>cd01869 Rab1_Ypt1 Rab1/Ypt1 subfamily. Rab1 is found in every eukaryote and is a key regulatory component for the transport of vesicles from the ER to the Golgi apparatus. Studies on mutations of Ypt1, the yeast homolog of Rab1, showed that this protein is necessary for the budding of vesicles of the ER as well as for their transport to, and fusion with, the Golgi apparatus. GTPase activating proteins (GAPs) interact with GTP-bound Rab and accelerate the hydrolysis of GTP to GDP. Guanine nucleotide exchange factors (GEFs) interact with GDP-bound Rabs to promote the formation of the GTP-bound state. Rabs are further regulated by guanine nucleotide dissociation inhibitors (GDIs), which facilitate Rab recycling by masking C-terminal lipid binding and promoting cytosolic localization. Most Rab GTPases contain a lipid modification site at the C-terminus, with sequence motifs CC, CXC, or CCX. Lipid binding is essential for membrane attachment, a key feature of most Rab proteins. Due to t

Probab=99.42 E-value=1.3e-12 Score=107.24 Aligned_cols=135 Identities=20% Similarity=0.281 Sum_probs=94.0 Q ss_pred CCEEEECCCCCCHHHHHHHHHCCHHCCCCCCCCCC-EEECCCCCCCCC--EEEEEEECCHHCCCCHHHHHHHHHHHHHHH Q ss_conf 30243114663188899998552000234546872-110001245683--589995081000241035666678889985 Q gi|254780809|r 220 YKIVILGHSNAGKSSLFNALAKKDVAIVTDIPGTT-RDVLTIDLDLEG--YLVKISDTAGIRETDDIVEKEGIKRTFLEV 296 (440) Q Consensus 220 ~~v~i~G~pN~GKSSL~N~L~~~~~aIVs~~~GTT-RD~i~~~~~i~g--~~~~l~DTaGir~t~d~IE~~GI~ra~~~i 296 (440) T Consensus 3 ~Kiv~vGd~~vGKTsli~r~~~~~f--~~~y~~Tig~~~~~~~i~~~~~~~~l~iwDtaG~e~~~~--------~~~~~~ 72 (166) T cd01869 3 FKLLLIGDSGVGKSCLLLRFADDTY--TESYISTIGVDFKIRTIELDGKTIKLQIWDTAGQERFRT--------ITSSYY 72 (166) T ss_pred EEEEEECCCCCCHHHHHHHHHCCCC--CCCCCCCCCEEEEEEEEEECCEEEEEEEEECCCCCCCCC--------CHHHHH T ss_conf 9999999999789999999943999--987478544048999999999999999998999823462--------678885 Q ss_pred HHHCCEEECCCCCCHHHHHH------------HCCCCCCCCCCCCCCCCCCCHH-------------HHHHHHHHHHHHH Q ss_conf 03011020135898566343------------1289853222233344654200-------------0001333323235 Q gi|254780809|r 297 ENADLILLLKEINSKKEISF------------PKNIDFIFIGTKSDLYSTYTEE-------------YDHLISSFTGEGL 351 (440) Q Consensus 297 ~~aDlil~v~D~~~~~~~~~------------~~~~~~i~V~NK~Dl~~~~~~~-------------~~~~ISaktg~Gi 351 (440) T Consensus 73 ~~a~~~ilvfdit~~~Sf~~i~~w~~~i~~~~~~~~~~ilvgNK~DL~~~r~v~~~~~~~~a~~~~~~~~E~SAk~g~nI 152 (166) T cd01869 73 RGAHGIIIVYDVTDQESFNNVKQWLQEIDRYASENVNKLLVGNKCDLTDKRVVDYSEAQEFADELGIPFLETSAKNATNV 152 (166) T ss_pred HHCCEEEEEECCCCHHHHHHHHHHHHHHHHHCCCCCCEEEEEEEECCCCCCCCCHHHHHHHHHHCCCEEEEECCCCCCCH T ss_conf 63267799711799899999999999999867877744886132011314667999999999983996999876878068 Q ss_pred HHHHHHHHHHHHH Q ss_conf 8999999999632 Q gi|254780809|r 352 EELINKIKSILSN 364 (440) Q Consensus 352 ~~L~~~I~~~l~~ 364 (440) T Consensus 153 ~e~F~~l~~~i~k 165 (166) T cd01869 153 EQAFMTMAREIKK 165 (166) T ss_pred HHHHHHHHHHHHH T ss_conf 9999999999971

HHsearch alignment for GI: 254780809 and conserved domain: cd01869