>cd04146 RERG_RasL11_like RERG/RasL11-like subfamily. RERG (Ras-related and Estrogen- Regulated Growth inhibitor) and Ras-like 11 are members of a novel subfamily of Ras that were identified based on their behavior in breast and prostate tumors, respectively. RERG expression was decreased or lost in a significant fraction of primary human breast tumors that lack estrogen receptor and are correlated with poor clinical prognosis. Elevated RERG expression correlated with favorable patient outcome in a breast tumor subtype that is positive for estrogen receptor expression. In contrast to most Ras proteins, RERG overexpression inhibited the growth of breast tumor cells in vitro and in vivo. RasL11 was found to be ubiquitously expressed in human tissue, but down-regulated in prostate tumors. Both RERG and RasL11 lack the C-terminal CaaX prenylation motif, where a = an aliphatic amino acid and X = any amino acid, and are localized primarily in the cytoplasm. Both are believed to have tu

Probab=99.42 E-value=6.5e-13 Score=109.39 Aligned_cols=134 Identities=22% Similarity=0.337 Sum_probs=93.1 Q ss_pred CEEEECCCCCCHHHHHHHHHCCHHCCCCCCCCCCEEECCCCCCCCCE--EEEEEECCHHCCCCHHHHHHHHHHHHHHHHH Q ss_conf 02431146631888999985520002345468721100012456835--8999508100024103566667888998503 Q gi|254780809|r 221 KIVILGHSNAGKSSLFNALAKKDVAIVTDIPGTTRDVLTIDLDLEGY--LVKISDTAGIRETDDIVEKEGIKRTFLEVEN 298 (440) Q Consensus 221 ~v~i~G~pN~GKSSL~N~L~~~~~aIVs~~~GTTRD~i~~~~~i~g~--~~~l~DTaGir~t~d~IE~~GI~ra~~~i~~ 298 (440) T Consensus 1 Kiv~vGd~~VGKTsli~rf~~~~--f~~~y~~T~~~~~~~~~~v~~~~~~l~iwDtaG~e~~~~-------~~~~~~~~~ 71 (165) T cd04146 1 KIAVLGASGVGKSALVVRFLTKR--FIGEYDPNLESLYSRQVTIDGEQVSLEILDTAGQQQADT-------EQLERSIRW 71 (165) T ss_pred CEEEECCCCCCHHHHHHHHHHCC--CCCCCCCCCCCEEEEEEEECCEEEEEEEEECCCCCCCCH-------HHHHHHCCC T ss_conf 99999989977899999997498--998759955630579999999999999992898501220-------125543045 Q ss_pred HCCEEECCCCCCHHHHHH--------------HCCCCCCCCCCCCCCCCCCCHH-------------HHHHHHHHHH-HH Q ss_conf 011020135898566343--------------1289853222233344654200-------------0001333323-23 Q gi|254780809|r 299 ADLILLLKEINSKKEISF--------------PKNIDFIFIGTKSDLYSTYTEE-------------YDHLISSFTG-EG 350 (440) Q Consensus 299 aDlil~v~D~~~~~~~~~--------------~~~~~~i~V~NK~Dl~~~~~~~-------------~~~~ISaktg-~G 350 (440) T Consensus 72 a~~~ilvydit~~~Sf~~~~~~~~~i~~~~~~~~~~piilVGNK~DL~~~r~Vs~ee~~~~a~~~~~~f~E~SAk~~~~~ 151 (165) T cd04146 72 ADGFVLVYSITDRSSFDEISQLKQLIREIKKRDREIPVILVGNKADLLHYRQVSTEEGEKLASELGCLFFEVSAAEDYDG 151 (165) T ss_pred CCEEEEEEECCCHHHHHHHHHHHHHHHHHHCCCCCCEEEEECCCCCCCCCCCCCHHHHHHHHHHCCCEEEEEECCCCCCC T ss_conf 87899998658889999999999999998466999539984455452103677999999999981998999752087826 Q ss_pred HHHHHHHHHHHHH Q ss_conf 5899999999963 Q gi|254780809|r 351 LEELINKIKSILS 363 (440) Q Consensus 351 i~~L~~~I~~~l~ 363 (440) T Consensus 152 V~~~F~~l~~~i~ 164 (165) T cd04146 152 VHSVFHELCREVR 164 (165) T ss_pred HHHHHHHHHHHHC T ss_conf 9999999999966

HHsearch alignment for GI: 254780809 and conserved domain: cd04146