BLASTP 2.2.22 [Sep-27-2009] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= gi|254780805|ref|YP_003065218.1| chromosome partitioning protein B [Candidatus Liberibacter asiaticus str. psy62] (300 letters) Database: las_proteome 1233 sequences; 328,796 total letters Searching...................................................done >gi|254780805|ref|YP_003065218.1| chromosome partitioning protein B [Candidatus Liberibacter asiaticus str. psy62] Length = 300 Score = 604 bits (1558), Expect = e-175, Method: Compositional matrix adjust. Identities = 300/300 (100%), Positives = 300/300 (100%) Query: 1 MSNNYSKRRLGRGLAALIGEVNQSIDSPEKKTETIPESQDCISIHSIVPNPHNPRNYFES 60 MSNNYSKRRLGRGLAALIGEVNQSIDSPEKKTETIPESQDCISIHSIVPNPHNPRNYFES Sbjct: 1 MSNNYSKRRLGRGLAALIGEVNQSIDSPEKKTETIPESQDCISIHSIVPNPHNPRNYFES 60 Query: 61 EGLEDLCQSIKSHGIIQPLIVRAIDNGLYKIIAGERRFRAAKMASLSEVPVIIRNVDNKS 120 EGLEDLCQSIKSHGIIQPLIVRAIDNGLYKIIAGERRFRAAKMASLSEVPVIIRNVDNKS Sbjct: 61 EGLEDLCQSIKSHGIIQPLIVRAIDNGLYKIIAGERRFRAAKMASLSEVPVIIRNVDNKS 120 Query: 121 SLEIAIVENVQRKDLNPLEEALGYEQLISEYGYTQNDIGSIVGKSRSHVANILRILKLPS 180 SLEIAIVENVQRKDLNPLEEALGYEQLISEYGYTQNDIGSIVGKSRSHVANILRILKLPS Sbjct: 121 SLEIAIVENVQRKDLNPLEEALGYEQLISEYGYTQNDIGSIVGKSRSHVANILRILKLPS 180 Query: 181 SVREMIRKEEISLGHARTLVSTSDPLSLAQVIVSKKMSVRDTEELVQEQDNKKEKRKKIF 240 SVREMIRKEEISLGHARTLVSTSDPLSLAQVIVSKKMSVRDTEELVQEQDNKKEKRKKIF Sbjct: 181 SVREMIRKEEISLGHARTLVSTSDPLSLAQVIVSKKMSVRDTEELVQEQDNKKEKRKKIF 240 Query: 241 EGSREKEKYLTDLEKKISSKVGLNISIKHRNNKGQFCIKYETNEQLKIICSLLGENDFEY 300 EGSREKEKYLTDLEKKISSKVGLNISIKHRNNKGQFCIKYETNEQLKIICSLLGENDFEY Sbjct: 241 EGSREKEKYLTDLEKKISSKVGLNISIKHRNNKGQFCIKYETNEQLKIICSLLGENDFEY 300 >gi|254780922|ref|YP_003065335.1| glucose-1-phosphate thymidylyltransferase [Candidatus Liberibacter asiaticus str. psy62] Length = 292 Score = 29.6 bits (65), Expect = 0.060, Method: Compositional matrix adjust. Identities = 41/168 (24%), Positives = 78/168 (46%), Gaps = 25/168 (14%) Query: 1 MSNNYSKRRLGRGLAALIGEVNQSIDSPEKKTET-IPESQDCISIHSIVPNPHNPRN--- 56 +S+ + K R R A ++G + +P++ + S ISI P+NP++ Sbjct: 116 ISDIFHKARARRNSATVVG---CHVQNPQRYGVVEVDSSNQAISIEE---KPNNPKSSFA 169 Query: 57 ----YFESEGLEDLCQSIK--SHGIIQPLIVRA--IDNGLYKIIA---GERRFRAAKMAS 105 YF + + ++ ++I+ + G ++ V + +D GL + G F A S Sbjct: 170 VTGIYFYDQEVVNIARNIRPSARGELEITDVNSYYLDKGLLAVEFLREGSAWFDAGTPES 229 Query: 106 LSEVPVIIRNVDNKSSLEIAIVENVQ-RKDLNPLEEALGYEQLISEYG 152 L + V +RN++N+ L +A E + R D + E+ + QLI +G Sbjct: 230 LLDTAVFVRNIENRLGLYVACPEEIAYRHDF--INES-QFFQLIDHFG 274 >gi|254780724|ref|YP_003065137.1| component of type IV pilus [Candidatus Liberibacter asiaticus str. psy62] Length = 483 Score = 28.5 bits (62), Expect = 0.13, Method: Compositional matrix adjust. Identities = 11/20 (55%), Positives = 13/20 (65%) Query: 63 LEDLCQSIKSHGIIQPLIVR 82 EDLC I +G +QPLI R Sbjct: 114 FEDLCNDILGYGPLQPLIAR 133 >gi|254781034|ref|YP_003065447.1| hypothetical protein CLIBASIA_04680 [Candidatus Liberibacter asiaticus str. psy62] Length = 344 Score = 27.3 bits (59), Expect = 0.31, Method: Compositional matrix adjust. Identities = 23/77 (29%), Positives = 35/77 (45%), Gaps = 1/77 (1%) Query: 127 VENVQRKDLNPL-EEALGYEQLISEYGYTQNDIGSIVGKSRSHVANILRILKLPSSVREM 185 + N Q ++ PL EE +QLIS+ DI + + K + AN LR V + Sbjct: 125 LANTQNFNIKPLLEEIASLKQLISDLSKNYQDIVTRLTKMETLTANPLRNPNTQRMVSLL 184 Query: 186 IRKEEISLGHARTLVST 202 I K + G +L +T Sbjct: 185 ILKNALDKGEYSSLNTT 201 >gi|254780326|ref|YP_003064739.1| bifunctional ornithine acetyltransferase/N-acetylglutamate synthase protein [Candidatus Liberibacter asiaticus str. psy62] Length = 416 Score = 24.3 bits (51), Expect = 2.6, Method: Compositional matrix adjust. Identities = 16/47 (34%), Positives = 24/47 (51%), Gaps = 8/47 (17%) Query: 65 DLCQSIKSHGIIQPLIVRAIDNGLYKIIAGER-----RFRAAKMASL 106 D C+ SHGI + LIV ++G+ G+R RF A ++ L Sbjct: 68 DFCKGNLSHGIARALIV---NSGIANAFTGKRGRDTVRFIAKAVSEL 111 >gi|254780750|ref|YP_003065163.1| DNA mismatch repair protein [Candidatus Liberibacter asiaticus str. psy62] Length = 920 Score = 22.7 bits (47), Expect = 8.3, Method: Compositional matrix adjust. Identities = 14/45 (31%), Positives = 22/45 (48%), Gaps = 9/45 (20%) Query: 241 EGSREKEKYLTDLEKKISSKVGL---------NISIKHRNNKGQF 276 + S ++ + L D K+I + + L N+ IKH NN G F Sbjct: 458 DASLDETRSLRDQSKRIIASLQLKYAEETKIKNLKIKHNNNLGYF 502 Database: las_proteome Posted date: Jun 5, 2011 6:30 PM Number of letters in database: 328,796 Number of sequences in database: 1233 Lambda K H 0.313 0.132 0.356 Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 193,130 Number of Sequences: 1233 Number of extensions: 8037 Number of successful extensions: 33 Number of sequences better than 100.0: 16 Number of HSP's better than 100.0 without gapping: 6 Number of HSP's successfully gapped in prelim test: 10 Number of HSP's that attempted gapping in prelim test: 26 Number of HSP's gapped (non-prelim): 18 length of query: 300 length of database: 328,796 effective HSP length: 73 effective length of query: 227 effective length of database: 238,787 effective search space: 54204649 effective search space used: 54204649 T: 11 A: 40 X1: 16 ( 7.2 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 42 (21.9 bits) S2: 38 (19.2 bits)