>cd04150 Arf1_5_like Arf1-Arf5-like subfamily. This subfamily contains Arf1, Arf2, Arf3, Arf4, Arf5, and related proteins. Arfs1-5 are soluble proteins that are crucial for assembling coat proteins during vesicle formation. Each contains an N-terminal myristoylated amphipathic helix that is folded into the protein in the GDP-bound state. GDP/GTP exchange exposes the helix, which anchors to the membrane. Following GTP hydrolysis, the helix dissociates from the membrane and folds back into the protein. A general feature of Arf1-5 signaling may be the cooperation of two Arfs at the same site. Arfs1-5 are generally considered to be interchangeable in function and location, but some specific functions have been assigned. Arf1 localizes to the early/cis-Golgi, where it is activated by GBF1 and recruits the coat protein COPI. It also localizes to the trans-Golgi network (TGN), where it is activated by BIG1/BIG2 and recruits the AP1, AP3, AP4, and GGA proteins. Humans, but not rodents

Probab=99.43 E-value=5.6e-13 Score=109.83 Aligned_cols=128 Identities=18% Similarity=0.295 Sum_probs=92.1 Q ss_pred CCEEEECCCCCCHHHHHHHHHCCHHCCCCCCCCCCEEECCCCCCCCCEEEEEEECCHHCCCCHHHHHHHHHHHHHHHHHH Q ss_conf 30243114663188899998552000234546872110001245683589995081000241035666678889985030 Q gi|254780809|r 220 YKIVILGHSNAGKSSLFNALAKKDVAIVTDIPGTTRDVLTIDLDLEGYLVKISDTAGIRETDDIVEKEGIKRTFLEVENA 299 (440) Q Consensus 220 ~~v~i~G~pN~GKSSL~N~L~~~~~aIVs~~~GTTRD~i~~~~~i~g~~~~l~DTaGir~t~d~IE~~GI~ra~~~i~~a 299 (440) T Consensus 1 ~KililG~~~sGKTsll~~l~~~~~~--~~~p--T~g~~~~~~~~~~~~l~iwD~~G~~~~r--------~l~~~Y~~~a 68 (159) T cd04150 1 MRILMVGLDAAGKTTILYKLKLGEIV--TTIP--TIGFNVETVEYKNISFTVWDVGGQDKIR--------PLWRHYFQNT 68 (159) T ss_pred CEEEEECCCCCCHHHHHHHHHCCCCC--CCCC--CCCCCEEEEEECCEEEEEEECCCCCCCC--------HHHHHHCCCC T ss_conf 99999999999989999999729967--7589--6870179999898999999789972146--------5678647687 Q ss_pred CCEEECCCCCCHHHHH-------------HHCCCCCCCCCCCCCCCCCCCHH----------------HHHHHHHHHHHH Q ss_conf 1102013589856634-------------31289853222233344654200----------------000133332323 Q gi|254780809|r 300 DLILLLKEINSKKEIS-------------FPKNIDFIFIGTKSDLYSTYTEE----------------YDHLISSFTGEG 350 (440) Q Consensus 300 Dlil~v~D~~~~~~~~-------------~~~~~~~i~V~NK~Dl~~~~~~~----------------~~~~ISaktg~G 350 (440) T Consensus 69 ~~iI~VvD~sd~~~~~~~~~~l~~~l~~~~~~~~pili~~NK~Dl~~~~~~~ei~~~l~l~~~~~~~~~i~~~SA~tG~G 148 (159) T cd04150 69 QGLIFVVDSNDRERIGEAREELQRMLNEDELRDAVLLVFANKQDLPNAMSAAEVTDKLGLHSLRNRNWYIQATCATSGDG 148 (159) T ss_pred CEEEEEEECCCHHHHHHHHHHHHHHHCCHHHCCCEEEEEEECCCCCCCCCHHHHHHHHCHHHHHCCCEEEEEEECCCCCC T ss_conf 38999997777789999999999996235336982999997566778989999999968666637985999826867939 Q ss_pred HHHHHHHHH Q ss_conf 589999999 Q gi|254780809|r 351 LEELINKIK 359 (440) Q Consensus 351 i~~L~~~I~ 359 (440) T Consensus 149 v~e~f~WL~ 157 (159) T cd04150 149 LYEGLDWLS 157 (159) T ss_pred HHHHHHHHH T ss_conf 899999985

HHsearch alignment for GI: 254780809 and conserved domain: cd04150