>cd04168 TetM_like Tet(M)-like subfamily. Tet(M), Tet(O), Tet(W), and OtrA are tetracycline resistance genes found in Gram-positive and Gram-negative bacteria. Tetracyclines inhibit protein synthesis by preventing aminoacyl-tRNA from binding to the ribosomal acceptor site. This subfamily contains tetracycline resistance proteins that function through ribosomal protection and are typically found on mobile genetic elements, such as transposons or plasmids, and are often conjugative. Ribosomal protection proteins are homologous to the elongation factors EF-Tu and EF-G. EF-G and Tet(M) compete for binding on the ribosomes. Tet(M) has a higher affinity than EF-G, suggesting these two proteins may have overlapping binding sites and that Tet(M) must be released before EF-G can bind. Tet(M) and Tet(O) have been shown to have ribosome-dependent GTPase activity. These proteins are part of the GTP translation factor family, which includes EF-G, EF-Tu, EF2, LepA, and SelB.

Probab=98.20 E-value=2.6e-06 Score=56.32 Aligned_cols=87 Identities=10% Similarity=0.152 Sum_probs=58.5 Q ss_pred CCCCCCEEEECCCCC--CCCCCHHHHHHHCCCCCCCCCHHHHHHHHHHHHHHHHHHHHHCCCCCCCCCCCEEECCCHHHH Q ss_conf 027820331013332--222101123310011111231137888753357776554320267743100202312531001 Q gi|254780806|r 122 SDFSYIFLDCPPSFN--LLTMNAMAAADSILVPLQCEFFALEGLSQLLETVEEVRRTVNSALDIQGIILTMFDSRNSLSQ 199 (265) Q Consensus 122 ~~yD~IiiD~pp~~~--~~~~~al~aad~viip~~p~~~s~~~~~~~~~~i~~~~~~~~~~~~~~~iv~N~~~~~~~~~~ 199 (265) T Consensus 62 ~~~~~n~iDtPG~~dF~~e~~~al~~~D~av~Vv~a~~Gv~~~t~~---~~~~~~~~---~~P~i-ifiNKmDre~adf~ 134 (237) T cd04168 62 EDTKVNLIDTPGHMDFIAEVERSLSVLDGAILVISAVEGVQAQTRI---LWRLLRKL---NIPTI-IFVNKIDRAGADLE 134 (237) T ss_pred CCEEEEEEECCCCHHHHHHHHHHHHHCCCEEEEEECCCCCCCCHHH---HHHHHHHC---CCCEE-EEEECCCCCCCCHH T ss_conf 9987999889884656668988976348169999658882234499---99999985---99859-98624457899999 Q ss_pred HHHHHHHHHHCCCCCC Q ss_conf 1268999880852015 Q gi|254780806|r 200 QVVSDVRKNLGGKVYN 215 (265) Q Consensus 200 ~~~~~l~~~~~~~v~~ 215 (265) T Consensus 135 ~~l~~i~~~l~~~~~p 150 (237) T cd04168 135 KVYQEIKEKLSSDIVP 150 (237) T ss_pred HHHHHHHHHHCCCEEE T ss_conf 9999999997897476

HHsearch alignment for GI: 254780806 and conserved domain: cd04168