>cd03256 ABC_PhnC_transporter ABC-type phosphate/phosphonate transport system. Phosphonates are a class of organophosphorus compounds characterized by a chemically stable carbon-to-phosphorus (C-P) bond. Phosphonates are widespread among naturally occurring compounds in all kingdoms of wildlife, but only procaryotic microorganisms are able to cleave this bond. Certain bacteria such as E. coli can use alkylphosphonates as a phosphorus source. ABC transporters are a subset of nucleotide hydrolases that contain a signature motif, Q-loop, and H-loop/switch region, in addition to, the Walker A motif/P-loop and Walker B motif commonly found in a number of ATP- and GTP-binding and hydrolyzing proteins.

Probab=95.24 E-value=0.013 Score=36.40 Aligned_cols=55 Identities=16% Similarity=0.399 Sum_probs=36.3 Q ss_pred HHHHCCCCEEEECCCCCCHHHHHHHHHHHHHHCCCCCEEEEE----ECCCCHHHHHHHHHHH Q ss_conf 655102312220487787899999999998611886469999----5087878999999840 Q gi|254780810|r 169 APIGKGQRSLIVAPPRTGKTILLQNIAHSIKKNHPECYLIVL----LIDERPEEVTDMQRSV 226 (423) Q Consensus 169 ~pig~gqr~~i~~~~~~gkt~ll~~ia~~~~~~~~~v~~i~~----ligEr~~ev~e~~~~~ 226 (423) T Consensus 22 l~i~~Ge~~~iiGpsGsGKSTLl~~i~gl~~---p~~G~I~~~g~~i~~~~~~~l~~~R~~i 80 (241) T cd03256 22 LSINPGEFVALIGPSGAGKSTLLRCLNGLVE---PTSGSVLIDGTDINKLKGKALRQLRRQI 80 (241) T ss_pred EEECCCCEEEEECCCCCHHHHHHHHHHCCCC---CCCEEEEECCEECCCCCHHHHHHHHCCC T ss_conf 8999998999999998339999999974999---9855999999998989989999986491

HHsearch alignment for GI: 254780810 and conserved domain: cd03256