>cd04177 RSR1 RSR1 subgroup. RSR1/Bud1p is a member of the Rap subfamily of the Ras family that is found in fungi. In budding yeasts, RSR1 is involved in selecting a site for bud growth on the cell cortex, which directs the establishment of cell polarization. The Rho family GTPase cdc42 and its GEF, cdc24, then establish an axis of polarized growth by organizing the actin cytoskeleton and secretory apparatus at the bud site. It is believed that cdc42 interacts directly with RSR1 in vivo. In filamentous fungi, polar growth occurs at the tips of hypha and at novel growth sites along the extending hypha. In Ashbya gossypii, RSR1 is a key regulator of hyphal growth, localizing at the tip region and regulating in apical polarization of the actin cytoskeleton. Most Ras proteins contain a lipid modification site at the C-terminus, with a typical sequence motif CaaX, where a = an aliphatic amino acid and X = any amino acid. Lipid binding is essential for membrane attachment, a key featu

Probab=99.44 E-value=5.3e-13 Score=110.00 Aligned_cols=134 Identities=22% Similarity=0.308 Sum_probs=93.9 Q ss_pred CCEEEECCCCCCHHHHHHHHHCCHHCCCCCCCCCCEEECCCCCCCCCE--EEEEEECCHHCCCCHHHHHHHHHHHHHHHH Q ss_conf 302431146631888999985520002345468721100012456835--899950810002410356666788899850 Q gi|254780809|r 220 YKIVILGHSNAGKSSLFNALAKKDVAIVTDIPGTTRDVLTIDLDLEGY--LVKISDTAGIRETDDIVEKEGIKRTFLEVE 297 (440) Q Consensus 220 ~~v~i~G~pN~GKSSL~N~L~~~~~aIVs~~~GTTRD~i~~~~~i~g~--~~~l~DTaGir~t~d~IE~~GI~ra~~~i~ 297 (440) T Consensus 2 fKivlvGd~~VGKTsli~rf~~~~f--~~~y~pTi~~~~~k~i~i~~~~~~l~iwDtaG~e~~~~--------~~~~~~~ 71 (168) T cd04177 2 YKIVVLGAGGVGKSALTVQFVQNVF--IESYDPTIEDSYRKQVEIDGRQCDLEILDTAGTEQFTA--------MRELYIK 71 (168) T ss_pred EEEEEECCCCCCHHHHHHHHHHCCC--CCCCCCCCCCEEEEEEEECCEEEEEEEEECCCCCCCCC--------CHHHHHC T ss_conf 1999989999779999999961938--98658833315999999999999999982788623334--------5154512 Q ss_pred HHCCEEECCCCCCHHHHHH-------------HCCCCCCCCCCCCCCCCCCCH----------H----HHHHHHHHHHHH Q ss_conf 3011020135898566343-------------128985322223334465420----------0----000133332323 Q gi|254780809|r 298 NADLILLLKEINSKKEISF-------------PKNIDFIFIGTKSDLYSTYTE----------E----YDHLISSFTGEG 350 (440) Q Consensus 298 ~aDlil~v~D~~~~~~~~~-------------~~~~~~i~V~NK~Dl~~~~~~----------~----~~~~ISaktg~G 350 (440) T Consensus 72 ~a~~~ilvydvt~~~Sf~~~~~~~~~i~~~~~~~~~piilvgNK~DL~~~r~v~~~e~~~~a~~~~~~~~~E~SAk~~~n 151 (168) T cd04177 72 SGQGFLLVYSVTSEASLNELGELREQVLRIKDSDNVPMVLVGNKADLEDDRQVSREDGVSLSQQWGNVPFYETSARKRTN 151 (168) T ss_pred CCCEEEEECCCCCHHHHHHHHHHHHHHHHHCCCCCCCEEEEEECCCHHHCCCCCHHHHHHHHHHCCCCEEEEECCCCCCC T ss_conf 68667985368988899999999999998517888748988731461213768999999999974997799962487846 Q ss_pred HHHHHHHHHHHHH Q ss_conf 5899999999963 Q gi|254780809|r 351 LEELINKIKSILS 363 (440) Q Consensus 351 i~~L~~~I~~~l~ 363 (440) T Consensus 152 V~e~F~~l~~~il 164 (168) T cd04177 152 VDEVFIDLVRQII 164 (168) T ss_pred HHHHHHHHHHHHH T ss_conf 8999999999999

HHsearch alignment for GI: 254780809 and conserved domain: cd04177