>cd01854 YjeQ_engC YjeQ/EngC. YjeQ (YloQ in Bacillus subtilis) represents a protein family whose members are broadly conserved in bacteria and have been shown to be essential to the growth of E. coli and B. subtilis. Proteins of the YjeQ family contain all sequence motifs typical of the vast class of P-loop-containing GTPases, but show a circular permutation, with a G4-G1-G3 pattern of motifs as opposed to the regular G1-G3-G4 pattern seen in most GTPases. All YjeQ family proteins display a unique domain architecture, which includes an N-terminal OB-fold RNA-binding domain, the central permuted GTPase domain, and a zinc knuckle-like C-terminal cysteine domain. This domain architecture suggests a role for YjeQ as a regulator of translation.

Probab=94.76 E-value=0.013 Score=37.86 Aligned_cols=67 Identities=28% Similarity=0.333 Sum_probs=46.3 Q ss_pred HHHHCCEEECCCCCCHH-HH---------HHHCCCCCCCCCCCCCCCCCCCHH-----------HHHHHHHHHHHHHHHH Q ss_conf 50301102013589856-63---------431289853222233344654200-----------0001333323235899 Q gi|254780809|r 296 VENADLILLLKEINSKK-EI---------SFPKNIDFIFIGTKSDLYSTYTEE-----------YDHLISSFTGEGLEEL 354 (440) Q Consensus 296 i~~aDlil~v~D~~~~~-~~---------~~~~~~~~i~V~NK~Dl~~~~~~~-----------~~~~ISaktg~Gi~~L 354 (440) T Consensus 76 aANiD~v~IV~s~~~p~~~~~~idR~Lv~a~~~~i~pvivlnK~DL~~~~~~~~~~~~~~~~gy~v~~~S~~~~~g~~~L 155 (287) T cd01854 76 AANVDQLVIVVSLNEPFFNPRLLDRYLVAAEAAGIEPVIVLTKADLLDDEEEELELVEALALGYPVLAVSAKTGEGLDEL 155 (287) T ss_pred EECCCEEEEEECCCCCCCCHHHHHHHHHHHHHCCCCEEEEEECHHCCCCHHHHHHHHHHHCCCCEEEEEECCCCCCHHHH T ss_conf 97266899995268998998999999999997799689999862219948999999998729984999966898588999 Q ss_pred HHHHHHHH Q ss_conf 99999996 Q gi|254780809|r 355 INKIKSIL 362 (440) Q Consensus 355 ~~~I~~~l 362 (440) T Consensus 156 ~~~l~~k~ 163 (287) T cd01854 156 REYLKGKT 163 (287) T ss_pred HHHHCCCE T ss_conf 98747988

HHsearch alignment for GI: 254780809 and conserved domain: cd01854