HHsearch alignment for GI: 254780810 and conserved domain: cd03252

>cd03252 ABCC_Hemolysin The ABC-transporter hemolysin B is a central component of the secretion machinery that translocates the toxin, hemolysin A, in a Sec-independent fashion across both membranes of E. coli. The hemolysin A (HlyA) transport machinery is composed of the ATP-binding cassette (ABC) transporter HlyB located in the inner membrane, hemolysin D (HlyD), also anchored in the inner membrane, and TolC, which resides in the outer membrane. HlyD apparently forms a continuous channel that bridges the entire periplasm, interacting with TolC and HlyB. This arrangement prevents the appearance of periplasmic intermediates of HlyA during substrate transport. Little is known about the molecular details of HlyA transport, but it is evident that ATP-hydrolysis by the ABC-transporter HlyB is a necessary source of energy.
Probab=94.10  E-value=0.036  Score=33.42  Aligned_cols=30  Identities=27%  Similarity=0.244  Sum_probs=26.6

Q ss_pred             HHHHCCCCEEEECCCCCCHHHHHHHHHHHH
Q ss_conf             655102312220487787899999999998
Q gi|254780810|r  169 APIGKGQRSLIVAPPRTGKTILLQNIAHSI  198 (423)
Q Consensus       169 ~pig~gqr~~i~~~~~~gkt~ll~~ia~~~  198 (423)
T Consensus        23 ~~i~~G~~vaivG~sGsGKSTll~ll~gl~   52 (237)
T cd03252          23 LRIKPGEVVGIVGRSGSGKSTLTKLIQRFY   52 (237)
T ss_pred             EEECCCCEEEEECCCCCHHHHHHHHHHCCC
T ss_conf             998799999999999985999999996776