>cd04140 ARHI_like ARHI subfamily. ARHI (A Ras homolog member I) is a member of the Ras family with several unique structural and functional properties. ARHI is expressed in normal human ovarian and breast tissue, but its expression is decreased or eliminated in breast and ovarian cancer. ARHI contains an N-terminal extension of 34 residues (human) that is required to retain its tumor suppressive activity. Unlike most other Ras family members, ARHI is maintained in the constitutively active (GTP-bound) state in resting cells and has modest GTPase activity. ARHI inhibits STAT3 (signal transducers and activators of transcription 3), a latent transcription factor whose abnormal activation plays a critical role in oncogenesis. Most Ras proteins contain a lipid modification site at the C-terminus, with a typical sequence motif CaaX, where a = an aliphatic amino acid and X = any amino acid. Lipid binding is essential for membrane attachment, a key feature of most Ras proteins. Due to

Probab=99.39 E-value=1.4e-12 Score=107.16 Aligned_cols=132 Identities=20% Similarity=0.283 Sum_probs=91.7 Q ss_pred CCEEEECCCCCCHHHHHHHHHCCHHCCCCCCCCCCEEECCCCCCCCCE--EEEEEECCHHCCCCHHHHHHHHHHHHHHHH Q ss_conf 302431146631888999985520002345468721100012456835--899950810002410356666788899850 Q gi|254780809|r 220 YKIVILGHSNAGKSSLFNALAKKDVAIVTDIPGTTRDVLTIDLDLEGY--LVKISDTAGIRETDDIVEKEGIKRTFLEVE 297 (440) Q Consensus 220 ~~v~i~G~pN~GKSSL~N~L~~~~~aIVs~~~GTTRD~i~~~~~i~g~--~~~l~DTaGir~t~d~IE~~GI~ra~~~i~ 297 (440) T Consensus 2 ~KivllGd~~VGKTsli~r~~~~~F--~~~y~~Ti~~~~~~~i~~~~~~~~l~iwDtaG~e~~~~--------l~~~~~~ 71 (165) T cd04140 2 YRVVVFGAGGVGKSSLVLRFVKGTF--RESYIPTIEDTYRQVISCSKNICTLQITDTTGSHQFPA--------MQRLSIS 71 (165) T ss_pred EEEEEECCCCCCHHHHHHHHHHCCC--CCCCCCCCCCEEEEEEEECCEEEEEEEEECCCCCCCCC--------CHHHHHC T ss_conf 0999989999769999999964969--99868845420558999999999999998999846542--------3244506 Q ss_pred HHCCEEECCCCCCHHHHHH---------------HCCCCCCCCCCCCCCCCCCCHH-------------HHHHHHHHHHH Q ss_conf 3011020135898566343---------------1289853222233344654200-------------00013333232 Q gi|254780809|r 298 NADLILLLKEINSKKEISF---------------PKNIDFIFIGTKSDLYSTYTEE-------------YDHLISSFTGE 349 (440) Q Consensus 298 ~aDlil~v~D~~~~~~~~~---------------~~~~~~i~V~NK~Dl~~~~~~~-------------~~~~ISaktg~ 349 (440) T Consensus 72 ~a~~~ilvydit~~~Sf~~~~~~~~~i~~~~~~~~~~~piilVgNK~Dl~~~r~V~~~e~~~~a~~~~~~~~E~SAk~~~ 151 (165) T cd04140 72 KGHAFILVYSVTSKQSLEELKPIYELICEIKGNNIEKIPIMLVGNKCDESHKREVSSNEGAACATEWNCAFMETSAKTNH 151 (165) T ss_pred CCCEEEEEECCCCHHHHHHHHHHHHHHHHHHHCCCCCCCEEEEEECCCCCCCCCCCHHHHHHHHHHCCCEEEEECCCCCC T ss_conf 88579998138987899999999999999961588888789986424640027889999999999869889997447794 Q ss_pred HHHHHHHHHHHH Q ss_conf 358999999999 Q gi|254780809|r 350 GLEELINKIKSI 361 (440) Q Consensus 350 Gi~~L~~~I~~~ 361 (440) T Consensus 152 nV~e~F~~l~~l 163 (165) T cd04140 152 NVQELFQELLNL 163 (165) T ss_pred CHHHHHHHHHHC T ss_conf 879999999814

HHsearch alignment for GI: 254780809 and conserved domain: cd04140