RPSBLAST alignment for GI: 254780808 and conserved domain: COG2081

>gnl|CDD|32264 COG2081, COG2081, Predicted flavoproteins [General function prediction only]. Length = 408
 Score = 42.9 bits (101), Expect = 3e-04
 Identities = 17/34 (50%), Positives = 19/34 (55%)

Query: 3  NRSYDVIVIGGGHAGCEAAAVAAKLGASTALITH 36
             +DVI+IGGG AG  AA  AAK G    LI  
Sbjct: 1  MERFDVIIIGGGPAGLMAAISAAKAGRRVLLIDK 34