HHsearch alignment for GI: 254780808 and conserved domain: PRK07233

>PRK07233 hypothetical protein; Provisional.
Probab=97.55  E-value=0.00011  Score=52.70  Aligned_cols=31  Identities=32%  Similarity=0.476  Sum_probs=29.2

Q ss_pred             EEEECCCHHHHHHHHHHHHCCCCEEEEECCH
Q ss_conf             8898894268999999985899899998076
Q gi|254780808|r    8 VIVIGGGHAGCEAAAVAAKLGASTALITHKT   38 (626)
Q Consensus         8 ViVIGaG~AG~EAA~~~Ar~G~~v~L~~~~~   38 (626)
T Consensus         2 VvVIGaG~aGLsaA~~L~~~G~~V~VlEa~~   32 (430)
T PRK07233          2 IAIIGGGIMGLAAAYRLAKAGHEVTVFEADD   32 (430)
T ss_pred             EEEECCCHHHHHHHHHHHHCCCCEEEEECCC
T ss_conf             8999977899999999983999889995899