>cd04165 GTPBP1_like GTPBP1-like. Mammalian GTP binding protein 1 (GTPBP1), GTPBP2, and nematode homologs AGP-1 and CGP-1 are GTPases whose specific functions remain unknown. In mouse, GTPBP1 is expressed in macrophages, in smooth muscle cells of various tissues and in some neurons of the cerebral cortex; GTPBP2 tissue distribution appears to overlap that of GTPBP1. In human leukemia and macrophage cell lines, expression of both GTPBP1 and GTPBP2 is enhanced by interferon-gamma (IFN-gamma). The chromosomal location of both genes has been identified in humans, with GTPBP1 located in chromosome 22q12-13.1 and GTPBP2 located in chromosome 6p21-12. Human glioblastoma multiforme (GBM), a highly-malignant astrocytic glioma and the most common cancer in the central nervous system, has been linked to chromosomal deletions and a translocation on chromosome 6. The GBM translocation results in a fusion of GTPBP2 and PTPRZ1, a protein involved in oligodendrocyte differentiation, recovery, and

Probab=98.84 E-value=1.2e-08 Score=79.68 Aligned_cols=106 Identities=23% Similarity=0.320 Sum_probs=64.0 Q ss_pred CEEEECCCCCCHHHHHHHHHCC--------------------HHCCCCCCC---------C--------CCEEECCCCCC Q ss_conf 0243114663188899998552--------------------000234546---------8--------72110001245 Q gi|254780809|r 221 KIVILGHSNAGKSSLFNALAKK--------------------DVAIVTDIP---------G--------TTRDVLTIDLD 263 (440) Q Consensus 221 ~v~i~G~pN~GKSSL~N~L~~~--------------------~~aIVs~~~---------G--------TTRD~i~~~~~ 263 (440) T Consensus 1 Rv~v~GhVD~GKSTL~G~Lt~g~lDdGrg~ar~~~~rh~hE~~~G~Tssi~~~~lgf~~~g~~~~~~~~~~~~~~~~~~~ 80 (224) T cd04165 1 RVAVVGNVDAGKSTLLGVLTQGELDNGRGKARLNLFRHKHEVESGRTSSVSNEILGFDSDGEVVNYPDNHLSESDIEICE 80 (224) T ss_pred CEEEEECCCCCHHHHHHHHHCCCCCCCCHHHHHHHHHHHHHHHHCCCCCHHHHHHHHCCCCCEECCCCCCCCCCCEEEEC T ss_conf 98999485884889999985677422210677787761899972654411565540101453202134765442201213 Q ss_pred CCCEEEEEEECCHHCCCCHHHHHHHHHHHHHH--HHHHCCEEECCCCCCHH--------HHHHHCCCCCCCCCCCCCCCC Q ss_conf 68358999508100024103566667888998--50301102013589856--------634312898532222333446 Q gi|254780809|r 264 LEGYLVKISDTAGIRETDDIVEKEGIKRTFLE--VENADLILLLKEINSKK--------EISFPKNIDFIFIGTKSDLYS 333 (440) Q Consensus 264 i~g~~~~l~DTaGir~t~d~IE~~GI~ra~~~--i~~aDlil~v~D~~~~~--------~~~~~~~~~~i~V~NK~Dl~~ 333 (440) T Consensus 81 ~~~k~it~iD~pGH~~y--------~kt~i~G~~~~~~d~~~LvV~A~~G~~~~T~ehl~l~~~l~ip~~vvitKiDl~~ 152 (224) T cd04165 81 KSSKLVTFIDLAGHERY--------LKTTLFGLTGYAPDYAMLVVAANAGIIGMTKEHLGLALALNIPVFVVVTKIDLAP 152 (224) T ss_pred CCCCEEEEEECCCHHHH--------HHHHHHHHHCCCCCEEEEEEECCCCCHHHHHHHHHHHHHHCCCEEEEEECCCCCC T ss_conf 67867999978873999--------9999987635568989999317889779999999999983999899998977689 Q ss_pred C Q ss_conf 5 Q gi|254780809|r 334 T 334 (440) Q Consensus 334 ~ 334 (440) T Consensus 153 ~ 153 (224) T cd04165 153 A 153 (224) T ss_pred H T ss_conf 8

HHsearch alignment for GI: 254780809 and conserved domain: cd04165