>TIGR00483 EF-1_alpha translation elongation factor EF-1, subunit alpha; InterPro: IPR004539 Translation elongation factors are responsible for two main processes during protein synthesis on the ribosome , , . EF1A (or EF-Tu) is responsible for the selection and binding of the cognate aminoacyl-tRNA to the A-site (acceptor site) of the ribosome. EF2 (or EF-G) is responsible for the translocation of the peptidyl-tRNA from the A-site to the P-site (peptidyl-tRNA site) of the ribosome, thereby freeing the A-site for the next aminoacyl-tRNA to bind. Elongation factors are responsible for achieving accuracy of translation and both EF1A and EF2 are remarkably conserved throughout evolution. EF1A (also known as EF-1alpha or EF-Tu) is a G-protein. It forms a ternary complex of EF1A-GTP-aminoacyltRNA. The binding of aminoacyl-tRNA stimulates GTP hydrolysis by EF1A, causing a conformational change in EF1A that causes EF1A-GDP to detach from the ribosome, leaving the aminoacyl-tRNA attached at the A-site. Only the cognate aminoacyl-tRNA can induce the required conformational change in EF1A through its tight anticodon-codon binding , . EF1A-GDP is returned to its active state, EF1A-GTP, through the action of another elongation factor, EF1B (also known as EF-Ts or EF-1beta/gamma/delta). This entry represents EF1A proteins found primarily in eukaryotic (eEF1A) and archaeal (aEF1A) organisms, these proteins being more closely related to one another than to EF1A (or EF-Tu) found in bacteria (IPR004541 from INTERPRO). More information about these proteins can be found at Protein of the Month: Elongation Factors . ; GO: 0003746 translation elongation factor activity, 0005525 GTP binding, 0006414 translational elongation, 0005737 cytoplasm.

Probab=97.58 E-value=5.7e-05 Score=54.29 Aligned_cols=115 Identities=28% Similarity=0.344 Sum_probs=80.5 Q ss_pred HHCCCEEEECCCCCCHHHHHHHHHCCHHCC------------------------C------CCCCCCCEEECCCCCCCCC Q ss_conf 202302431146631888999985520002------------------------3------4546872110001245683 Q gi|254780809|r 217 RNGYKIVILGHSNAGKSSLFNALAKKDVAI------------------------V------TDIPGTTRDVLTIDLDLEG 266 (440) Q Consensus 217 ~~g~~v~i~G~pN~GKSSL~N~L~~~~~aI------------------------V------s~~~GTTRD~i~~~~~i~g 266 (440) T Consensus 5 K~~~Nv~~IGHVD~GKST~~G~Lly~~G~I~~~~~eK~~kEa~e~GK~~F~fa~V~D~Lk~ERERGvTID~A~~KFeT~K 84 (445) T TIGR00483 5 KEHINVAFIGHVDHGKSTLVGRLLYKAGAIDEQLLEKLKKEAQEKGKASFEFAWVMDRLKEERERGVTIDVAHKKFETDK 84 (445) T ss_pred CCEEEEEEEEEEECCCCHHHHHHHHHCCCCCHHHHHHHHHHHHHCCCCEEEEEEEECCCCCCCCCCCHHHHHHHHCCCCC T ss_conf 43244899825408850266777754289658999999875755187303676543110000015622433445417885 Q ss_pred EEEEEEECCHHCCCCHHHHHHHHHHHHHHHHHHCCEEECCCCCCHHHH------------HHH---CC-CCCCCCCCCCC Q ss_conf 589995081000241035666678889985030110201358985663------------431---28-98532222333 Q gi|254780809|r 267 YLVKISDTAGIRETDDIVEKEGIKRTFLEVENADLILLLKEINSKKEI------------SFP---KN-IDFIFIGTKSD 330 (440) Q Consensus 267 ~~~~l~DTaGir~t~d~IE~~GI~ra~~~i~~aDlil~v~D~~~~~~~------------~~~---~~-~~~i~V~NK~D 330 (440) T Consensus 85 Y~~TivDcPGHRDF--------iKNMITGaSQADaAvLv~~v~~~~~~ag~~~~pQTrEH~~La~TLGi~QliVAiNKMD 156 (445) T TIGR00483 85 YEVTIVDCPGHRDF--------IKNMITGASQADAAVLVVAVDDGEFEAGISVQPQTREHVFLARTLGINQLIVAINKMD 156 (445) T ss_pred EEEEEEECCCCCHH--------HHHCCCCCCCCCEEEEEEECCCCCCCCCEEECCCCHHHHHHHHHHCCEEEEEEECCCC T ss_conf 16999846987013--------4311266751242799995254410240121786057788877503204533310246 Q ss_pred CCCCCCHHH Q ss_conf 446542000 Q gi|254780809|r 331 LYSTYTEEY 339 (440) Q Consensus 331 l~~~~~~~~ 339 (440) T Consensus 157 ~V~yd~~~f 165 (445) T TIGR00483 157 SVNYDEEEF 165 (445) T ss_pred CEECCHHHH T ss_conf 100277899

HHsearch alignment for GI: 254780809 and conserved domain: TIGR00483