BLAST/PSIBLAST alignment of GI: 254780803 and GI: 315122025 at iteration 1
>gi|315122025|ref|YP_004062514.1| hypothetical protein CKC_01375 [Candidatus Liberibacter solanacearum CLso-ZC1] Length = 170
>gi|313495427|gb|ADR52026.1| hypothetical protein CKC_01375 [Candidatus Liberibacter solanacearum CLso-ZC1] Length = 170
 Score =  170 bits (431), Expect = 5e-41,   Method: Compositional matrix adjust.
 Identities = 85/151 (56%), Positives = 117/151 (77%)

Query: 15  FFLLINSCSVYPFYYLKNQDRTEYIHPIKVLVVSKNNKNEIYRSINFLTSTVRTKNLYQL 74
           FFL+     +YP YY KN+D T YI+PIK+LV SK+N  EIYR++NFLTS + TKN YQL
Sbjct: 19  FFLVSCDYKIYPLYYSKNKDNTTYINPIKILVSSKDNIQEIYRNLNFLTSAILTKNKYQL 78

Query: 75  EVNIDSFTDHAISNAFFKNIGRITLKAKYYFKEISGKNILYENNTDVTSLFDFSDQQFSQ 134
            VN+ S T+++I N FF NIGRI LKA Y  KE+S   ILY+N+T VTSL+ F++Q F++
Sbjct: 79  NVNVISNTENSIDNIFFNNIGRIVLKANYSLKELSTGKILYKNHTVVTSLYSFTNQNFAK 138

Query: 135 LRSHKSSEEKAIQELSENIYIDIISFIRTIE 165
           +R+ K++E KAI+EL+ENI+IDI+SFI+ ++
Sbjct: 139 MRTIKNTETKAIKELAENIHIDIVSFIKNVD 169