>cd03248 ABCC_TAP TAP, the Transporter Associated with Antigen Processing; TAP is essential for peptide delivery from the cytosol into the lumen of the endoplasmic reticulum (ER), where these peptides are loaded on major histocompatibility complex (MHC) I molecules. Loaded MHC I leave the ER and display their antigenic cargo on the cell surface to cytotoxic T cells. Subsequently, virus-infected or malignantly transformed cells can be eliminated. TAP belongs to the large family of ATP-binding cassette (ABC) transporters, which translocate a vast variety of solutes across membranes.

Probab=95.06 E-value=0.014 Score=36.00 Aligned_cols=60 Identities=20% Similarity=0.495 Sum_probs=42.9 Q ss_pred CHHHHHCCCCHHHCCCCCCCC--CCCCCCCCCCCCCHHHHHHHHHHHHHCCCCEEEECCCCCCHHHHHHHHHHHHH Q ss_conf 878851244300020001122--34324778653213688899886551023122204877878999999999986 Q gi|254780810|r 126 VPERVRNKIHFDNLTPLYPDK--RFNMELNNPENKDISSRVIDLIAPIGKGQRSLIVAPPRTGKTILLQNIAHSIK 199 (423) Q Consensus 126 ~~d~~~~~~~f~~l~p~~p~~--~i~le~~~~~p~~~~~~~id~~~pig~gqr~~i~~~~~~gkt~ll~~ia~~~~ 199 (423) T Consensus 4 ~p~~~~G~I~f~nVsf~Y~~~~~~~vL~--------------~is~~i~~Ge~vaIvG~sGsGKSTL~~ll~gl~~ 65 (226) T cd03248 4 APDHLKGIVKFQNVTFAYPTRPDTLVLQ--------------DVSFTLHPGEVTALVGPSGSGKSTVVALLENFYQ 65 (226) T ss_pred CCCCCEEEEEEEEEEEECCCCCCCEEEE--------------CEEEEECCCCEEEEECCCCCHHHHHHHHHHCCCC T ss_conf 6434555999998899889999994374--------------5389982999999999999849999999964546

HHsearch alignment for GI: 254780810 and conserved domain: cd03248