~~i~~~R~y~~d~~~~lak~~Ee~~l~~eM~~d~a~qIlrrL~~l  141 (152)
T 2r76_A           78 ELIYFVEFAVALPG-KEA-QPFKIEIRRDYLDDPRTALAKSREMELLVKEMRIQAADRILQSMAST  141 (152)
T ss_dssp             EEEEEEEEEEECTT-SCC-EEEEEEEEEEEECCSSCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
T ss_pred             EEEEEEEEEEECCC-CCE-EEEEEEEEEEEEECHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
T ss_conf             68899999999799-968-53578999987509778750699999999999999999999999985